Basement membrane-specific heparan sulfate proteoglycan core protein

Overview
NameBasement membrane-specific heparan sulfate proteoglycan core protein
Smed IDSMED30020058
Length (bp)3105
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Basement membrane-specific heparan sulfate proteoglycan core protein (SMED30020058) t-SNE clustered cells

Violin plots show distribution of expression levels for Basement membrane-specific heparan sulfate proteoglycan core protein (SMED30020058) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Basement membrane-specific heparan sulfate proteoglycan core protein (SMED30020058) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Basement membrane-specific heparan sulfate proteoglycan core protein (SMED30020058) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020058

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30020058h1SMcG0014919 Contig4415uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30020058h1SMcG0014919 Contig4415newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30020058h1SMcG0014919 Contig4415uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020058h1SMcG0014919 Contig4415newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020058h1SMcG0014919 Contig30849uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020058h1SMcG0014919 Contig30849newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020058h1SMcG0014919 Contig9067newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020058h1SMcG0014919 Contig9067uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020058h1SMcG0014919 Contig18922uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020058h1SMcG0014919 Contig18922newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30020058h1SMcG0014919 dd_Smed_v4_1054_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020058h1SMcG0014919 dd_Smed_v4_1054_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020058h1SMcG0014919 dd_Smed_v4_1054_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30020058h1SMcG0014919 Contig18922uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30020058h1SMcG0014919 Contig18922newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30020058h1SMcG0014919 dd_Smed_v6_1054_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020058h1SMcG0014919 dd_Smed_v6_1054_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30020058h1SMcG0014919 dd_Smed_v6_1054_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: HSPG2 (heparan sulfate proteoglycan 2 [Source:HGNC Symbol;Acc:HGNC:5273])

HSP 1 Score: 123.635 bits (309), Expect = 1.317e-27
Identity = 80/214 (37.38%), Postives = 105/214 (49.07%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDE-DQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLE--CGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVI-ESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            C      CRNG CI     CDG+ DC DGSDE D      C+P    C   NG   +       W CDG+ DC +  DEA C     E  CG  +++C      IP +F CD+++DC +  DE  C+ P ++    +S  I A RG+TVT TC   G P P I WR NWG + +  R+ V  E  R       TL I + +  D G Y CEA++
Sbjct:  285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG--NGHCALK-----LWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES--IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGRG------TLIIRDVKESDQGAYTCEAMN 483          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 87.4261 bits (215), Expect = 9.748e-17
Identity = 66/217 (30.41%), Postives = 94/217 (43.32%), Query Frame = 2
Query: 1841 IIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCET--YNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            I  +P +I    G+   F+C +    R    P   +          + T       K  + Y   T   N          S AE+   V   C      C++G+CI+    CDG  +C DGSDE QE C     LS  C++  ++    +N      W CDG+ DC NG DE  C      C   +++C+DG K I R F+CD D DC++G DE+ C
Sbjct:   28 IHESPSVILGPPGEVPGFRCALWRHLR----PHLVLGGALAPPAPIKFTEGPPATLKASVPYEVETLPQNLPA----PPWSAAEIFSHVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETC-----LSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKT--CSQDEFRCHDG-KCISRQFVCDSDRDCLDGSDEASC 228          

HSP 2 Score: 64.6994 bits (156), Expect = 7.928e-10
Identity = 55/170 (32.35%), Postives = 75/170 (44.12%), Query Frame = 2
Query: 2066 CRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCR-----QCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTL 2560
            C  G   A   VL    C   S  C +  CI     CD  PDC DGSDE  + CR     Q D  S  C  +           + W CDG  DC +  DE  C   V  C   ++QC+DG   I  +  CD++ DC +  DE  C+  + + E  + +K ++  GE +TL
Sbjct:  219 CLDGSDEASCPVLT---CGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGD--SSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENC--AVATCRPDEFQCSDG-NCIHGSRQCDREYDCKDMSDEVGCVN-VTLCEGPNKFKCHS--GECITL 377          

HSP 3 Score: 58.5362 bits (140), Expect = 6.822e-8
Identity = 41/131 (31.30%), Postives = 58/131 (44.27%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDE--AKCFGNVL------ECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            CS     C +G+CI+    CD   DC DGSDE       C P S +C +   +  +       WACD + DC +G DE   +C G  +       C   ++ C  G + I  ++ CD   DC +  DE  C
Sbjct:  194 CSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQL-------WACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSG-ECIHSSWRCDGGPDCKDKSDEENC 316          

HSP 4 Score: 56.6102 bits (135), Expect = 2.504e-7
Identity = 41/120 (34.17%), Postives = 56/120 (46.67%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            CS+    C +GECI+S+  CDG PDC D SDE+      C P   +C   N +            CD E DC +  DE  C    L  G  K++C+ G + I    +C+   DC +  DE
Sbjct:  282 CSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCI-------HGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSG-ECITLDKVCNMARDCRDWSDE 393          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 83.1889 bits (204), Expect = 1.775e-15
Identity = 49/123 (39.84%), Postives = 70/123 (56.91%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCET--YNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPII 2500
            C++G+CI+    CDG  +C DGSDE QE C     LS  C++  ++    +N      W CDG+ DC NG DE  C      C   +++C+DG K I R F+CD D DC++G DE+ C  P++
Sbjct:   34 CQDGKCISYKWVCDGSAECQDGSDESQETC-----LSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKT--CSQDEFRCHDG-KCISRQFVCDSDRDCLDGSDEASC--PVL 146          

HSP 2 Score: 65.0846 bits (157), Expect = 6.417e-10
Identity = 55/170 (32.35%), Postives = 75/170 (44.12%), Query Frame = 2
Query: 2066 CRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCR-----QCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTL 2560
            C  G   A   VL    C   S  C +  CI     CD  PDC DGSDE  + CR     Q D  S  C  +           + W CDG  DC +  DE  C   V  C   ++QC+DG   I  +  CD++ DC +  DE  C+  + + E  + +K ++  GE +TL
Sbjct:  134 CLDGSDEASCPVLT---CGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGD--SSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENC--AVATCRPDEFQCSDG-NCIHGSRQCDREYDCKDMSDEVGCVN-VTLCEGPNKFKCHS--GECITL 292          

HSP 3 Score: 58.5362 bits (140), Expect = 7.562e-8
Identity = 41/132 (31.06%), Postives = 58/132 (43.94%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDE--AKCFGNVL------ECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
             CS     C +G+CI+    CD   DC DGSDE       C P S +C +   +  +       WACD + DC +G DE   +C G  +       C   ++ C  G + I  ++ CD   DC +  DE  C
Sbjct:  108 TCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQL-------WACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSG-ECIHSSWRCDGGPDCKDKSDEENC 231          

HSP 4 Score: 56.6102 bits (135), Expect = 2.637e-7
Identity = 41/120 (34.17%), Postives = 56/120 (46.67%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            CS+    C +GECI+S+  CDG PDC D SDE+      C P   +C   N +            CD E DC +  DE  C    L  G  K++C+ G + I    +C+   DC +  DE
Sbjct:  197 CSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCI-------HGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSG-ECITLDKVCNMARDCRDWSDE 308          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 82.4185 bits (202), Expect = 2.670e-15
Identity = 50/130 (38.46%), Postives = 71/130 (54.62%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCET--YNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPII 2500
            C      C++G+CI+    CDG  +C DGSDE QE C     LS  C++  ++    +N      W CDG+ DC NG DE  C      C   +++C+DG K I R F+CD D DC++G DE+ C  P++
Sbjct:   27 CERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETC-----LSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKT--CSQDEFRCHDG-KCISRQFVCDSDRDCLDGSDEASC--PVL 146          

HSP 2 Score: 63.929 bits (154), Expect = 1.372e-9
Identity = 55/170 (32.35%), Postives = 75/170 (44.12%), Query Frame = 2
Query: 2066 CRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCR-----QCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTL 2560
            C  G   A   VL    C   S  C +  CI     CD  PDC DGSDE  + CR     Q D  S  C  +           + W CDG  DC +  DE  C   V  C   ++QC+DG   I  +  CD++ DC +  DE  C+  + + E  + +K ++  GE +TL
Sbjct:  134 CLDGSDEASCPVLT---CGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGD--SSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENC--AVATCRPDEFQCSDG-NCIHGSRQCDREYDCKDMSDEVGCVN-VTLCEGPNKFKCHS--GECITL 292          

HSP 3 Score: 57.7658 bits (138), Expect = 1.188e-7
Identity = 41/131 (31.30%), Postives = 58/131 (44.27%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDE--AKCF------GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            CS     C +G+CI+    CD   DC DGSDE       C P S +C +   +  +       WACD + DC +G DE   +C       G+   C   ++ C  G + I  ++ CD   DC +  DE  C
Sbjct:  109 CSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQL-------WACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSG-ECIHSSWRCDGGPDCKDKSDEENC 231          

HSP 4 Score: 55.8398 bits (133), Expect = 4.183e-7
Identity = 41/120 (34.17%), Postives = 56/120 (46.67%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            CS+    C +GECI+S+  CDG PDC D SDE+      C P   +C   N +            CD E DC +  DE  C    L  G  K++C+ G + I    +C+   DC +  DE
Sbjct:  197 CSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCI-------HGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSG-ECITLDKVCNMARDCRDWSDE 308          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 82.4185 bits (202), Expect = 2.735e-15
Identity = 50/130 (38.46%), Postives = 71/130 (54.62%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCET--YNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPII 2500
            C      C++G+CI+    CDG  +C DGSDE QE C     LS  C++  ++    +N      W CDG+ DC NG DE  C      C   +++C+DG K I R F+CD D DC++G DE+ C  P++
Sbjct:   27 CERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETC-----LSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKT--CSQDEFRCHDG-KCISRQFVCDSDRDCLDGSDEASC--PVL 146          

HSP 2 Score: 63.929 bits (154), Expect = 1.259e-9
Identity = 55/170 (32.35%), Postives = 75/170 (44.12%), Query Frame = 2
Query: 2066 CRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCR-----QCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTL 2560
            C  G   A   VL    C   S  C +  CI     CD  PDC DGSDE  + CR     Q D  S  C  +           + W CDG  DC +  DE  C   V  C   ++QC+DG   I  +  CD++ DC +  DE  C+  + + E  + +K ++  GE +TL
Sbjct:  134 CLDGSDEASCPVLT---CGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGD--SSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENC--AVATCRPDEFQCSDG-NCIHGSRQCDREYDCKDMSDEVGCVN-VTLCEGPNKFKCHS--GECITL 292          

HSP 3 Score: 57.7658 bits (138), Expect = 1.228e-7
Identity = 41/131 (31.30%), Postives = 58/131 (44.27%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDE--AKCF------GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            CS     C +G+CI+    CD   DC DGSDE       C P S +C +   +  +       WACD + DC +G DE   +C       G+   C   ++ C  G + I  ++ CD   DC +  DE  C
Sbjct:  109 CSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQL-------WACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSG-ECIHSSWRCDGGPDCKDKSDEENC 231          

HSP 4 Score: 55.8398 bits (133), Expect = 4.180e-7
Identity = 41/120 (34.17%), Postives = 56/120 (46.67%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            CS+    C +GECI+S+  CDG PDC D SDE+      C P   +C   N +            CD E DC +  DE  C    L  G  K++C+ G + I    +C+   DC +  DE
Sbjct:  197 CSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCI-------HGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSG-ECITLDKVCNMARDCRDWSDE 308          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 120.168 bits (300), Expect = 4.627e-27
Identity = 101/321 (31.46%), Postives = 147/321 (45.79%), Query Frame = 2
Query: 1835 LRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMAN-GGRAADTQRTTVEKLEAGKVQL----TYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSR----------LCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFG--NVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            ++I V P   ++R G+  +F+C    +  S  YP    A  GG    +   +  +L    VQL    TY  V+  +  T     + R+T  V+       S+G R           C N EC+ +   CDG+PDC D SDE       C  +S+ CE        N   Q  W CDG+DDCG+  DE  C    +  +C   ++QC+D  + +P +F CD   DC +G DE  C+QP ++     + ++   RG T +LTC+    P P I WR NWG +    R +             TLTI + QP D G Y CEA++
Sbjct:   45 VQITVFPSEKEVRDGRDVSFECRARTSDNS-VYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGTYICVSDYNGNTV----EARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDE-----ANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQV--PRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSE-----GGYGTLTIHDAQPVDQGAYTCEAIN 348          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 120.168 bits (300), Expect = 4.643e-27
Identity = 101/321 (31.46%), Postives = 148/321 (46.11%), Query Frame = 2
Query: 1835 LRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMAN-GGRAADTQRTTVEKLEAGKVQL----TYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSR----------LCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFG--NVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            ++I V P   ++R G+  +F+C    +  S  YP    A  GG    +   +  +L    VQL    TY  V+  +  T     + R+T  V+       S+G R           C N EC+ +   CDG+PDC D SDE       C  +S+ CE        N   Q  W CDG+DDCG+  DE  C    +  +C   ++QC+D  + +P +F CD   DC +G DE  C+QP ++     + ++   RG T +LTC+    P P I WR NWG +    R +     +       TLTI + QP D G Y CEA++
Sbjct:  834 VQITVFPSEKEVRDGRDVSFECRARTSDNS-VYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGTYICVSDYNGNTV----EARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDE-----ANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQV--PRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCL-----QTSEGGYGTLTIHDAQPVDQGAYTCEAIN 1137          

HSP 2 Score: 62.7734 bits (151), Expect = 1.832e-9
Identity = 49/140 (35.00%), Postives = 64/140 (45.71%), Query Frame = 2
Query: 1967 ADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKG---RSTAEVLVLVDPV------CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC 2359
            A+  R TV K +  K  L     T  D+GT     +G    +  EV +  D V      C SG R C++G C+  A+FCD +  C DG DE+     QC     RCE+ N   P   +      CDG  DC +G DE KC
Sbjct:  217 AEDGRVTVYK-KGDKHHLHIINATDADDGTYKMIVQGINVEADFEVRITSDRVATESDECPSGERACKSGHCLPVAQFCDRRVQCPDGDDEEHCSEVQCKSNEFRCESTNVCVPTVVV------CDGWKDCHDGSDEKKC 349          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 120.168 bits (300), Expect = 4.956e-27
Identity = 101/321 (31.46%), Postives = 148/321 (46.11%), Query Frame = 2
Query: 1835 LRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMAN-GGRAADTQRTTVEKLEAGKVQL----TYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSR----------LCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFG--NVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            ++I V P   ++R G+  +F+C    +  S  YP    A  GG    +   +  +L    VQL    TY  V+  +  T     + R+T  V+       S+G R           C N EC+ +   CDG+PDC D SDE       C  +S+ CE        N   Q  W CDG+DDCG+  DE  C    +  +C   ++QC+D  + +P +F CD   DC +G DE  C+QP ++     + ++   RG T +LTC+    P P I WR NWG +    R +     +       TLTI + QP D G Y CEA++
Sbjct:   45 VQITVFPSEKEVRDGRDVSFECRARTSDNS-VYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGTYICVSDYNGNTV----EARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDE-----ANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQV--PRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCL-----QTSEGGYGTLTIHDAQPVDQGAYTCEAIN 348          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 120.168 bits (300), Expect = 5.105e-27
Identity = 101/321 (31.46%), Postives = 148/321 (46.11%), Query Frame = 2
Query: 1835 LRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMAN-GGRAADTQRTTVEKLEAGKVQL----TYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSR----------LCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFG--NVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            ++I V P   ++R G+  +F+C    +  S  YP    A  GG    +   +  +L    VQL    TY  V+  +  T     + R+T  V+       S+G R           C N EC+ +   CDG+PDC D SDE       C  +S+ CE        N   Q  W CDG+DDCG+  DE  C    +  +C   ++QC+D  + +P +F CD   DC +G DE  C+QP ++     + ++   RG T +LTC+    P P I WR NWG +    R +     +       TLTI + QP D G Y CEA++
Sbjct:   45 VQITVFPSEKEVRDGRDVSFECRARTSDNS-VYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGTYICVSDYNGNTV----EARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDE-----ANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQV--PRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCL-----QTSEGGYGTLTIHDAQPVDQGAYTCEAIN 348          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 119.783 bits (299), Expect = 5.413e-27
Identity = 101/321 (31.46%), Postives = 148/321 (46.11%), Query Frame = 2
Query: 1835 LRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMAN-GGRAADTQRTTVEKLEAGKVQL----TYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSR----------LCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFG--NVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            ++I V P   ++R G+  +F+C    +  S  YP    A  GG    +   +  +L    VQL    TY  V+  +  T     + R+T  V+       S+G R           C N EC+ +   CDG+PDC D SDE       C  +S+ CE        N   Q  W CDG+DDCG+  DE  C    +  +C   ++QC+D  + +P +F CD   DC +G DE  C+QP ++     + ++   RG T +LTC+    P P I WR NWG +    R +     +       TLTI + QP D G Y CEA++
Sbjct:   45 VQITVFPSEKEVRDGRDVSFECRARTSDNS-VYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGTYICVSDYNGNTV----EARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDE-----ANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQV--PRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCL-----QTSEGGYGTLTIHDAQPVDQGAYTCEAIN 348          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342821)

HSP 1 Score: 123.25 bits (308), Expect = 6.431e-28
Identity = 74/213 (34.74%), Postives = 106/213 (49.77%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC--FGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
             C+     C NGECI+ +  CDG PDC+D SDE      Q   L  +C+    +   +      W CDGE+DCG+  DE  C    +   C   ++QC  G   IP++F CD   DC +G DE  C+ P+ I+    S  ++    E + LTC  TG P P I+WR NWG + ++      +SY   G    TL   + +P D G Y+CE ++
Sbjct:  898 ACTEYQATCMNGECIDKSSICDGNPDCSDASDE------QSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSG-HCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS--VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDK---CESKSYGGTG----TLRCPDMRPQDSGAYSCEIIN 1094          

HSP 2 Score: 59.6918 bits (143), Expect = 1.817e-8
Identity = 133/630 (21.11%), Postives = 246/630 (39.05%), Query Frame = 2
Query:  104 VVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYEWID-----PRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWI-------TPSGERQSSSSFFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVF----GETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCR-INTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNP---KNVRFFEP-------------LELNCEVTPPLRDVTYEIYFNDRLISQS----SRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRV---RGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRV-EGYQTRNRD-VIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLI--VESDLRII-VTPP 1858
            ++ + E+ I +  G    + C  ++  S  P+  +W       P N     NV LTI    +E+ G Y+C A       LS+T  S+ ++ +++  +       IV    +TF+ G          G   +   EW+       +P  + QS      + +  E +G Y CR   I     + G A + V+  P +++ +  N       G+ +   C V     + +V      +      +  SN  IL++    +   G YTC   N    +  +V+ +V E R     + GG   +      + NP   +N    +P             + L C++  PL +  +E      L   +    +R  I R+++ N+G Y+C   GRD N        + +V +       +I     P   + V AG   ++HC++     ++ ++  W        S D  R     + R+  S++   +I Q   G+Y C      G   +   + + K  +    P  Q ++  +G  ++  C V + Y  R +D V +++   +   + N          +A  ++  ++LT    +DAG YIC    + D  R   +  V  DL+++  TPP
Sbjct: 2500 IIESLEQNILIIQGEDYSITC--EASGSPYPSI-KWAKVHDFMPENVHISGNV-LTIYGARFENRGVYSCVAENDHGSDLSST--SIDIEPRERPSVK------IVSAPLQTFSVGAPASLYCTVEGI-PDPTVEWVRVDGQPLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGE--ATGVATITVQE-PTLVQIIPDNRDLRLTEGDELSLTC-VGSGVPNPEVEWVNEMALKRDLYSPPSNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRVEVQERR----GDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPL-NTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQYRCNGIGRDGNV------KTYFVKELVLMPLPRIRFY--PNIPLTVEAGQNLDVHCQV---ENVRPEDVHW--------STDNNRPLPSSV-RIVGSVLRFVSITQAAAGEYRCSAFNQYGNRSQIARVAVKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWFRDDRRPLPN----------NARTDSQILVLTNLRPEDAGRYICN---SYDVDRGQQLPEVSIDLQVLTATPP 3074          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342809)

HSP 1 Score: 123.25 bits (308), Expect = 6.633e-28
Identity = 74/213 (34.74%), Postives = 106/213 (49.77%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC--FGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
             C+     C NGECI+ +  CDG PDC+D SDE      Q   L  +C+    +   +      W CDGE+DCG+  DE  C    +   C   ++QC  G   IP++F CD   DC +G DE  C+ P+ I+    S  ++    E + LTC  TG P P I+WR NWG + ++      +SY   G    TL   + +P D G Y+CE ++
Sbjct:  745 ACTEYQATCMNGECIDKSSICDGNPDCSDASDE------QSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSG-HCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS--VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDK---CESKSYGGTG----TLRCPDMRPQDSGAYSCEIIN 941          

HSP 2 Score: 60.8474 bits (146), Expect = 8.565e-9
Identity = 64/234 (27.35%), Postives = 99/234 (42.31%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCI--------QPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMNF 2794
            C +    C NG+CI++ K C+   DC++G DE++E CR C     RC   + V+   P       C+G  +C +  DE  C G   EC   +++CN G + +  +  C+  TDC +  DE  C           + ++   DS  I   R   V   C+  G    K+ W    G     R +    + RN       L I   +  D G Y CEA+  G  ++    Q+ +N 
Sbjct:  492 CQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEE-CR-CYANQFRCNNGDCVSGSAP-------CNGYSECSDHSDELNC-GGTQECLPNQFRCNSG-QCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESR--EVIFRCRDEGPARAKVKWSRPGG-----RPLPPGFTDRN-----GRLEIPNIRVEDAGTYVCEAV--GYASYIPGQQVTVNL 700          

HSP 3 Score: 60.8474 bits (146), Expect = 9.086e-9
Identity = 156/753 (20.72%), Postives = 277/753 (36.79%), Query Frame = 2
Query:  104 VVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYEWID-----PRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWI-------TPSGERQSSSSFFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVF----GETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCR-INTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNP---KNVRFFEP-------------LELNCEVTPPLRDVTYEIYFNDRLISQS----SRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRV---RGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRV-EGYQTRNRD-VIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANGGRAADTQRTTV--------EKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDE 2212
            ++ + E+ I +  G    + C  ++  S  P+  +W       P N     NV LTI    +E+ G Y+C A       LS+T  S+ ++ +++  +       IV    +TF+ G          G   +   EW+       +P  + QS      + +  E +G Y CR   I     + G A + V+  P +++ +  N       G+ +   C V     + +V      +      +  SN  IL++    +   G YTC   N    +  +V+ +V E R     + GG   +      + NP   +N    +P             + L C++  PL +  +E      L   +    +R  I R+++ N+G Y+C   GRD N        + +V +       +I     P   + V AG   ++HC++     ++ ++  W        S D  R     + R+  S++   +I Q   G+Y C      G   +   + + K  +    P  Q ++  +G  ++  C V + Y  R +D V +++   +   + N          +A  ++  ++LT    +DAG YIC    + D  R   + E  + + V                       R+P YP      G    DT    +         KL + K  ++  A TT      + C+            D  C S         C+ +   CDG  DC D SDE
Sbjct: 2285 IIESLEQNILIIQGEDYSITC--EASGSPYPSI-KWAKVHDFMPENVHISGNV-LTIYGARFENRGVYSCVAENDHGSDLSST--SIDIEPRERPSVK------IVSAPLQTFSVGAPASLYCTVEGI-PDPTVEWVRVDGQPLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGE--ATGVATITVQE-PTLVQIIPDNRDLRLTEGDELSLTC-VGSGVPNPEVEWVNEMALKRDLYSPPSNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRVEVQERR----GDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPL-NTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQYRCNGIGRDGNV------KTYFVKELVLMPLPRIRFY--PNIPLTVEAGQNLDVHCQV---ENVRPEDVHW--------STDNNRPLPSSV-RIVGSVLRFVSITQAAAGEYRCSAFNQYGNRSQIARVAVKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWFRDDRRPLPN----------NARTDSQILVLTNLRPEDAGRYICN---SYDVDRGQQLPEVSIDLQVL----------------------RAPQYPYNRFKGGVSLKDTPCMVLYICADFKSSKLSSAKPIISGPA-TTRAPAISYVCQPN----------DFKCVSHPHT-----CVRANMVCDGIYDCTDHSDE 2944          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342825)

HSP 1 Score: 123.25 bits (308), Expect = 7.005e-28
Identity = 74/213 (34.74%), Postives = 106/213 (49.77%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC--FGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
             C+     C NGECI+ +  CDG PDC+D SDE      Q   L  +C+    +   +      W CDGE+DCG+  DE  C    +   C   ++QC  G   IP++F CD   DC +G DE  C+ P+ I+    S  ++    E + LTC  TG P P I+WR NWG + ++      +SY   G    TL   + +P D G Y+CE ++
Sbjct:  976 ACTEYQATCMNGECIDKSSICDGNPDCSDASDE------QSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSG-HCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS--VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDK---CESKSYGGTG----TLRCPDMRPQDSGAYSCEIIN 1172          

HSP 2 Score: 59.6918 bits (143), Expect = 1.727e-8
Identity = 133/630 (21.11%), Postives = 246/630 (39.05%), Query Frame = 2
Query:  104 VVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYEWID-----PRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWI-------TPSGERQSSSSFFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVF----GETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCR-INTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNP---KNVRFFEP-------------LELNCEVTPPLRDVTYEIYFNDRLISQS----SRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRV---RGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRV-EGYQTRNRD-VIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLI--VESDLRII-VTPP 1858
            ++ + E+ I +  G    + C  ++  S  P+  +W       P N     NV LTI    +E+ G Y+C A       LS+T  S+ ++ +++  +       IV    +TF+ G          G   +   EW+       +P  + QS      + +  E +G Y CR   I     + G A + V+  P +++ +  N       G+ +   C V     + +V      +      +  SN  IL++    +   G YTC   N    +  +V+ +V E R     + GG   +      + NP   +N    +P             + L C++  PL +  +E      L   +    +R  I R+++ N+G Y+C   GRD N        + +V +       +I     P   + V AG   ++HC++     ++ ++  W        S D  R     + R+  S++   +I Q   G+Y C      G   +   + + K  +    P  Q ++  +G  ++  C V + Y  R +D V +++   +   + N          +A  ++  ++LT    +DAG YIC    + D  R   +  V  DL+++  TPP
Sbjct: 2516 IIESLEQNILIIQGEDYSITC--EASGSPYPSI-KWAKVHDFMPENVHISGNV-LTIYGARFENRGVYSCVAENDHGSDLSST--SIDIEPRERPSVK------IVSAPLQTFSVGAPASLYCTVEGI-PDPTVEWVRVDGQPLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGE--ATGVATITVQE-PTLVQIIPDNRDLRLTEGDELSLTC-VGSGVPNPEVEWVNEMALKRDLYSPPSNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRVEVQERR----GDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPL-NTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQYRCNGIGRDGNV------KTYFVKELVLMPLPRIRFY--PNIPLTVEAGQNLDVHCQV---ENVRPEDVHW--------STDNNRPLPSSV-RIVGSVLRFVSITQAAAGEYRCSAFNQYGNRSQIARVAVKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWFRDDRRPLPN----------NARTDSQILVLTNLRPEDAGRYICN---SYDVDRGQQLPEVSIDLQVLTATPP 3090          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342823)

HSP 1 Score: 123.25 bits (308), Expect = 7.158e-28
Identity = 74/213 (34.74%), Postives = 106/213 (49.77%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC--FGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
             C+     C NGECI+ +  CDG PDC+D SDE      Q   L  +C+    +   +      W CDGE+DCG+  DE  C    +   C   ++QC  G   IP++F CD   DC +G DE  C+ P+ I+    S  ++    E + LTC  TG P P I+WR NWG + ++      +SY   G    TL   + +P D G Y+CE ++
Sbjct:  742 ACTEYQATCMNGECIDKSSICDGNPDCSDASDE------QSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSG-HCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS--VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDK---CESKSYGGTG----TLRCPDMRPQDSGAYSCEIIN 938          

HSP 2 Score: 60.4622 bits (145), Expect = 9.247e-9
Identity = 64/234 (27.35%), Postives = 99/234 (42.31%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCI--------QPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMNF 2794
            C +    C NG+CI++ K C+   DC++G DE++E CR C     RC   + V+   P       C+G  +C +  DE  C G   EC   +++CN G + +  +  C+  TDC +  DE  C           + ++   DS  I   R   V   C+  G    K+ W    G     R +    + RN       L I   +  D G Y CEA+  G  ++    Q+ +N 
Sbjct:  519 CQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEE-CR-CYANQFRCNNGDCVSGSAP-------CNGYSECSDHSDELNC-GGTQECLPNQFRCNSG-QCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESR--EVIFRCRDEGPARAKVKWSRPGG-----RPLPPGFTDRN-----GRLEIPNIRVEDAGTYVCEAV--GYASYIPGQQVTVNL 727          

HSP 3 Score: 57.7658 bits (138), Expect = 6.835e-8
Identity = 125/601 (20.80%), Postives = 233/601 (38.77%), Query Frame = 2
Query:  104 VVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYEWID-----PRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWI-------TPSGERQSSSSFFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVF----GETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCR-INTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNP---KNVRFFEP-------------LELNCEVTPPLRDVTYEIYFNDRLISQS----SRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRV---RGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRV-EGYQTRNRD-VIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYIC 1780
            ++ + E+ I +  G    + C  ++  S  P+  +W       P N     NV LTI    +E+ G Y+C A       LS+T  S+ ++ +++  +       IV    +TF+ G          G   +   EW+       +P  + QS      + +  E +G Y CR   I     + G A + V+  P +++ +  N       G+ +   C V     + +V      +      +  SN  IL++    +   G YTC   N    +  +V+ +V E R     + GG   +      + NP   +N    +P             + L C++  PL +  +E      L   +    +R  I R+++ N+G Y+C   GRD N        + +V +       +I     P   + V AG   ++HC++     ++ ++  W        S D  R     + R+  S++   +I Q   G+Y C      G   +   + + K  +    P  Q ++  +G  ++  C V + Y  R +D V +++   +   + N          +A  ++  ++LT    +DAG YIC
Sbjct: 2282 IIESLEQNILIIQGEDYSITC--EASGSPYPSI-KWAKVHDFMPENVHISGNV-LTIYGARFENRGVYSCVAENDHGSDLSST--SIDIEPRERPSVK------IVSAPLQTFSVGAPASLYCTVEGI-PDPTVEWVRVDGQPLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGE--ATGVATITVQE-PTLVQIIPDNRDLRLTEGDELSLTC-VGSGVPNPEVEWVNEMALKRDLYSPPSNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRVEVQERR----GDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPL-NTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQYRCNGIGRDGNV------KTYFVKELVLMPLPRIRFY--PNIPLTVEAGQNLDVHCQV---ENVRPEDVHW--------STDNNRPLPSSV-RIVGSVLRFVSITQAAAGEYRCSAFNQYGNRSQIARVAVKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWFRDDRRPLPN----------NARTDSQILVLTNLRPEDAGRYIC 2830          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342811)

HSP 1 Score: 123.25 bits (308), Expect = 7.353e-28
Identity = 74/213 (34.74%), Postives = 106/213 (49.77%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC--FGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
             C+     C NGECI+ +  CDG PDC+D SDE      Q   L  +C+    +   +      W CDGE+DCG+  DE  C    +   C   ++QC  G   IP++F CD   DC +G DE  C+ P+ I+    S  ++    E + LTC  TG P P I+WR NWG + ++      +SY   G    TL   + +P D G Y+CE ++
Sbjct:  715 ACTEYQATCMNGECIDKSSICDGNPDCSDASDE------QSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSG-HCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS--VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDK---CESKSYGGTG----TLRCPDMRPQDSGAYSCEIIN 911          

HSP 2 Score: 60.4622 bits (145), Expect = 9.449e-9
Identity = 64/234 (27.35%), Postives = 99/234 (42.31%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCI--------QPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMNF 2794
            C +    C NG+CI++ K C+   DC++G DE++E CR C     RC   + V+   P       C+G  +C +  DE  C G   EC   +++CN G + +  +  C+  TDC +  DE  C           + ++   DS  I   R   V   C+  G    K+ W    G     R +    + RN       L I   +  D G Y CEA+  G  ++    Q+ +N 
Sbjct:  492 CQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEE-CR-CYANQFRCNNGDCVSGSAP-------CNGYSECSDHSDELNC-GGTQECLPNQFRCNSG-QCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESR--EVIFRCRDEGPARAKVKWSRPGG-----RPLPPGFTDRN-----GRLEIPNIRVEDAGTYVCEAV--GYASYIPGQQVTVNL 700          

HSP 3 Score: 59.6918 bits (143), Expect = 1.635e-8
Identity = 132/628 (21.02%), Postives = 244/628 (38.85%), Query Frame = 2
Query:  104 VVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYEWID-----PRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWI-------TPSGERQSSSSFFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVF----GETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCR-INTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNP---KNVRFFEP-------------LELNCEVTPPLRDVTYEIYFNDRLISQS----SRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRV---RGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRV-EGYQTRNRD-VIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDLRII-VTPP 1858
            ++ + E+ I +  G    + C  ++  S  P+  +W       P N     NV LTI    +E+ G Y+C A       LS+T  S+ ++ +++  +       IV    +TF+ G          G   +   EW+       +P  + QS      + +  E +G Y CR   I     + G A + V+  P +++ +  N       G+ +   C V     + +V      +      +  SN  IL++    +   G YTC   N    +  +V+ +V E R     + GG   +      + NP   +N    +P             + L C++  PL +  +E      L   +    +R  I R+++ N+G Y+C   GRD N        + +V +       +I     P   + V AG   ++HC++     ++ ++  W        S D  R     + R+  S++   +I Q   G+Y C      G   +   + + K  +    P  Q ++  +G  ++  C V + Y  R +D V +++   +   + N          +A  ++  ++LT    +DAG YIC      D  +    V  DL+++  TPP
Sbjct: 2255 IIESLEQNILIIQGEDYSITC--EASGSPYPSI-KWAKVHDFMPENVHISGNV-LTIYGARFENRGVYSCVAENDHGSDLSST--SIDIEPRERPSVK------IVSAPLQTFSVGAPASLYCTVEGI-PDPTVEWVRVDGQPLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGE--ATGVATITVQE-PTLVQIIPDNRDLRLTEGDELSLTC-VGSGVPNPEVEWVNEMALKRDLYSPPSNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRVEVQERR----GDIGGVDDDSDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPL-NTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQYRCNGIGRDGNV------KTYFVKELVLMPLPRIRFY--PNIPLTVEAGQNLDVHCQV---ENVRPEDVHW--------STDNNRPLPSSV-RIVGSVLRFVSITQAAAGEYRCSAFNQYGNRSQIARVAVKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWFRDDRRPLPN----------NARTDSQILVLTNLRPEDAGRYICNSYDV-DRGQQLPEVSIDLQVLTATPP 2829          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 128.642 bits (322), Expect = 1.885e-29
Identity = 76/215 (35.35%), Postives = 107/215 (49.77%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC---RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNV--LECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            C +    C+NG+CI+    CDG+ DC DGSDE +  C     C+P   +C+  NG   +       W CDG++DC +  DE  C        C   ++ C    K IP ++ CD++ DC +  DE  C  P +     +S  I A RG+TVT TC   G P+P I WR NWG +    R+ +I           TLTI + + GD G Y CEA++
Sbjct:  199 CRADQATCQNGQCISREYLCDGESDCTDGSDESR--CGTPSPCEPNEFKCQ--NGRCALK-----LWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEES--ITASRGDTVTFTCSAIGVPVPIITWRLNWGHIPANNRITMISENGQ-----GTLTIRDVKEGDQGAYTCEAIN 397          

HSP 2 Score: 67.3958 bits (163), Expect = 9.730e-11
Identity = 144/641 (22.46%), Postives = 223/641 (34.79%), Query Frame = 2
Query:  116 QEEAIFVELGHTVILQCRPQSVMSNVPTTYEWIDPRNNL---RGSNVN--LTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSSFFKN------QVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNP-----VFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPK-NVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQS-----SRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNS--------TYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYEC---RVRGETKEAYIIVMAKSKNTEVSPSQQTR-KVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDT--ARATLIVESDLRIIVTP------PIIKLRSGQTATFQCYVLG 1912
            + +A  V +G TV   C  +S +     T  W    N     R  + N  LTI N   E  G Y C  S +    L     S  L V    G+       + P V       +    C      +     EWI  SG+R SS +  +N       V     G+Y C+         + G   VQ    P  +  V  +P       GET+   C+   S T        +  W       I    +  ++L D    GTY C + T +          I++  T       +  N  S      P  +V   E L+LNC V P     + +      L+S +     +R  I R    + G Y C      S     ++ +         T +I  E  SA              V+ G+     C+  V+ G Q     W     ++ +N     N++V P    SIM + N Q  N+G Y C    + G T     +++ +S    V+P+   R +VGD  P+   C+  G       V W  L      + +             + ++ I +  A  +D+G Y+C+    + T   R  + VE   ++   P      P+I +  G TAT  C   G
Sbjct: 1692 EPKAQSVRVGSTVSFICTAKSKLPAY--TLVWTRKGNGKLPNRAMDFNGILTIQNVQPEDAGIYVCTGSNM----LGMDEGSAVLYVPAAEGV--QPVATLSPPVQTVKEGDVAQFRCTVTGNPTP--AVEWIGGSGKRISSKAVIRNGQLTISSVDRSDEGEYICKALNTHGEHTARGVLHVQSTGQPNGLPHVQVSPQRVEIYEGETLRLYCRAIGSPTP-------SLKWNKMDRTDIGTLVVPNIRLSDA---GTYLC-VGTNAAGSSEAH---IDVSVT-------KGENILSGVIIQPPSASVIEGEALDLNCLV-PGTSTGSVKWSRAGGLLSSNHQVLETRLRILRASADDTGDYICTVENGPSPQKATVSVSVTSSASRLQTPIISIEPHSA-------------VVKQGESASFRCK--VHNGAQPVRLEW-----KLTNNLPLPDNVKVGPD--SSIMTVTNAQAKNQGTYRCVASNLYGMTHSIVSLIVRESPKAVVTPAGPVRVRVGD--PINLECQAAG--EPRPSVRWHRLDNNRKTMLS--------STVPVDSSAIIQVLVARPEDSGTYVCSAQNNQGTTETRVEVFVEGGPQVPTVPRASVREPMIIVVEGSTATLHCDAHG 2266          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 128.642 bits (322), Expect = 1.969e-29
Identity = 76/215 (35.35%), Postives = 107/215 (49.77%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC---RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNV--LECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            C +    C+NG+CI+    CDG+ DC DGSDE +  C     C+P   +C+  NG   +       W CDG++DC +  DE  C        C   ++ C    K IP ++ CD++ DC +  DE  C  P +     +S  I A RG+TVT TC   G P+P I WR NWG +    R+ +I           TLTI + + GD G Y CEA++
Sbjct:  199 CRADQATCQNGQCISREYLCDGESDCTDGSDESR--CGTPSPCEPNEFKCQ--NGRCALK-----LWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEES--ITASRGDTVTFTCSAIGVPVPIITWRLNWGHIPANNRITMISENGQ-----GTLTIRDVKEGDQGAYTCEAIN 397          

HSP 2 Score: 68.1662 bits (165), Expect = 6.946e-11
Identity = 144/641 (22.46%), Postives = 226/641 (35.26%), Query Frame = 2
Query:  116 QEEAIFVELGHTVILQCRPQSVMSNVPTTYEWIDPRNNL---RGSNVN--LTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSSFFKN------QVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNP-----VFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPK-NVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQS-----SRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNS--------TYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYEC---RVRGETKEAYIIVMAKSKNTEVSPSQQTR-KVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDT--ARATLIVESDLRIIVTP------PIIKLRSGQTATFQCYVLG 1912
            + +A  V +G TV   C  +S +     T  W    N     R  + N  LTI N   E  G Y C  S +    L     S  L V    G+       + P V       +    C      +     EWI  SG+R SS +  +N       V     G+Y C+         + G   VQ    P  +  V  +P       GET+   C+   S T +  ++       D    ++ N     ++L D    GTY C + T +          I++  T       +  N  S      P  +V   E L+LNC V P     + +      L+S +     +R  I R    + G Y C      S     ++ +         T +I  E  SA              V+ G+     C+  V+ G Q     W     ++ +N     N++V P    SIM + N Q  N+G Y C    + G T     +++ +S    V+P+   R +VGD  P+   C+  G       V W  L      + +             + ++ I +  A  +D+G Y+C+    + T   R  + VE   ++   P      P+I +  G TAT  C   G
Sbjct: 1696 EPKAQSVRVGSTVSFICTAKSKLPAY--TLVWTRKGNGKLPNRAMDFNGILTIQNVQPEDAGIYVCTGSNM----LGMDEGSAVLYVPAAEGV--QPVATLSPPVQTVKEGDVAQFRCTVTGNPTP--AVEWIGGSGKRISSKAVIRNGQLTISSVDRSDEGEYICKALNTHGEHTARGVLHVQSTGQPNGLPHVQVSPQRVEIYEGETLRLYCRAIGSPTPSLKWNKARMDRTDIGTLVVPN-----IRLSDA---GTYLC-VGTNAAGSSEAH---IDVSVT-------KGENILSGVIIQPPSASVIEGEALDLNCLV-PGTSTGSVKWSRAGGLLSSNHQVLETRLRILRASADDTGDYICTVENGPSPQKATVSVSVTSSASRLQTPIISIEPHSA-------------VVKQGESASFRCK--VHNGAQPVRLEW-----KLTNNLPLPDNVKVGPD--SSIMTVTNAQAKNQGTYRCVASNLYGMTHSIVSLIVRESPKAVVTPAGPVRVRVGD--PINLECQAAG--EPRPSVRWHRLDNNRKTMLS--------STVPVDSSAIIQVLVARPEDSGTYVCSAQNNQGTTETRVEVFVEGGPQVPTVPRASVREPMIIVVEGSTATLHCDAHG 2272          

HSP 3 Score: 51.2174 bits (121), Expect = 8.828e-6
Identity = 140/647 (21.64%), Postives = 226/647 (34.93%), Query Frame = 2
Query:  104 VVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYEWIDPRNNLRGSNVN-------LTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDK-TGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSSFFKNQVG--------PEFTGQYTCRMTRISDNQVSEGKAFV----QVKALP-IMIEKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQI----LRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNC--EVTPPLRDVTYE-IYFNDRLIS----QSSRHTIPRLDKTNMGVYQCVSRGRDSNTNEL----INYNSTYVIQAEFKSASKIELSEPPGPQIFVRA-GDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRVRGETKEAY----IIVMAKSK-NTEVSPSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQT--RDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLG 1912
            +++ +  +  V+ G +   +C+  +     P   EW    N     NV        +T+TN   ++ G Y C AS +     S  +  +R   K   T  G    +V  P          I + C+ A     + ++  +  + +   SS+   +           PE +G Y C          +  + FV    QV  +P   + +     V G T    C       D   F   T +W   ++++    +I    L L    +   G Y C          ++    + I    D+         Y+T    N  +VR  E + L C    TPPLR   YE    N  L S    Q     I    + + G Y+CV+  +   +  L    + Y  T+         S   LS    PQ+ V+A G   E  C      GLQ +   W  +G  +  N + +  I          + + N++Q+NEG Y CRV  + + A     +++ A  K    V  S QT  VG+   VEF C   G       V WS +         I               + + + Q    D+G Y CT       + +   L ++S  +I   P   ++  G  A   C   G
Sbjct: 2058 IISIEPHSAVVKQGESASFRCKVHNGAQ--PVRLEWKLTNNLPLPDNVKVGPDSSIMTVTNAQAKNQGTYRCVASNLYGMTHSIVSLIVRESPKAVVTPAGPVRVRVGDP----------INLECQAAGEPRPSVRWHRLDNNRKTMLSSTVPVDSSAIIQVLVARPEDSGTYVCSAQNNQGTTETRVEVFVEGGPQVPTVPRASVREPMIIVVEGSTATLHC-------DAHGFPKPTITWFKERSSLPWRHKIVDNSLILPNVGRQDSGQYVCNATN------HLGTSEVTIMLEVDTP-------PYATSLP-NDVSVRVGEVIRLQCLAHGTPPLR---YEWTKINGSLPSTAQLQGGDLQINLAKENDAGTYRCVASNKVGKSEALAKVSVRYFFTFPHLELCPVFSAASLSVKVSPQVEVKALGSAVEFTC--AAKGGLQIE---WLKEGGVLPPNHHIKDGI----------LRIENLEQSNEGIYTCRVTSQFEHAQDSAKLLIQALPKVKINVRTSVQTVMVGNS--VEFECHAIG--DPEPTVRWSKVGAPLPDHVEI-------------RGNILRIDQVFESDSGQYRCTATNDVGSEHSHVVLNIQSLPQIAALPESKEVTIGSDAVLPCIASG 2636          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 128.642 bits (322), Expect = 2.399e-29
Identity = 76/214 (35.51%), Postives = 106/214 (49.53%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC---RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNV--LECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEAL 2743
            C +    C+NG+CI+    CDG+ DC DGSDE +  C     C+P   +C+  NG   +       W CDG++DC +  DE  C        C   ++ C    K IP ++ CD++ DC +  DE  C  P +     +S  I A RG+TVT TC   G P+P I WR NWG +    R+ +I           TLTI + + GD G Y CEA+
Sbjct:  264 CRADQATCQNGQCISREYLCDGESDCTDGSDESR--CGTPSPCEPNEFKCQ--NGRCALK-----LWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEES--ITASRGDTVTFTCSAIGVPVPIITWRLNWGHIPANNRITMISENGQ-----GTLTIRDVKEGDQGAYTCEAI 461          

HSP 2 Score: 67.781 bits (164), Expect = 8.026e-11
Identity = 144/641 (22.46%), Postives = 223/641 (34.79%), Query Frame = 2
Query:  116 QEEAIFVELGHTVILQCRPQSVMSNVPTTYEWIDPRNNL---RGSNVN--LTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSSFFKN------QVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNP-----VFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPK-NVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQS-----SRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNS--------TYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYEC---RVRGETKEAYIIVMAKSKNTEVSPSQQTR-KVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDT--ARATLIVESDLRIIVTP------PIIKLRSGQTATFQCYVLG 1912
            + +A  V +G TV   C  +S +     T  W    N     R  + N  LTI N   E  G Y C  S +    L     S  L V    G+       + P V       +    C      +     EWI  SG+R SS +  +N       V     G+Y C+         + G   VQ    P  +  V  +P       GET+   C+   S T        +  W       I    +  ++L D    GTY C + T +          I++  T       +  N  S      P  +V   E L+LNC V P     + +      L+S +     +R  I R    + G Y C      S     ++ +         T +I  E  SA              V+ G+     C+  V+ G Q     W     ++ +N     N++V P    SIM + N Q  N+G Y C    + G T     +++ +S    V+P+   R +VGD  P+   C+  G       V W  L      + +             + ++ I +  A  +D+G Y+C+    + T   R  + VE   ++   P      P+I +  G TAT  C   G
Sbjct: 1757 EPKAQSVRVGSTVSFICTAKSKLPAY--TLVWTRKGNGKLPNRAMDFNGILTIQNVQPEDAGIYVCTGSNM----LGMDEGSAVLYVPAAEGV--QPVATLSPPVQTVKEGDVAQFRCTVTGNPTP--AVEWIGGSGKRISSKAVIRNGQLTISSVDRSDEGEYICKALNTHGEHTARGVLHVQSTGQPNGLPHVQVSPQRVEIYEGETLRLYCRAIGSPTP-------SLKWNKMDRTDIGTLVVPNIRLSDA---GTYLC-VGTNAAGSSEAH---IDVSVT-------KGENILSGVIIQPPSASVIEGEALDLNCLV-PGTSTGSVKWSRAGGLLSSNHQVLETRLRILRASADDTGDYICTVENGPSPQKATVSVSVTSSASRLQTPIISIEPHSA-------------VVKQGESASFRCK--VHNGAQPVRLEW-----KLTNNLPLPDNVKVGPD--SSIMTVTNAQAKNQGTYRCVASNLYGMTHSIVSLIVRESPKAVVTPAGPVRVRVGD--PINLECQAAG--EPRPSVRWHRLDNNRKTMLS--------STVPVDSSAIIQVLVARPEDSGTYVCSAQNNQGTTETRVEVFVEGGPQVPTVPRASVREPMIIVVEGSTATLHCDAHG 2331          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 81.6481 bits (200), Expect = 3.469e-15
Identity = 52/129 (40.31%), Postives = 69/129 (53.49%), Query Frame = 2
Query: 2105 VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC--RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            V   C+    +CR+G+CI     CDG+PDC DGSDE  E C  R C      C    G     P++   W CDGE DC NG DE  C GN+  C  L++ C+ G + + R F+C+ + DC +G DE  C
Sbjct:   64 VRKTCAEVDFVCRSGQCIPKRWQCDGEPDCEDGSDESIEMCHTRTCRVNEFSCGV--GSTQCIPVF---WKCDGEKDCDNGEDEINC-GNIT-CAPLEFTCSSG-RCVSRKFVCNGEDDCGDGSDEQDC 184          

HSP 2 Score: 65.4698 bits (158), Expect = 3.005e-10
Identity = 45/124 (36.29%), Postives = 57/124 (45.97%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDG-TKSIPRAFICDKDTDCVNGDDESRC 2485
            C      C NG CI S   CDG  DC+DGSDE          + K C   + V          W CDGE DC +G DE+    +   C   ++ C  G T+ IP  + CD + DC NG+DE  C
Sbjct:   29 CEQSQFQCGNGRCIPSVWQCDGDMDCSDGSDETS-------CVRKTCAEVDFVCRSGQCIPKRWQCDGEPDCEDGSDESIEMCHTRTCRVNEFSCGVGSTQCIPVFWKCDGEKDCDNGEDEINC 145          

HSP 3 Score: 58.151 bits (139), Expect = 6.097e-8
Identity = 41/121 (33.88%), Postives = 59/121 (48.76%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGL-KYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            CS     C +GECI+    CDG PDC DGSDE     R C P   +C+  + +            C+G  DC +G DE  C  N+ +C    +++C  G + I  + +C+K  DC +  DE
Sbjct:  235 CSPSEMQCGSGECIHRKWRCDGDPDCKDGSDEKNCSARNCRPDQFKCDDGSCI-------HGSRQCNGFRDCVDGTDEVNC-KNLTQCNSSDQFKCRSG-ECIEMSKVCNKVRDCPDWSDE 346          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 81.6481 bits (200), Expect = 3.671e-15
Identity = 52/129 (40.31%), Postives = 69/129 (53.49%), Query Frame = 2
Query: 2105 VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC--RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            V   C+    +CR+G+CI     CDG+PDC DGSDE  E C  R C      C    G     P++   W CDGE DC NG DE  C GN+  C  L++ C+ G + + R F+C+ + DC +G DE  C
Sbjct:   64 VRKTCAEVDFVCRSGQCIPKRWQCDGEPDCEDGSDESIEMCHTRTCRVNEFSCGV--GSTQCIPVF---WKCDGEKDCDNGEDEINC-GNIT-CAPLEFTCSSG-RCVSRKFVCNGEDDCGDGSDEQDC 184          

HSP 2 Score: 65.4698 bits (158), Expect = 3.284e-10
Identity = 45/124 (36.29%), Postives = 57/124 (45.97%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDG-TKSIPRAFICDKDTDCVNGDDESRC 2485
            C      C NG CI S   CDG  DC+DGSDE          + K C   + V          W CDGE DC +G DE+    +   C   ++ C  G T+ IP  + CD + DC NG+DE  C
Sbjct:   29 CEQSQFQCGNGRCIPSVWQCDGDMDCSDGSDETS-------CVRKTCAEVDFVCRSGQCIPKRWQCDGEPDCEDGSDESIEMCHTRTCRVNEFSCGVGSTQCIPVFWKCDGEKDCDNGEDEINC 145          

HSP 3 Score: 57.7658 bits (138), Expect = 6.601e-8
Identity = 41/121 (33.88%), Postives = 59/121 (48.76%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGL-KYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            CS     C +GECI+    CDG PDC DGSDE     R C P   +C+  + +            C+G  DC +G DE  C  N+ +C    +++C  G + I  + +C+K  DC +  DE
Sbjct:  235 CSPSEMQCGSGECIHRKWRCDGDPDCKDGSDEKNCSARNCRPDQFKCDDGSCI-------HGSRQCNGFRDCVDGTDEVNC-KNLTQCNSSDQFKCRSG-ECIEMSKVCNKVRDCPDWSDE 346          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 120.553 bits (301), Expect = 8.952e-27
Identity = 73/205 (35.61%), Postives = 98/205 (47.80%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQ-EFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCF--GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEAL 2743
            C NG+CI     CDG+ DC DGSDE        C+P   +C+  NG   +       W CDG++DCG+G DE  C   G    C   ++ C      IP ++ CD + DC +  DE  C  P +I    +S  I A RG+TV  TC   G P P I WR NWG +    R+ +     +      TL I + +  D G Y CEA+
Sbjct:  259 CPNGQCIPRDYLCDGEKDCKDGSDEMHCGTPSPCEPNEFKCK--NGRCALK-----LWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEES--IMASRGDTVRFTCVAIGVPTPIITWRLNWGHIPTSSRVSMTSENGH-----GTLIIRDVKEADQGAYTCEAI 449          

HSP 2 Score: 53.9138 bits (128), Expect = 1.919e-6
Identity = 118/585 (20.17%), Postives = 198/585 (33.85%), Query Frame = 2
Query:  251 LTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSS-----FFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALP-IMIEKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISN--DQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRL-----DKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQI-----FVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEET-SFIILTQAEMKDAGVYICTEPQTRDTARATLIV---------ESDLR-----IIVTPPIIKLRSGQTATFQCYV 1906
            LTI     E  G Y C  S + D  +   N +L +Q    T   S N      Q+         F      +   A    EW  P+G     +         + V P   GQYTCR+   +    +     V   +LP + +         G+TV   C+   +        + T SW     ++        LR+        G Y CR+     N    Q   I I  T  S     S N  + R   +   +   + LELNC + P   +     + + + +S + + + PRL        + G Y C        T   +   ++ ++     S   I L   P  +I      V  G   EL+C   V  G       W+  G+ ++ N           ++  S + + +    + G+Y CR++         +M   + + +S  Q T   G G P+      E  +      +        G +            S  + + S + + QA   D+G+YIC       +  A++ +           D R     I + P    ++ GQ ATF+C +
Sbjct: 1736 LTIRRVQPEDAGIYVCTGSNMYD--MDEGNATLYVQAGTAT---SPNAAAEPRQLTVQRGQTAEFRCTATGTPTPA---VEWTGPNGGLSPRAVVQGGVLRFHSVEPSDEGQYTCRVHNSAGQHFARVDLRVHSGSLPEVQVSPERTEVREGDTVRLYCRAGGTP-------AATISWRKEGGSLPPQAYGSKLRILQASTADSGEYICRVT----NGAATQQASIIITITRSSGPQQPSGNVPALRIEPSSDTLVEGQTLELNC-LFPSYPNAVVTWHRSGQPLSPNHQVSGPRLRILQASVADSGEYIC------RVTTGPVTQKASILVTITRASGPSIPLGNGPAVRIETSSGSVVEGQTLELNC---VVAGQPDAVVTWHRAGRLLSPNH----------QVSGSRLRITHASPRDSGEYICRIQSGAGVQMASIMVSIEGSSLSEYQDT---GLGSPIRIESSSETVELGQTIELNCLAEGHPGAVVTWHRSGGLPLPSNHQVSGSRMRILQASPADSGIYICRVSSASGSQEASVTINVHSSAQGEPGDARLQSPVISIDPHSATVQRGQNATFKCRI 2278          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 118.627 bits (296), Expect = 3.509e-26
Identity = 74/207 (35.75%), Postives = 99/207 (47.83%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFC---RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCF--GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEAL 2743
            C NG+CI     CDG+ DC DGSDE    C     C+P   +C+  NG   +       W CDG++DCG+G DE  C   G    C   ++ C      IP ++ CD + DC +  DE  C  P +I    +S  I A RG+TV  TC   G P P I WR NWG +    R+ +     +      TL I + +  D G Y CEA+
Sbjct:  226 CPNGQCIPRDYLCDGEKDCKDGSDEMH--CGTPSPCEPNEFKCK--NGRCALK-----LWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEES--IMASRGDTVRFTCVAIGVPTPIITWRLNWGHIPTSSRVSMTSENGH-----GTLIIRDVKEADQGAYTCEAI 416          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 114.775 bits (286), Expect = 4.745e-25
Identity = 74/205 (36.10%), Postives = 96/205 (46.83%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQ-EFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCF--GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEAL 2743
            C NG+CI     CDG+ DC DGSDE        C+P   +C+  NG   +       W CDG++DCG+G DE  C   G    C   ++ C      IP ++ CD + DC +  DE  C  P +I    +S  I A RG+TV  TC   G P P I WR NWG        +   S  N      TL I + +  D G Y CEA+
Sbjct:  202 CPNGQCIPRDYLCDGEKDCKDGSDEMHCGTPSPCEPNEFKCK--NGRCALK-----LWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEES--IMASRGDTVRFTCVAIGVPTPIITWRLNWG-------HIPTSSSEN---GHGTLIIRDVKEADQGAYTCEAI 387          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: ppp2r2b (protein phosphatase 2 regulatory subunit B, beta [Source:Xenbase;Acc:XB-GENE-946380])

HSP 1 Score: 78.1814 bits (191), Expect = 7.768e-14
Identity = 43/113 (38.05%), Postives = 55/113 (48.67%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            C+NG CI++A  CDG+ DC DG DE       CD     C         N      W CDGEDDCGNG DE++     + C    + C      +P  ++CD + DC NG DE
Sbjct: 2555 CQNGRCISNAWVCDGQRDCEDGRDE-----LHCD---TSCSWSQFACSKNKCISKQWVCDGEDDCGNGLDESEELCGSVTCAAGFFSCPGSHACVPSHWLCDGERDCPNGSDE 2659          

HSP 2 Score: 73.559 bits (179), Expect = 2.217e-12
Identity = 46/126 (36.51%), Postives = 59/126 (46.83%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC-RQCDPLSKRCETYN-GVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGG-LKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C+     C +G CI +   CDG  DC D SDE    C R   P+S  CE       P        W CDGE DC +G DE  C G + +C    K+ C +  + I  A++CD D DC +  DE  C
Sbjct:  982 CTDKQFRCSSGRCIPAHWVCDGDNDCGDFSDETHANCSRTVSPVSGACEAKQFQCHPDGNCIPELWLCDGEKDCEDGSDERGCNGTLRQCDAKTKFACKNTGRCISNAWVCDGDIDCEDHSDEDYC 1107          

HSP 3 Score: 68.5514 bits (166), Expect = 6.485e-11
Identity = 44/121 (36.36%), Postives = 61/121 (50.41%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            +C+S    C+N  CI  +  CDG+ DC DGSDED E C     L+  C         N      W CDG +DCG+  DE+        C   +Y CN+G + I  ++ICD++ DC +  DE
Sbjct:  829 LCNSEEFQCKNYRCIQESWKCDGEDDCLDGSDEDFENC-----LNHSCPNDQFKCRSNRCIPKRWLCDGANDCGSNEDESNETCLARTCQPHQYSCNNG-RCISLSWICDQEDDCGDRSDE 943          

HSP 4 Score: 64.3142 bits (155), Expect = 1.285e-9
Identity = 42/123 (34.15%), Postives = 57/123 (46.34%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C  G   C +G C   A  CDG+ DC D SDE       C     +C       PIN        C+G++DCG+  DE  C  N   C    +QC      I + ++CD+D+DC +G DE+ C
Sbjct: 3223 CQPGRFQCGSGLCALPAFICDGENDCGDNSDELNCDTYVCLSGQFKCTKKQKCIPIN------LRCNGQNDCGDEEDEIDCPEN--SCSPDHFQCKTTKHCISKLWVCDEDSDCADGSDEANC 3337          

HSP 5 Score: 62.003 bits (149), Expect = 6.383e-9
Identity = 49/154 (31.82%), Postives = 70/154 (45.45%), Query Frame = 2
Query: 2033 VTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRL-CRNGECINSAKFCDGKPDCADGSDEDQEFC--RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            + T D     +CR  R         +  C+  S   C NGECI   + CDG   C D SDE Q +C  R C    + C  +  + P N +      C+ EDDCG+  DE  C   +  C   +++C DGT  I ++  C++  DC +  DE  C
Sbjct: 2348 LITPDGRINCSCRGDRVLVNDNRCKNSSCNMFSEFECANGECIEYHQTCDGIVHCKDRSDEKQSYCENRSCWRGFRLCGNHRCI-PNNKV------CNDEDDCGDNSDELDC--KISTCASTEFRCTDGT-CITKSAQCNQIIDCADASDEKNC 2491          

HSP 6 Score: 60.077 bits (144), Expect = 2.301e-8
Identity = 41/125 (32.80%), Postives = 58/125 (46.40%), Query Frame = 2
Query: 2150 ECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC--FGNVLE-----------CGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
             CI+    CD   DCADGSDE     + C     +C+  N +         HW CDG++DCG+  DE  C  F ++L+           C   ++ C++G   I   F CD + DC +G DE  C
Sbjct: 3314 HCISKLWVCDEDSDCADGSDEANCDKKACGLHEFQCKNKNCIPD-------HWRCDGQNDCGDNSDEESCSKFYSILQINIIQCSASFTCALKEFLCSNG-DCISSRFWCDGEYDCADGKDEKNC 3430          

HSP 7 Score: 58.5362 bits (140), Expect = 8.151e-8
Identity = 47/151 (31.13%), Postives = 69/151 (45.70%), Query Frame = 2
Query: 2045 DNGTRFTCRKGRSTAEVLVL---VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDP----LSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            DN    +C K  S  ++ ++       C+    LC NG+CI+S  +CDG+ DCADG DE     + C+P       RC       P+       W CDG  DC +G DE  C          ++ CN+ T    + ++CD + DC +  DE
Sbjct: 3369 DNSDEESCSKFYSILQINIIQCSASFTCALKEFLCSNGDCISSRFWCDGEYDCADGKDE-----KNCEPGIYTNQFRCRNRAYCIPL------RWFCDGVQDCVDGSDEDNCE------RADEFLCNN-TLCKLQLWLCDGEDDCGDNSDE 3501          

HSP 8 Score: 58.151 bits (139), Expect = 8.868e-8
Identity = 45/132 (34.09%), Postives = 58/132 (43.94%), Query Frame = 2
Query: 2105 VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC--RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICD---KDTDCVNGDDESRC 2485
            ++  C +    CR+  CI     CDG  DC    DE  E C  R C P    C     ++         W CD EDDCG+  DE      +  CG  KYQ     +S PR+ IC+    + DC +G DES C
Sbjct:  867 LNHSCPNDQFKCRSNRCIPKRWLCDGANDCGSNEDESNETCLARTCQPHQYSCNNGRCIS-------LSWICDQEDDCGDRSDE------MASCG--KYQ-----RSPPRSLICNIFTANDDCGDGSDESGC 978          

HSP 9 Score: 56.9954 bits (136), Expect = 2.150e-7
Identity = 43/128 (33.59%), Postives = 57/128 (44.53%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPI---YQAHWACDGEDDCGNGYDEAKCFG-NVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
             C+S    C +G CI  +  C+   DCAD SDE       C    K      G    N         W CDG +DCG+  DE KC   N  +C    ++C +G + I  A++CD   DC +G DE  C
Sbjct: 2456 TCASTEFRCTDGTCITKSAQCNQIIDCADASDEKNCNNTDCTHYYKLGVKTAGFIRCNSTSLCILPEWICDGANDCGDYSDELKCPAQNKQKCEENYFECQNG-RCISNAWVCDGQRDCEDGRDELHC 2582          

HSP 10 Score: 56.9954 bits (136), Expect = 2.460e-7
Identity = 41/114 (35.96%), Postives = 55/114 (48.25%), Query Frame = 2
Query: 2144 NGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINP--IYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQC-NDGTKSIPRAFICDKDTDCVNGDDE 2476
            +G CI     CDG+ DC DGSDE     R C+   ++C+     A  N        W CDG+ DC +  DE  C G +  CG  KY C ND +  +    +C+   DC +G DE
Sbjct: 1039 DGNCIPELWLCDGEKDCEDGSDE-----RGCNGTLRQCDAKTKFACKNTGRCISNAWVCDGDIDCEDHSDEDYCEGYI--CGPPKYPCANDTSICLQPEKLCNGRRDCPDGSDE 1145          

HSP 11 Score: 56.6102 bits (135), Expect = 2.839e-7
Identity = 45/145 (31.03%), Postives = 58/145 (40.00%), Query Frame = 2
Query: 2060 FTCRKGRSTAEVLVL--------------VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQ--CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDE---AKCFGNVLECGGLKYQCNDGTKSIPRAFI 2437
            F C+ GR  +   V                D  CS     C   +CI+    CDG+ DC +G DE +E C    C      C   +   P      +HW CDGE DC NG DE   A C   V  C    + CN+    IP+ F+
Sbjct: 2553 FECQNGRCISNAWVCDGQRDCEDGRDELHCDTSCSWSQFACSKNKCISKQWVCDGEDDCGNGLDESEELCGSVTCAAGFFSCPGSHACVP------SHWLCDGERDCPNGSDELSTADC-APVTTCDENAFMCNNKV-CIPKQFM 2689          

HSP 12 Score: 55.4546 bits (132), Expect = 6.824e-7
Identity = 46/161 (28.57%), Postives = 62/161 (38.51%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDE------------------------------DQEFCR-QCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDE--AKCFGNVL----ECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
             C      C NG CI+ +  CD + DC D SDE                              D+  C   C     RC +   +        AHW CDG++DCG+  DE  A C   V      C   ++QC+     IP  ++CD + DC +G DE  C
Sbjct:  911 TCQPHQYSCNNGRCISLSWICDQEDDCGDRSDEMASCGKYQRSPPRSLICNIFTANDDCGDGSDESGCSLSCTDKQFRCSSGRCIP-------AHWVCDGDNDCGDFSDETHANCSRTVSPVSGACEAKQFQCHPDGNCIPELWLCDGEKDCEDGSDERGC 1064          

HSP 13 Score: 53.9138 bits (128), Expect = 2.059e-6
Identity = 40/125 (32.00%), Postives = 54/125 (43.20%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDED---------QEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C+N  CI     CDG+ DC D SDE+         Q    QC   S  C     +        + + CDGE DC +G DE  C   +      +++C +    IP  + CD   DCV+G DE  C
Sbjct: 3349 CKNKNCIPDHWRCDGQNDCGDNSDEESCSKFYSILQINIIQCSA-SFTCALKEFLCSNGDCISSRFWCDGEYDCADGKDEKNCEPGIYT---NQFRCRNRAYCIPLRWFCDGVQDCVDGSDEDNC 3469          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: ppp2r2b (protein phosphatase 2 regulatory subunit B, beta [Source:Xenbase;Acc:XB-GENE-946380])

HSP 1 Score: 78.1814 bits (191), Expect = 8.011e-14
Identity = 43/113 (38.05%), Postives = 55/113 (48.67%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            C+NG CI++A  CDG+ DC DG DE       CD     C         N      W CDGEDDCGNG DE++     + C    + C      +P  ++CD + DC NG DE
Sbjct: 2563 CQNGRCISNAWVCDGQRDCEDGRDE-----LHCD---TSCSWSQFACSKNKCISKQWVCDGEDDCGNGLDESEELCGSVTCAAGFFSCPGSHACVPSHWLCDGERDCPNGSDE 2667          

HSP 2 Score: 73.1738 bits (178), Expect = 2.508e-12
Identity = 44/123 (35.77%), Postives = 60/123 (48.78%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            CS     C  G+CI++   CDG  DC  G DE     + C+P+S  C +   V        A+  C+GE DC +G DE  C   V EC   +++C +    IP  + CD   DCV+G DE  C
Sbjct: 3427 CSKEQFQCSTGQCISAKWKCDGHEDCKSGEDE-----KNCEPVSPTCSSSEYVCDSGGCVSAYLRCNGEYDCADGSDENDC---VAECKENQFRCRNRAYCIPLRWFCDGVQDCVDGSDEDNC 3541          

HSP 3 Score: 68.9366 bits (167), Expect = 5.458e-11
Identity = 44/121 (36.36%), Postives = 61/121 (50.41%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            +C+S    C+N  CI  +  CDG+ DC DGSDED E C     L+  C         N      W CDG +DCG+  DE+        C   +Y CN+G + I  ++ICD++ DC +  DE
Sbjct:  830 LCNSEEFQCKNYRCIQESWKCDGEDDCLDGSDEDFENC-----LNHSCPNDQFKCRSNRCIPKRWLCDGANDCGSNEDESNETCLARTCQPHQYSCNNG-RCISLSWICDQEDDCGDRSDE 944          

HSP 4 Score: 64.3142 bits (155), Expect = 1.269e-9
Identity = 42/123 (34.15%), Postives = 57/123 (46.34%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C  G   C +G C   A  CDG+ DC D SDE       C     +C       PIN        C+G++DCG+  DE  C  N   C    +QC      I + ++CD+D+DC +G DE+ C
Sbjct: 3231 CQPGRFQCGSGLCALPAFICDGENDCGDNSDELNCDTYVCLSGQFKCTKKQKCIPIN------LRCNGQNDCGDEEDEIDCPEN--SCSPDHFQCKTTKHCISKLWVCDEDSDCADGSDEANC 3345          

HSP 5 Score: 62.003 bits (149), Expect = 6.800e-9
Identity = 42/118 (35.59%), Postives = 59/118 (50.00%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFC--RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C NGECI   + CDG   C D SDE Q +C  R C    + C  +  + P N +      C+ EDDCG+  DE  C   +  C   +++C DGT  I ++  C++  DC +  DE  C
Sbjct: 2392 CANGECIEYHQTCDGIVHCKDRSDEKQSYCENRSCWRGFRLCGNHRCI-PNNKV------CNDEDDCGDNSDELDC--KISTCASTEFRCTDGT-CITKSAQCNQIIDCADASDEKNC 2499          

HSP 6 Score: 61.2326 bits (147), Expect = 1.269e-8
Identity = 40/126 (31.75%), Postives = 58/126 (46.03%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEF--CRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGG-LKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C+     C +G CI +   CDG  DC D S + +     R     +K+ + +    P        W CDGE DC +G DE  C G + +C    K+ C +  + I  A++CD D DC +  DE  C
Sbjct:  992 CTDKQFRCSSGRCIPAHWVCDGDNDCGDFSMDSRRISGLRHWHSPAKQFQCH----PDGNCIPELWLCDGEKDCEDGSDERGCNGTLRQCDAKTKFACKNTGRCISNAWVCDGDIDCEDHSDEDYC 1113          

HSP 7 Score: 60.8474 bits (146), Expect = 1.404e-8
Identity = 39/112 (34.82%), Postives = 53/112 (47.32%), Query Frame = 2
Query: 2150 ECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
             CI+    CD   DCADGSDE     + C     +C+  N +         HW CDG++DCG+  DE  C      C   ++ C++G   I   F CD + DC +G DE  C
Sbjct: 3322 HCISKLWVCDEDSDCADGSDEANCDKKACGLHEFQCKNKNCIPD-------HWRCDGQNDCGDNSDEESCKPQT--CALKEFLCSNG-DCISSRFWCDGEYDCADGSDERNC 3423          

HSP 8 Score: 60.4622 bits (145), Expect = 2.035e-8
Identity = 43/125 (34.40%), Postives = 64/125 (51.20%), Query Frame = 2
Query: 2105 VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC-FGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            V P CSS   +C +G C+++   C+G+ DCADGSDE+ +   +C     RC       P+       W CDG  DC +G DE  C   N+  C   ++ CN+ T    + ++CD + DC +  DE
Sbjct: 3464 VSPTCSSSEYVCDSGGCVSAYLRCNGEYDCADGSDEN-DCVAECKENQFRCRNRAYCIPL------RWFCDGVQDCVDGSDEDNCERANI--CRADEFLCNN-TLCKLQLWLCDGEDDCGDNSDE 3578          

HSP 9 Score: 56.9954 bits (136), Expect = 2.000e-7
Identity = 43/128 (33.59%), Postives = 57/128 (44.53%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPI---YQAHWACDGEDDCGNGYDEAKCFG-NVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
             C+S    C +G CI  +  C+   DCAD SDE       C    K      G    N         W CDG +DCG+  DE KC   N  +C    ++C +G + I  A++CD   DC +G DE  C
Sbjct: 2464 TCASTEFRCTDGTCITKSAQCNQIIDCADASDEKNCNNTDCTHYYKLGVKTAGFIRCNSTSLCILPEWICDGANDCGDYSDELKCPAQNKQKCEENYFECQNG-RCISNAWVCDGQRDCEDGRDELHC 2590          

HSP 10 Score: 56.9954 bits (136), Expect = 2.428e-7
Identity = 43/115 (37.39%), Postives = 57/115 (49.57%), Query Frame = 2
Query: 2144 NGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINP---IYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQC-NDGTKSIPRAFICDKDTDCVNGDDE 2476
            +G CI     CDG+ DC DGSDE     R C+   ++C+     A  N    I  A W CDG+ DC +  DE  C G +  CG  KY C ND +  +    +C+   DC +G DE
Sbjct: 1045 DGNCIPELWLCDGEKDCEDGSDE-----RGCNGTLRQCDAKTKFACKNTGRCISNA-WVCDGDIDCEDHSDEDYCEGYI--CGPPKYPCANDTSICLQPEKLCNGRRDCPDGSDE 1151          

HSP 11 Score: 56.6102 bits (135), Expect = 3.234e-7
Identity = 45/145 (31.03%), Postives = 58/145 (40.00%), Query Frame = 2
Query: 2060 FTCRKGRSTAEVLVL--------------VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQ--CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDE---AKCFGNVLECGGLKYQCNDGTKSIPRAFI 2437
            F C+ GR  +   V                D  CS     C   +CI+    CDG+ DC +G DE +E C    C      C   +   P      +HW CDGE DC NG DE   A C   V  C    + CN+    IP+ F+
Sbjct: 2561 FECQNGRCISNAWVCDGQRDCEDGRDELHCDTSCSWSQFACSKNKCISKQWVCDGEDDCGNGLDESEELCGSVTCAAGFFSCPGSHACVP------SHWLCDGERDCPNGSDELSTADC-APVTTCDENAFMCNNKV-CIPKQFM 2697          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Hspg2 (perlecan (heparan sulfate proteoglycan 2) [Source:MGI Symbol;Acc:MGI:96257])

HSP 1 Score: 128.642 bits (322), Expect = 2.693e-29
Identity = 79/217 (36.41%), Postives = 103/217 (47.47%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQ---CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCF----GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            C      C +G CI     CDG+ DC DGSDE    C     C+P    CE  NG   +       W CDG+ DC +  DEA C     G V  CG   +QC    + IP +F CD+++DC +  DE  C+ P ++     S  I A RG+TVT TC  TG P P I WR NWG +    R+ +            TL I + +  D G Y CEA++
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDELG--CASPPPCEPNEFACE--NGHCALK-----LWRCDGDFDCEDRTDEANCSVKQPGEV--CGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQS--IQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSE-----GGRGTLIIRDVKEADQGAYTCEAMN 483          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Hspg2 (perlecan (heparan sulfate proteoglycan 2) [Source:MGI Symbol;Acc:MGI:96257])

HSP 1 Score: 128.257 bits (321), Expect = 2.786e-29
Identity = 79/217 (36.41%), Postives = 103/217 (47.47%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQ---CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCF----GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            C      C +G CI     CDG+ DC DGSDE    C     C+P    CE  NG   +       W CDG+ DC +  DEA C     G V  CG   +QC    + IP +F CD+++DC +  DE  C+ P ++     S  I A RG+TVT TC  TG P P I WR NWG +    R+ +            TL I + +  D G Y CEA++
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDELG--CASPPPCEPNEFACE--NGHCALK-----LWRCDGDFDCEDRTDEANCSVKQPGEV--CGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQS--IQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSE-----GGRGTLIIRDVKEADQGAYTCEAMN 483          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 79.337 bits (194), Expect = 1.618e-14
Identity = 49/130 (37.69%), Postives = 67/130 (51.54%), Query Frame = 2
Query: 2105 VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQP 2494
            V   C+    +C+NG+C+ +   CDG PDC DGSDE  E   QC   + R    +  A         W CDGE+DC NG DE  C GN+  C   ++ C+ G + + R F+C+   DC +G DE  C  P
Sbjct:   68 VKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPE---QCHMRTCRINEISCGARSTQCIPVSWRCDGENDCDNGEDEENC-GNIT-CSADEFTCSSG-RCVSRNFVCNGQDDCDDGSDELDCAPP 191          

HSP 2 Score: 68.5514 bits (166), Expect = 3.482e-11
Identity = 48/130 (36.92%), Postives = 59/130 (45.38%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAK-------CFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C S    C NG CI     CDG  DCADGSDE     + C  + K C   + V          W CDG+ DC +G DE+        C  N + CG    QC      IP ++ CD + DC NG+DE  C
Sbjct:   33 CDSSQFQCTNGRCITLLWKCDGDEDCADGSDE-----KNC--VKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCHMRTCRINEISCGARSTQC------IPVSWRCDGENDCDNGEDEENC 149          

HSP 3 Score: 64.3142 bits (155), Expect = 7.863e-10
Identity = 51/183 (27.87%), Postives = 72/183 (39.34%), Query Frame = 2
Query: 2060 FTCRKGRSTAEVLVL---------------VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLT 2563
            FTC  GR  +   V                  P C +    C    CI  +  CD   DC+D SDE  E C +   +  +C T              W CDG+ DC +G DE  C      C   +++C DG+  I  +  C+   DCV+G DE  C     + + L   K   R GE + ++
Sbjct:  159 FTCSSGRCVSRNFVCNGQDDCDDGSDELDCAPPTCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDESLEQCGRQPVIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRT--CRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKN---VNQCLGPGKFKCRSGECIDMS 335          

HSP 4 Score: 58.9214 bits (141), Expect = 3.684e-8
Identity = 44/126 (34.92%), Postives = 62/126 (49.21%), Query Frame = 2
Query: 2102 LVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLEC-GGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            ++   C +    C +GECI+    CDG PDC DGSDE     R C P    CE  + +            C+G  DC +G DE  C  NV +C G  K++C  G + I  + +CD++ DC +  DE
Sbjct:  234 VIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCI-------HGSRQCNGIRDCVDGSDEVNC-KNVNQCLGPGKFKCRSG-ECIDMSKVCDQEQDCRDWSDE 350          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 79.337 bits (194), Expect = 1.712e-14
Identity = 49/130 (37.69%), Postives = 67/130 (51.54%), Query Frame = 2
Query: 2105 VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQP 2494
            V   C+    +C+NG+C+ +   CDG PDC DGSDE  E   QC   + R    +  A         W CDGE+DC NG DE  C GN+  C   ++ C+ G + + R F+C+   DC +G DE  C  P
Sbjct:   68 VKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPE---QCHMRTCRINEISCGARSTQCIPVSWRCDGENDCDNGEDEENC-GNIT-CSADEFTCSSG-RCVSRNFVCNGQDDCDDGSDELDCAPP 191          

HSP 2 Score: 68.5514 bits (166), Expect = 3.607e-11
Identity = 48/130 (36.92%), Postives = 59/130 (45.38%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAK-------CFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C S    C NG CI     CDG  DCADGSDE     + C  + K C   + V          W CDG+ DC +G DE+        C  N + CG    QC      IP ++ CD + DC NG+DE  C
Sbjct:   33 CDSSQFQCTNGRCITLLWKCDGDEDCADGSDE-----KNC--VKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCHMRTCRINEISCGARSTQC------IPVSWRCDGENDCDNGEDEENC 149          

HSP 3 Score: 64.3142 bits (155), Expect = 7.429e-10
Identity = 51/183 (27.87%), Postives = 72/183 (39.34%), Query Frame = 2
Query: 2060 FTCRKGRSTAEVLVL---------------VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLT 2563
            FTC  GR  +   V                  P C +    C    CI  +  CD   DC+D SDE  E C +   +  +C T              W CDG+ DC +G DE  C      C   +++C DG+  I  +  C+   DCV+G DE  C     + + L   K   R GE + ++
Sbjct:  159 FTCSSGRCVSRNFVCNGQDDCDDGSDELDCAPPTCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDESLEQCGRQPVIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRT--CRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKN---VNQCLGPGKFKCRSGECIDMS 335          

HSP 4 Score: 58.9214 bits (141), Expect = 3.830e-8
Identity = 44/126 (34.92%), Postives = 62/126 (49.21%), Query Frame = 2
Query: 2102 LVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLEC-GGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            ++   C +    C +GECI+    CDG PDC DGSDE     R C P    CE  + +            C+G  DC +G DE  C  NV +C G  K++C  G + I  + +CD++ DC +  DE
Sbjct:  234 VIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCI-------HGSRQCNGIRDCVDGSDEVNC-KNVNQCLGPGKFKCRSG-ECIDMSKVCDQEQDCRDWSDE 350          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 78.1814 bits (191), Expect = 3.544e-14
Identity = 53/164 (32.32%), Postives = 81/164 (49.39%), Query Frame = 2
Query: 2105 VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQ--CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDES--RCIQPIIIQESLDSYKINARRGETVTLTCQVTGFP 2584
            V   C+    +C+NG+C+ +   CDG PDC DGSDE  E CR   C      C +   V+        ++ C+G+DDC +G DE  C      CG  ++QC+  +  IP +++CD D DC +  DES  +C +  +I     + +I    GE +    +  G P
Sbjct:   68 VKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCRNITCSADEFTCSSGRCVS-------RNFVCNGQDDCDDGSDELDCAPPT--CGAHEFQCS-TSSCIPLSWVCDDDADCSDQSDESLEQCGRQPVIHTKCPTSEIQCGSGECIHKKWRCDGDP 221          

HSP 2 Score: 67.3958 bits (163), Expect = 8.538e-11
Identity = 44/126 (34.92%), Postives = 59/126 (46.83%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQP 2494
            C S    C NG CI     CDG  DCADGSDE     + C  + K C   + V          W CDG+ DC +G DE+      + C   ++ C+ G + + R F+C+   DC +G DE  C  P
Sbjct:   33 CDSSQFQCTNGRCITLLWKCDGDEDCADGSDE-----KNC--VKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCRNITCSADEFTCSSG-RCVSRNFVCNGQDDCDDGSDELDCAPP 150          

HSP 3 Score: 64.3142 bits (155), Expect = 7.199e-10
Identity = 51/183 (27.87%), Postives = 72/183 (39.34%), Query Frame = 2
Query: 2060 FTCRKGRSTAEVLVL---------------VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLT 2563
            FTC  GR  +   V                  P C +    C    CI  +  CD   DC+D SDE  E C +   +  +C T              W CDG+ DC +G DE  C      C   +++C DG+  I  +  C+   DCV+G DE  C     + + L   K   R GE + ++
Sbjct:  118 FTCSSGRCVSRNFVCNGQDDCDDGSDELDCAPPTCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDESLEQCGRQPVIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRT--CRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKN---VNQCLGPGKFKCRSGECIDMS 294          

HSP 4 Score: 58.9214 bits (141), Expect = 3.333e-8
Identity = 44/126 (34.92%), Postives = 62/126 (49.21%), Query Frame = 2
Query: 2102 LVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLEC-GGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            ++   C +    C +GECI+    CDG PDC DGSDE     R C P    CE  + +            C+G  DC +G DE  C  NV +C G  K++C  G + I  + +CD++ DC +  DE
Sbjct:  193 VIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCI-------HGSRQCNGIRDCVDGSDEVNC-KNVNQCLGPGKFKCRSG-ECIDMSKVCDQEQDCRDWSDE 309          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|P98160|PGBM_HUMAN (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4)

HSP 1 Score: 123.635 bits (309), Expect = 6.323e-27
Identity = 80/214 (37.38%), Postives = 105/214 (49.07%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDE-DQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLE--CGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVI-ESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            C      CRNG CI     CDG+ DC DGSDE D      C+P    C   NG   +       W CDG+ DC +  DEA C     E  CG  +++C      IP +F CD+++DC +  DE  C+ P ++    +S  I A RG+TVT TC   G P P I WR NWG + +  R+ V  E  R       TL I + +  D G Y CEA++
Sbjct:  285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG--NGHCALK-----LWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRES--IQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGRG------TLIIRDVKESDQGAYTCEAMN 483          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|Q05793|PGBM_MOUSE (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 4.264e-26
Identity = 77/208 (37.02%), Postives = 101/208 (48.56%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQ-EFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCF----GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            C +G CI     CDG+ DC DGSDE        C+P    CE  NG   +       W CDG+ DC +  DEA C     G V  CG   +QC    + IP +F CD+++DC +  DE  C+ P ++     S  I A RG+TVT TC  TG P P I WR NWG +    R+ +            TL I + +  D G Y CEA++
Sbjct:  292 CHSGHCIPRDYLCDGQEDCRDGSDELGCASPPPCEPNEFACE--NGHCALK-----LWRCDGDFDCEDRTDEANCSVKQPGEV--CGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQS--IQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSE-----GGRGTLIIRDVKEADQGAYTCEAMN 483          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|Q06561|UNC52_CAEEL (Basement membrane proteoglycan OS=Caenorhabditis elegans OX=6239 GN=unc-52 PE=1 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 6.304e-26
Identity = 101/321 (31.46%), Postives = 148/321 (46.11%), Query Frame = 2
Query: 1835 LRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMAN-GGRAADTQRTTVEKLEAGKVQL----TYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSR----------LCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFG--NVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALS 2746
            ++I V P   ++R G+  +F+C    +  S  YP    A  GG    +   +  +L    VQL    TY  V+  +  T     + R+T  V+       S+G R           C N EC+ +   CDG+PDC D SDE       C  +S+ CE        N   Q  W CDG+DDCG+  DE  C    +  +C   ++QC+D  + +P +F CD   DC +G DE  C+QP ++     + ++   RG T +LTC+    P P I WR NWG +    R +     +       TLTI + QP D G Y CEA++
Sbjct:   45 VQITVFPSEKEVRDGRDVSFECRARTSDNS-VYPTVRWARVGGPLPSSAHDSGGRLTINPVQLSDAGTYICVSDYNGNTV----EARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDE-----ANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQV--PRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCL-----QTSEGGYGTLTIHDAQPVDQGAYTCEAIN 348          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|P35950|LDLR_CRIGR (Low-density lipoprotein receptor OS=Cricetulus griseus OX=10029 GN=LDLR PE=3 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 1.358e-15
Identity = 51/123 (41.46%), Postives = 64/123 (52.03%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C      CR+G+CI S   CDG P+C DGSDE  E C      SK       V+   P     W CDG+ DC NG DE  C      C   +++C DG K I + F+CD+D DCV+G DE+ C
Sbjct:   27 CDRNEFRCRDGKCIASKWVCDGSPECPDGSDESSETCMSVTCQSKEFSCGGRVSRCIP---NSWRCDGQTDCENGSDEQGCAPKT--CSQDEFRCQDG-KCISQKFVCDQDQDCVDGSDEAHC 143          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|P01131|LDLR_BOVIN (Low-density lipoprotein receptor OS=Bos taurus OX=9913 GN=LDLR PE=1 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 7.783e-15
Identity = 48/130 (36.92%), Postives = 69/130 (53.08%), Query Frame = 2
Query: 2105 VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQP 2494
            V+  C      C++G+CI+    CDG  +C DGSDE QE C+    ++ +   ++    +N      W CDG+ DC NG DE  C      C   +++CNDG K I   F+CD D DC++G DE+ C  P
Sbjct:   23 VEDNCGRNEFQCQDGKCISYKWVCDGTAECQDGSDESQETCKS---VTCKMGDFSCGGRVNRCISGSWRCDGQVDCENGSDEEGCSPKT--CSQDEFRCNDG-KCIAPKFVCDLDLDCLDGSDEASCPMP 146          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A1Z1R313 (Low density lipoprotein receptor-related 3 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1731.84 bits (4484), Expect = 0.000e+0
Identity = 860/927 (92.77%), Postives = 868/927 (93.64%), Query Frame = 2
Query:   86 ILSFLYVVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYEWIDPRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSSFFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEG----------------------------------------KYECRVRG-ETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEAL 2743
            ILSFLYVVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYEWIDPRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSSFFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVFGETVE KCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTG RSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEG                                        ++ CRV G +T+   +I    SK  E +PSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIDSRWSRSDDSAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLGAG SPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFT RKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAF+CDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNC  +
Sbjct:    1 ILSFLYVVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYEWIDPRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSSFFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVFGETVELKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGSRSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGNTNAGSEAKPKRLTSLYGKSKNTEVPPSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSK--ETAPSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIDSRWSRSDDSAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLGAGGSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFTRRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFVCDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCSHV 925          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A1Z1R275 (Low density lipoprotein receptor-related 1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 475.707 bits (1223), Expect = 1.327e-149
Identity = 282/802 (35.16%), Postives = 430/802 (53.62%), Query Frame = 2
Query:  437 IIFMACKEASGASANYKYEWITPSGERQSSSSF-FKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVFGETVEFKCQVDKSKTD-----NKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRL---YVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQT-RNRDVIWSFLSKETGQITNIXXXX-XXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDL---RIIVTPPIIKLRSGQTATFQCYVLGA-GRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRA-VTTNDNGTRFTCR-KGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVL-ECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLM 2788
             I +AC   + A       W+   G+  +++ + +   +  +  G Y C + ++ D Q+     F +   L I I  +S + +  E+++   Q+ +  +D       +   +TY+WL+ +N  I N  IL++ + D++  G Y C+  ++  +  Y     + ++              Y  +  +NP   R+ E   L CEV P  +++ Y  Y  D  I       I    K N+G Y+CV+  +  +    ++     + Q  F   SKIEL+  PGPQ++V  G+K+ELHCEI  ++G +GK A WY  G++  + D     I ++ RL   YVS++V+ +I Q NEG YECRV    KE  +IV+      E SP     KV +G  VEFHCRVE   + +N ++ W+F SKE     NI        +D  A++TSFI+L +AE+ D+G YICTEP  + TAR+ LIV  D     + +TP  I++R+GQ    +C+     GR+   PEF   N        R  +  +     +LT    ++ +DN     C  +GR  +  + + D +C  G R C+NGEC+ +AKFCD    CAD SDED   CR+CDP+S++CE  N V P    +  HW CDGE+DCGNGYDE  C G  L  CGG  + C+D  K+IPR ++CD++ DC  G+DE+ C  P I + S  + K+ A + + VTLTC+ TG PLP ++WRFNWGC+ N  R        +C +  S+LTI +F+ GDDGIYNCEALS  +R++S D+Q+++
Sbjct:   47 FINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIR----FNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLK----------QSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGK--LDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGD-----IPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPP--ILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQ-TARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSD-ICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQVLPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSD-NKTIPRGYVCDENIDCSQGEDETGCTSPQITKTS--ATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNSVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVIL 820          

HSP 2 Score: 65.855 bits (159), Expect = 4.020e-7
Identity = 104/501 (20.76%), Postives = 199/501 (39.72%), Query Frame = 2
Query:  197 TTYEWIDPRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASA----NYKYEWITPSGERQSSSSFFKNQVGPE-FTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPV---FGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQ--SMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPK-NVRFFEPLELNCEV--TPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKI-----ELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQE------INSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYEC-RVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTR 1624
            T+  W+D    +  +N  L I +   +  G Y C   ++ D ++   N++L L++     + S +  ++  +  +    G I   C +          ++ Y W+    +   +++  +  V  E   G+Y C+      +++ E   +V +K       K+  NP    +GE    +C+V+        + +  Y+W   K+  I NDQ L +K   +   GTY C  + Q  S     ++  + +  F  +S        E +T+    P+  V   E  EL+CE+  +   R    E Y N +         + RLD       Q VS    S+ +++   N    + +  K  + I      L E   P + V+ G   E HC +     ++  N  W F+ +E      I  + +   N ++  +   S +VL   + ++ G Y C    G+T  + +IV+       ++ + +  +V  G  V+  C  +  Q R
Sbjct:   62 TSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIR-FNRTLHLKIT----IPSISIDILPEESLKI--GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVE------PFYQNIKYTWY-KKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKI------ELTTK--PGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDG------QYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQ--TSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGR 532          

HSP 3 Score: 20.0162 bits (40), Expect = 4.020e-7
Identity = 11/28 (39.29%), Postives = 14/28 (50.00%), Query Frame = 1
Query:   25 TSPKVIS*FQLNEVSIVVFRYSVVSICC 108
            TSP  I+ F L   SIV      ++I C
Sbjct:   25 TSPPNITFFPLKNDSIVKSEMQFINIAC 52          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: T1DBM0 (LDL-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 472.241 bits (1214), Expect = 3.090e-148
Identity = 292/809 (36.09%), Postives = 431/809 (53.28%), Query Frame = 2
Query:  440 IFMACKEASGASANYKYEWITPSGERQSSSS--FFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVFGETVEFKCQVDKSKTDNK-----VFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEI-RFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGY-QTRNRDVIWSFLSKETGQITNIXXXX-XXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIV---ESDLRIIVTPPIIKLRSGQTATFQCYV-LGAGRSPDYPEFFMANG---GRAADTQRTTVEKLEAGKVQLTYRAVT----TNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLE-CGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMNFRN 2800
            +++ C   +     +   W+  +G   S +   +FK+ +     G Y C + + S   V   K F     L I I  +S N +  E+++   Q+ ++ +D K     +  + ++ W+D KN  +SN   L + + D++  GTY CR+ + + +  Y    ++ + R    +N        Y  + S+ P  + F +   LNC+VTP    + Y    ++  IS +    IP   K N+GVY+C++  +  N N L    +  + Q      SK+EL E PG  I V +G+K+ELHCEI V    +G    WY         D+   NI  + +  VS++V+RNI   NEGKYECR   + KE  I+V+ +    + +P     +V +G  VEFHCRV+ +   +N D+ W F SK+     +I +     ++    EETSF+ L  A M D G  ICTEP  + +A++ LIV   E ++ I +TP  I++R  Q    +C+     GR+   P+FF +N    GR A    TTV     G+  +   A      + DN   F C  G       + +   C  G R C+NG+C+ +AKFCDGK DC D SDED   C+ CDP+SK+CE + G+ P    Y  HWACDGE+DCGNGYDE  C    LE CGG  ++C+DG K+IPR ++CD++ DC NGDDE+ C  P II+ S  + +I A R + VT+TC+ +G PLP I+WRFNWGC+    R  V     NC    STLTI+ FQPGDDGIYNCEALS  +RA+S D+Q+++  RN
Sbjct:   55 LYVLCNVTNLKPNTFTARWLDKNGVVVSPNKILYFKSLLKHR-EGIYKCEVEKDS---VKSNKTF----QLNITIPSISINVLPDESLQIGGQISRNCSDFKSMNLSITDTLSHEWVDEKNKTVSNSNFLVIPIKDESVSGTYECRLKSFATSKVYTAKTMVNVQRKVVSAN--------YKIQISTTPGTITFAKMFTLNCDVTPS-NGIQYRWLKDNIEISTNKTIYIPSFKKENIGVYKCIAIVKLENGNNL-TLEAESLQQLTLFRHSKVELDETPGYTIIVHSGEKKELHCEIEVEAKKRGVEVEWYINNTLFRRGDFR--NIGRLDKELVSMLVIRNIVAQNEGKYECRYADKRKEINIVVLTEQGIIQTNPP--LLRVKEGQSVEFHCRVDNFANVKNVDLKWKFRSKDGSVTYDIPNDRWETTNPDITEETSFLELNSAVMADNGYLICTEPNGQ-SAQSELIVTAGEGNV-ITITPKEIRVRPHQRFDIECFTKTREGRASGQPKFFFSNNKAVGRDARFVETTV-----GQSHIRLSAPNGLPLSEDNMDVF-CGSGDQRVSSKIYIKDTCPPGHRYCQNGQCLENAKFCDGKVDCEDKSDEDPNLCKACDPISKKCEVHRGIIPTKNYYLVHWACDGEEDCGNGYDEENCGEGYLENCGGKFFKCSDG-KNIPRGYLCDQNADCDNGDDENLCTYPTIIKTS--TKEIKAARTQQVTMTCEASGKPLPAIVWRFNWGCIQQLPRFSVRSYSSNCTTVSSTLTINNFQPGDDGIYNCEALSSRQRAFSDDFQVVLQNRN 830          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A504YLF0 (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Fasciola gigantica OX=46835 GN=FGIG_04893 PE=4 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 7.868e-138
Identity = 279/833 (33.49%), Postives = 414/833 (49.70%), Query Frame = 2
Query:  407 PQVYETFASGIIFMACKEASGASANYKYEWI--TPSGERQSSSS----FFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQV-----KALP----IMIEKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTP-PLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSA--SKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDY--ARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGY-QTRNRDVIWSFLSKETGQI----TNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDL--RIIVTPPIIKLRSGQTATFQCYVL-GAGRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRA-VTTNDNGTRFTC--RKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFG-NVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLT-NERRMVVIESYRNCG----ATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMNF 2794
            P   E    G ++  C  ++  S  Y  +WI   P    Q  SS    +       E      C+ TR+SD Q  E    +++      +LP    + I  +    +    +  +C  + ++  N+ F    + WLD    +++N   L L L+D    G YTC    +S       N + + ++     +  ++     T        V    P E+ C V P P   VTY  Y NDR++   +R  +P L   ++G Y C                     +AE+  A     ++S PPG  +    G+ RELHCE G    L   +  W+F+GQ +  +    A   +  + RL VSI+ L  ++  + G YECR+ G+ K+ ++IV  +    EV+PS+ T  V +G PVEFHCR  G  Q  NR++ W +     G I     N ++ + R D   A  TSFI   +A   D G+YIC  P     AR  L V S +  R+++TPP++K+R      F+CYV+   GR  D    F     R     R   E++ A +V+   R+ +T+  NGT+  C        A  +++++  C  G R CR+G+C+ + +FCDG+ DC DGSDED   C +C+P  K+CE Y    P+   Y  HW CDGEDDCGNG+DEA C   ++ +CG   + C +  + IPR+F+CDKD DC  G+DE  C+ P I  ES+  Y+ + R G  VTLTC+VTG PLP++IWRFNWGCL  N+ R  +    +NC     + +STLTIS  +PGDDGIYNCE L+G  RA S DY +++ +
Sbjct:   48 PGPLEVNLGGQVYSRCTVSN--SHEYSVKWIRRLPDHSTQEVSSTAMLYIPEARAEEMQHPLYCQATRLSDGQTFEKALNIRMVGYGGASLPADLTLTIRSLPAEDLSTGRIMRQCLFEGNEEVNEQFD---FRWLDQNGRVVTNGDALYLMLEDPADLGNYTCEATHRS------SNNIYQAKYHVTRPSHAQASQYVVTVVPDAASQVLLGRPYEMLCRVEPMPSEPVTYRWYHNDRMVGSDARLRLPSLAYPDIGSYVC---------------------RAEWTPAYSRSGKMSPPPGSVLVTLPGETRELHCEFG---QLSSPSVQWFFEGQPLERHPTLNASRRVYRMDRLRVSIVTLSGVEVGHGGTYECRINGQIKQTHVIVRVED-GLEVNPSEDT--VDEGTPVEFHCRAHGADQNVNREMQWFYQPFSGGPIQPVDLNPETGFVRQDHPYASHTSFISRLRARKSDEGIYICRLPSEGSEARGRLYVRSTVQYRVVITPPVLKVRVNNPIEFECYVVEDTGRQADVLPNFSVLDSRV----RFDQERVAANRVRFLIRSGLTSEYNGTQVRCAVEGTDRYATSIIVIEDTCPHGFRRCRSGDCLPAGRFCDGRRDCPDGSDEDPRLCNECEPTVKKCEYYQNRPPLKSTYMIHWKCDGEDDCGNGFDEANCPDPSIAQCGDYMFTCPNSQRRIPRSFVCDKDQDCEYGEDERNCVGPTI--ESIADYRHSVRAGTQVTLTCRVTGNPLPRVIWRFNWGCLPENDNRYRITNVAQNCDSPMPSVISTLTISNVRPGDDGIYNCEGLAGSMRAMSNDYFVMIEY 836          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A4E0RPR1 (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Fasciola hepatica OX=6192 GN=D915_000102 PE=4 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 2.792e-136
Identity = 277/812 (34.11%), Postives = 404/812 (49.75%), Query Frame = 2
Query:  473 SANYKYEWI--TPSGERQSSSS----FFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQV-----KALP----IMIEKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTP-PLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSA--SKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDY--ARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGY-QTRNRDVIWSFLSKETGQI----TNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDL--RIIVTPPIIKLRSGQTATFQCYVL-GAGRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRA-VTTNDNGTRFTCR---KGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFG-NVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLT-NERRMVVIESYRNCG----ATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMNF 2794
            S  Y  +WI   P    Q  SS    +       E      C+ TR+SD Q  E    +++      +LP    + I  +    +    +  +C  + ++  N+ F    + WLD    +++N   L L L+D    G YTC    +S       N + + ++     +  ++     T        V    P E+ C V P P   VTY  Y NDR++   +R  +P L   ++G Y C                     +AE+  A     ++S PPG  +    G+ RELHCE G    L   +  W+F+GQ +  +    A   +  + RL VSI+ L  ++  + G YECR+ G+ K+ ++IV  +    EV+PS+ T  V +G PVEFHCR  G  Q  NR++ W +     G I     N ++ + R D   A  TSFI   +A   D G+YIC  P     AR  L V S +  R+++TPP++K+R      F+CYV+   GR  D    F     R     R   E++ A +V+   R+ +T+  NGT+  C      R     +V+ D  C  G R CR+G+C+ + +FCDG+ DC DGSDED   C +C+P  K+CE Y    P+   Y  HW CDGEDDCGNG+DEA C   ++ +CG   + C +  + IPR+F+CDKD DC  G+DE  C+ P I  ES+  Y+ + R G  V LTC+VTG PLP++IWRFNWGCL  N+ R  +    +NC     + +STLTIS  +PGDDGIYNCE LSG  RA S DY +++ +
Sbjct:   68 SHEYSVKWIRRLPDHSTQEVSSTAMLYIPEARAEEMQHPLYCQATRLSDGQTFEKALNIRMVGYGGASLPADLTLTIRSLPAEDLSTGRIMRQCLFEGNEEVNEQFD---FRWLDQNGRVVTNGDALYLMLEDPADLGNYTCEATHRS------SNNIYQAKYHVTRPSHAQASQYVVTVVPDAASQVLLGRPYEMLCRVEPMPSEPVTYRWYHNDRMVGSDARLRLPSLAYPDIGNYVC---------------------RAEWTPAYSRSGKMSPPPGSVLVTLPGETRELHCEFG---QLSSPSVQWFFEGQPLERHPTLNASRRVYRMDRLRVSIVTLSGVEVGHGGTYECRINGQIKQTHVIVRVED-GLEVNPSEDT--VDEGTPVEFHCRAHGADQNVNREMQWFYQPFSGGPIQPVDLNPETGFVRQDHPYASHTSFISRLRARKSDEGIYICRLPSEGSEARGRLYVRSTVQYRVVITPPVLKVRVNNPIEFECYVVEDTGRQADVLPNFSVLDSRI----RFDQERVAANRVRFLIRSGLTSEYNGTQVRCAVEGTDRYATSTIVIED-TCPHGFRRCRSGDCLPAGRFCDGRRDCPDGSDEDPRLCNECEPTVKKCEYYQNRPPLKSTYMIHWMCDGEDDCGNGFDEANCPDPSIAQCGDYMFTCPNSQRRIPRSFVCDKDQDCEYGEDERNCVGPTI--ESIADYRHSVRAGTQVILTCRVTGNPLPRVIWRFNWGCLPENDNRYRITNVAQNCDSPMPSVISTLTISNVRPGDDGIYNCEGLSGSMRAMSNDYFVMIEY 836          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 124.79 bits (312), Expect = 2.494e-28
Identity = 80/240 (33.33%), Postives = 114/240 (47.50%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC---RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC----FGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMNFRN*GRRF 2815
            C     +C+NG+CI+    CDG+ DC DGSDE +  C     C+P   +C+  NG   +       W CDG++DC +  DE  C     G+   C   ++ C      IP ++ CD++ DC +  DE  C  P +     DS  + A RG TVT TC+  G P P I WR NWG +    R+ +            TLTI + + GD G Y CEA++     ++    +L   RN G  F
Sbjct:  191 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMK--CGTPSPCEPNEFKCK--NGRCALK-----LWRCDGDNDCKDNSDEMDCPVRRPGDA--CAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDS--VTAMRGGTVTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTSENGQ-----GTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLNRNAGPFF 412          

HSP 2 Score: 55.4546 bits (132), Expect = 4.070e-7
Identity = 122/556 (21.94%), Postives = 195/556 (35.07%), Query Frame = 2
Query:  566 GQYTCRMTRISDNQVSEGKAFVQV---KALPIMIEKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKN--VRFFEPLELNCEVTPPLRDVTYE--------IYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNI--QQTNEGKYECRVR---GETKEAYIIVMAKSKNTEVSPSQQTRK----VGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLI--VESDLRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANG-------GRAADTQRTTVEKLEAGKVQLTYRAVTTNDNG---------TRFTCRKGRSTAEVLVLVDP 2113
            G Y C    +  N V   +A ++V   K   + I+    + V GET++  C V  +   +  +S     +L   + +I     LR+    Q   G Y CR++      P+V+   +        +    S    S   S  P +  V+  EP    C V    + V  E        I  N ++    S  TI      N G Y+CV+      T  +++     +I  E   A+      P GP + V+ GD   L C+     G    +  W+         D AR  +   P    S  VL+ +  +  + G Y C  +   G T+    +++         P    R+    V +G     HC  +GY      + WS L         I                 ++L     +D+G YIC       T+ AT++  VE+     + P  + +R G+    QC  L  G  P   E+    G        +  D Q       +AG    TY+ V +N  G          R  C +   +A + V V P
Sbjct: 1871 GTYLC----VGTNAVGSSEARIEVTVVKGNDVSIQPSEASVVEGETLDLNCFVPGNPPPSVTWSRAN-GYLSPNHQVIGTQ--LRILRASQEDSGEYICRVD----GGPHVRQASVS------VSVTSESSRLQSPIISIEPHSAAVKLGEPASFRCRVHSGAQPVRLEWKLTNNQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSIVS-----LIVRESPRATVT----PTGP-VHVKVGDPINLECQA---AGEPRPSVSWH-------RLDNARKTMLSSPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHC--DGYGFPKPTISWSKLRAPLPWRHKIV-------------NGSLVLPSVGRQDSGQYICNVTNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQC--LAHGTPPLRFEWSKVGGVLPATAEQQGGDLQINLASPDDAG----TYKCVASNKVGHSEAMAKVSVRLICNRVVCSAPLSVRVSP 2368          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 124.405 bits (311), Expect = 3.138e-28
Identity = 80/240 (33.33%), Postives = 114/240 (47.50%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC---RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC----FGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMNFRN*GRRF 2815
            C     +C+NG+CI+    CDG+ DC DGSDE +  C     C+P   +C+  NG   +       W CDG++DC +  DE  C     G+   C   ++ C      IP ++ CD++ DC +  DE  C  P +     DS  + A RG TVT TC+  G P P I WR NWG +    R+ +            TLTI + + GD G Y CEA++     ++    +L   RN G  F
Sbjct:  191 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMK--CGTPSPCEPNEFKCK--NGRCALK-----LWRCDGDNDCKDNSDEMDCPVRRPGDA--CAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDS--VTAMRGGTVTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTSENGQ-----GTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLNRNAGPFF 412          

HSP 2 Score: 53.1434 bits (126), Expect = 1.938e-6
Identity = 116/527 (22.01%), Postives = 186/527 (35.29%), Query Frame = 2
Query:  566 GQYTCRMTRISDNQVSEGKAFVQV---KALPIMIEKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKN--VRFFEPLELNCEVTPPLRDVTYE--------IYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNI--QQTNEGKYECRVR---GETKEAYIIVMAKSKNTEVSPSQQTRK----VGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLI--VESDLRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANG-------GRAADTQRTTVEKLEAGKVQLTYRAVTTNDNG 2053
            G Y C    +  N V   +A ++V   K   + I+    + V GET++  C V  +   +  +S     +L   + +I     LR+    Q   G Y CR++      P+V+   +        +    S    S   S  P +  V+  EP    C V    + V  E        I  N ++    S  TI      N G Y+CV+      T  +++     +I  E   A+      P GP + V+ GD   L C+     G    +  W+         D AR  +   P    S  VL+ +  +  + G Y C  +   G T+    +++         P    R+    V +G     HC  +GY      + WS L         I                 ++L     +D+G YIC       T+ AT++  VE+     + P  + +R G+    QC  L  G  P   E+    G        +  D Q       +AG    TY+ V +N  G
Sbjct: 1875 GTYLC----VGTNAVGSSEARIEVTVVKGNDVSIQPSEASVVEGETLDLNCFVPGNPPPSVTWSRAN-GYLSPNHQVIGTQ--LRILRASQEDSGEYICRVD----GGPHVRQASVS------VSVTSESSRLQSPIISIEPHSAAVKLGEPASFRCRVHSGAQPVRLEWKLTNNQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSIVS-----LIVRESPRATVT----PTGP-VHVKVGDPINLECQA---AGEPRPSVSWH-------RLDNARKTMLSSPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHC--DGYGFPKPTISWSKLRAPLPWRHKIV-------------NGSLVLPSVGRQDSGQYICNVTNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQC--LAHGTPPLRFEWSKVGGVLPATAEQQGGDLQINLASPDDAG----TYKCVASNKVG 2343          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 123.635 bits (309), Expect = 6.280e-28
Identity = 75/216 (34.72%), Postives = 105/216 (48.61%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC---RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC----FGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEAL 2743
            C     +C+NG+CI+    CDG+ DC DGSDE +  C     C+P   +C+  NG   +       W CDG++DC +  DE  C     G+   C   ++ C      IP ++ CD++ DC +  DE  C  P +     DS  + A RG TVT TC+  G P P I WR NWG +    R+ +            TLTI + + GD G Y CEA+
Sbjct:  196 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMK--CGTPSPCEPNEFKCK--NGRCALK-----LWRCDGDNDCKDNSDEMDCPVRRPGDA--CAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDS--VTAMRGGTVTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTSENGQ-----GTLTIRDVKEGDQGAYTCEAI 393          

HSP 2 Score: 53.9138 bits (128), Expect = 1.067e-6
Identity = 133/617 (21.56%), Postives = 211/617 (34.20%), Query Frame = 2
Query:  251 LTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKD---------------KTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSSFFKNQVGPEFT-------GQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPV-----FGETVEFKCQVDKSKTDN------------KVFSSYTYSWLDSKNNIISNDQILRLKLD-DQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFF--EPLELNCEVTP-PLRDVTYE-----IYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQI-------FVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRVR---GETKEAYIIVMAKSKNTEVSPSQQTR-KVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDT--ARATLIVESDLRIIVTP------PIIKLRSGQTATFQC 1900
            LTI N   E  G Y C  S +    +  ++  L +Q  +               + G GS     I P V            C  ASG  A    EW    G+R SS++  +  V   FT       G Y CR         +    +V   ++P ++  V  +P       GET+   C+   + +              +   S+ +    S +  +   +I  L+   ++T FGT T     +S    Y+    +     G S              S  P        E L+LNC V   P   VT+      +  N ++I    R  I R  + + G Y C   G              +V QA    +   E S    P I        V+ G+     C   V++G Q     W     ++ +N     N ++ P    S++ + N Q  N+G Y C      G T+    +++ +S    V+P+     KVGD  P+   C+  G       V W  L      + +             E  + + +  A  +D+G Y+CT    + T   R  +IVE    +   P      P+  +  G T T  C
Sbjct: 1735 LTIQNVQPEDYGVYVCTGSNMFG--MDESSAVLHVQEANAEMFYTAYEMFEGHRQPGEGSQPVATIQPPVLTIQQGQRAEFRCT-ASGNPAP-AVEWTGGPGKRISSNAVIRGGV-LTFTSVDRSDEGDYICRALNTHGEHTARAVLYVHSTSVPYLLPHVQVSPQQVELHEGETLRLYCRAGGTPSPGLTWKKRGGTLPPQAIPSHGFHQFKSNSLDVLQRRIEELQARVERTDFGTLTVPNMKRSDGGTYL---CVGTNAVGSSEARIEVTVVKGNDVSIQPSEASVVEGETLDLNCFVPGNPPPSVTWSRANGYLSPNHQVIGTQLR--ILRASQEDSGEYICRVDG------------GPHVRQASVSVSVTSESSRLQSPIISIEPHSAAVKLGEPASFRCR--VHSGAQPVRLEW-----KLTNNQPIPDNAKISPD--GSVITITNAQSKNKGTYRCVASNPFGITQSIVSLIVRESPRATVTPTGPVHVKVGD--PINLECQAAG--EPRPSVSWHRLDNARKTMLS--------SPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHC 2308          

HSP 3 Score: 53.5286 bits (127), Expect = 1.508e-6
Identity = 120/547 (21.94%), Postives = 192/547 (35.10%), Query Frame = 2
Query:  566 GQYTCRMTRISDNQVSEGKAFVQV---KALPIMIEKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKN--VRFFEPLELNCEVTPPLRDVTYE--------IYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNI--QQTNEGKYECRVR---GETKEAYIIVMAKSKNTEVSPSQQTRK----VGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLI--VESDLRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANG-------GRAADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDP 2113
            G Y C    +  N V   +A ++V   K   + I+    + V GET++  C V  +   +  +S     +L   + +I     LR+    Q   G Y CR++      P+V+   +        +    S    S   S  P +  V+  EP    C V    + V  E        I  N ++    S  TI      N G Y+CV+      T  +++     +I  E   A+      P GP + V+ GD   L C+     G    +  W+         D AR  +   P    S  VL+ +  +  + G Y C  +   G T+    +++         P    R+    V +G     HC  +GY      + WS L         I                 ++L     +D+G YIC       T+ AT++  VE+     + P  + +R G+    QC  L  G  P   E+    G        +  D Q       +AG    TY+ V +N  G      K    + + V V P
Sbjct: 1979 GTYLC----VGTNAVGSSEARIEVTVVKGNDVSIQPSEASVVEGETLDLNCFVPGNPPPSVTWSRAN-GYLSPNHQVIGTQ--LRILRASQEDSGEYICRVD----GGPHVRQASVS------VSVTSESSRLQSPIISIEPHSAAVKLGEPASFRCRVHSGAQPVRLEWKLTNNQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSIVS-----LIVRESPRATVT----PTGP-VHVKVGDPINLECQA---AGEPRPSVSWH-------RLDNARKTMLSSPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHC--DGYGFPKPTISWSKLRAPLPWRHKIV-------------NGSLVLPSVGRQDSGQYICNVTNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQC--LAHGTPPLRFEWSKVGGVLPATAEQQGGDLQINLASPDDAG----TYKCVASNKVGHSEAMAKVSVRSPLSVRVSP 2467          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 123.635 bits (309), Expect = 6.617e-28
Identity = 75/216 (34.72%), Postives = 105/216 (48.61%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC---RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC----FGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEAL 2743
            C     +C+NG+CI+    CDG+ DC DGSDE +  C     C+P   +C+  NG   +       W CDG++DC +  DE  C     G+   C   ++ C      IP ++ CD++ DC +  DE  C  P +     DS  + A RG TVT TC+  G P P I WR NWG +    R+ +            TLTI + + GD G Y CEA+
Sbjct:  196 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMK--CGTPSPCEPNEFKCK--NGRCALK-----LWRCDGDNDCKDNSDEMDCPVRRPGDA--CAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDS--VTAMRGGTVTFTCKAVGVPTPIITWRLNWGHIPVSSRITMTSENGQ-----GTLTIRDVKEGDQGAYTCEAI 393          

HSP 2 Score: 55.0694 bits (131), Expect = 5.578e-7
Identity = 129/602 (21.43%), Postives = 213/602 (35.38%), Query Frame = 2
Query:  251 LTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKD---------------KTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSSFFKNQVGPEFT-------GQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPV-----FGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTP-PLRDVTYE-----IYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQI-------FVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRVR---GETKEAYIIVMAKSKNTEVSPSQQTR-KVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDT--ARATLIVESDLRIIVTP------PIIKLRSGQTATFQC 1900
            LTI N   E  G Y C  S +    +  ++  L +Q  +               + G GS     I P V            C  ASG  A    EW    G+R SS++  +  V   FT       G Y CR         +    +V   ++P ++  V  +P       GET+   C+   + +    +     +         ++   L +    ++  GTY C + T ++     + +V  ++            N+ S + S    +V   E L+LNC V   P   VT+      +  N ++I    R  I R  + + G Y C   G              +V QA    +   E S    P I        V+ G+     C   V++G Q     W     ++ +N     N ++ P    S++ + N Q  N+G Y C      G T+    +++ +S    V+P+     KVGD  P+   C+  G    +  V W  L      + +             E  + + +  A  +D+G Y+CT    + T   R  +IVE    +   P      P+  +  G T T  C
Sbjct: 1798 LTIQNVQPEDYGVYVCTGSNMFG--MDESSAVLHVQEANAEMFYTAYEMFEGHRQPGEGSQPVATIQPPVLTIQQGQRAEFRCT-ASGNPAP-AVEWTGGPGKRISSNAVIRGGV-LTFTSVDRSDEGDYICRALNTHGEHTARAVLYVHSTSVPYLLPHVQVSPQQVELHEGETLRLYCRAGGTPSPGLTWKKRGGTLPPQARVERTDFGTLTVPNMKRSDGGTYLC-VGTNAVGSSEARIEVTVVK-----------GNDVSIQPSE--ASVVEGETLDLNCFVPGNPPPSVTWSRANGYLSPNHQVIGTQLR--ILRASQEDSGEYICRVDG------------GPHVRQASVSVSVTSESSRLQSPIISIEPHSAAVKLGEPASFRCR--VHSGAQPVRLEW-----KLTNNQPIPDNAKISPD--GSVITITNAQSKNKGTYRCVASNPFGITQSIVSLIVRESPRATVTPTGPVHVKVGD--PINLECQAAGEPRPS--VSWHRLDNARKTMLS--------SPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHC 2345          

HSP 3 Score: 53.5286 bits (127), Expect = 1.522e-6
Identity = 120/547 (21.94%), Postives = 192/547 (35.10%), Query Frame = 2
Query:  566 GQYTCRMTRISDNQVSEGKAFVQV---KALPIMIEKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKN--VRFFEPLELNCEVTPPLRDVTYE--------IYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNI--QQTNEGKYECRVR---GETKEAYIIVMAKSKNTEVSPSQQTRK----VGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLI--VESDLRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANG-------GRAADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDP 2113
            G Y C    +  N V   +A ++V   K   + I+    + V GET++  C V  +   +  +S     +L   + +I     LR+    Q   G Y CR++      P+V+   +        +    S    S   S  P +  V+  EP    C V    + V  E        I  N ++    S  TI      N G Y+CV+      T  +++     +I  E   A+      P GP + V+ GD   L C+     G    +  W+         D AR  +   P    S  VL+ +  +  + G Y C  +   G T+    +++         P    R+    V +G     HC  +GY      + WS L         I                 ++L     +D+G YIC       T+ AT++  VE+     + P  + +R G+    QC  L  G  P   E+    G        +  D Q       +AG    TY+ V +N  G      K    + + V V P
Sbjct: 2016 GTYLC----VGTNAVGSSEARIEVTVVKGNDVSIQPSEASVVEGETLDLNCFVPGNPPPSVTWSRAN-GYLSPNHQVIGTQ--LRILRASQEDSGEYICRVD----GGPHVRQASVS------VSVTSESSRLQSPIISIEPHSAAVKLGEPASFRCRVHSGAQPVRLEWKLTNNQPIPDNAKISPDGSVITITNAQSKNKGTYRCVASNPFGITQSIVS-----LIVRESPRATVT----PTGP-VHVKVGDPINLECQA---AGEPRPSVSWH-------RLDNARKTMLSSPVPMESNAVLQILVARAEDSGTYVCTAQNNQGTTETRIEVIVEGGPAVPTVPRASVREPMKVVVEGSTTTLHC--DGYGFPKPTISWSKLRAPLPWRHKIV-------------NGSLVLPSVGRQDSGQYICNVTNHMGTSEATIMLDVETTPYTTLLPDDVSVRVGEVIRLQC--LAHGTPPLRFEWSKVGGVLPATAEQQGGDLQINLASPDDAG----TYKCVASNKVGHSEAMAKVSVRSPLSVRVSP 2504          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:103023739])

HSP 1 Score: 86.6557 bits (213), Expect = 7.042e-17
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 2
Query: 2105 VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC--RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            V  +C+    +CRNG+CI     CDG+PDC DGSDE  E C  R C      C    G  P  P++   W CDGE DC NG DE  C GNV  C  L++ C  G + I + F+C+ + DC +G DE  C
Sbjct:   63 VRKMCAETDFVCRNGQCIPKRWHCDGEPDCEDGSDEGTEQCYTRTCRMNEFSCGV--GSTPCIPVF---WKCDGESDCDNGEDEMNC-GNVT-CALLEFTCTSG-RCISQNFVCNGEDDCGDGSDEQDC 183          

HSP 2 Score: 62.3882 bits (150), Expect = 2.501e-9
Identity = 58/235 (24.68%), Postives = 83/235 (35.32%), Query Frame = 2
Query: 1901 YVLGAGRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVL---------------VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTL 2560
            +  G G +P  P F+  +G    D      +++  G V               FTC  GR  ++  V                    C      C N  CI S   CD  PDC D SDE    C +      +C     +          W CDG+ DC +G DE  C      C   +++C DG+  I  +  C+   DC +G DE  C     + +     K   R GE + +
Sbjct:  113 FSCGVGSTPCIPVFWKCDGESDCDNGE---DEMNCGNVTCAL---------LEFTCTSGRCISQNFVCNGEDDCGDGSDEQDCAPSSCGPNEFQCGNATCIPSGWVCDDDPDCQDHSDESPLRCGRNPTPPAKCSVSEILCGSGECIHRKWRCDGDADCKDGSDEKNCPAR--SCRPDQFKCEDGS-CIHGSRQCNGIRDCTDGTDEVNCKN---LTQCNGPDKFKCRSGECIDM 329          

HSP 3 Score: 60.4622 bits (145), Expect = 8.304e-9
Identity = 44/121 (36.36%), Postives = 59/121 (48.76%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGL-KYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            CS    LC +GECI+    CDG  DC DGSDE     R C P   +CE  + +            C+G  DC +G DE  C  N+ +C G  K++C  G + I    +C+K  DC +  DE
Sbjct:  234 CSVSEILCGSGECIHRKWRCDGDADCKDGSDEKNCPARSCRPDQFKCEDGSCI-------HGSRQCNGIRDCTDGTDEVNC-KNLTQCNGPDKFKCRSG-ECIDMHKVCNKARDCPDWSDE 345          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: lrp1ab (low density lipoprotein receptor-related protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-030131-7126])

HSP 1 Score: 83.9593 bits (206), Expect = 1.544e-16
Identity = 61/195 (31.28%), Postives = 89/195 (45.64%), Query Frame = 2
Query: 1940 FFMANGGRAADTQRTTVEKLEAGK--VQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE-SRCIQPIIIQESL 2515
            F++A+ GR   +  T    +      +   ++  T +D G R        + E     D  C  G   C+NG C N A  CDG  DC DGSDE       C P   +C T +   P        + C+G+D+CG+G DE  C    + C   ++QC+   + IPR ++CD+D DC +G DE + C Q    QE  
Sbjct: 3290 FYLASDGRTCLSNCTASRFVCKNDKCIPFWWKCDTEDDCGDR--------SDEPADCPDFKCRPGQFQCKNGICTNPAFICDGDNDCGDGSDEANCDVHVCLPSQFKCRTTHRCIP------GIFRCNGQDNCGDGEDEKDC--PEVTCAPNQFQCSSTKRCIPRVWVCDRDNDCGDGSDEPANCTQMTCGQEEF 3468          

HSP 2 Score: 72.4034 bits (176), Expect = 5.330e-13
Identity = 46/122 (37.70%), Postives = 56/122 (45.90%), Query Frame = 2
Query: 2111 PVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            P C  G   C+NG CI     CDG  DC D SDE  E C Q    S R +  N     N      W CDG++DCGN  DE+        C   ++ C  G   IP ++ CD D DC +  DE
Sbjct:  825 PQCHPGEFACKNGRCIQERWRCDGDNDCLDNSDEAPEICHQHTCPSDRFKCQN-----NRCIPLRWLCDGDNDCGNSEDESNTTCAARTCPPNQFSCASG-HCIPMSWKCDLDDDCGDRSDE 940          

HSP 3 Score: 65.4698 bits (158), Expect = 6.933e-11
Identity = 44/123 (35.77%), Postives = 59/123 (47.97%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSK-RCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLE------CGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C NG CIN    CD   DCAD SDE    C     +S+ +C +   +        +HW CDG++DCG+  DE       L       C G ++QC    + IP  + CD DTDC++  DE  C
Sbjct:  957 CNNGRCINMNWRCDADNDCADASDEIG--CNHSCSISQFKCNSGRCIP-------SHWTCDGDNDCGDFSDETNPNCTKLATRPPGGCHGDEFQCKADGQCIPLRWRCDGDTDCIDTSDEKEC 1070          

HSP 4 Score: 64.3142 bits (155), Expect = 1.456e-10
Identity = 42/126 (33.33%), Postives = 55/126 (43.65%), Query Frame = 2
Query: 2108 DPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            D  C      C+N  C+     CD   DC D SDE+    R C      C     +A         W CDG+ DC +G DE  C      C   ++QC +G   IP+ + CD D DC++G DE  C
Sbjct: 3502 DRTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEEGCTPRPCSESEFSCANGRCIA-------GRWRCDGDHDCSDGSDEKDC---SPRCDHDQFQCRNG-HCIPQRWRCDADIDCIDGSDEDNC 3616          

HSP 5 Score: 64.3142 bits (155), Expect = 1.532e-10
Identity = 50/167 (29.94%), Postives = 68/167 (40.72%), Query Frame = 2
Query: 2054 TRFTCRKGR--------------STAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQ--------CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECG-GLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            T+F C  GR              + A   +  +  CS     C +G CI S   CDG  DC D SDE    C +        C     +C+      P+       W CDG+ DC +  DE +C G V  C   L++ C D  + I + + CD D DC +  DE  C
Sbjct:  953 TQFACNNGRCINMNWRCDADNDCADASDEIGCNHSCSISQFKCNSGRCIPSHWTCDGDNDCGDFSDETNPNCTKLATRPPGGCHGDEFQCKADGQCIPL------RWRCDGDTDCIDTSDEKECDGVVRTCDPTLQFSCRDTGRCISKTWFCDGDNDCEDNSDEEGC 1113          

HSP 6 Score: 63.929 bits (154), Expect = 2.336e-10
Identity = 43/121 (35.54%), Postives = 56/121 (46.28%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDES 2479
            CS     C NG CI     CDG  DC+DGSDE     + C P   RC+               W CD + DC +G DE  C   V  C   ++QCN+ T   P ++ CD + DC +  DE+
Sbjct: 3544 CSESEFSCANGRCIAGRWRCDGDHDCSDGSDE-----KDCSP---RCDHDQFQCRNGHCIPQRWRCDADIDCIDGSDEDNCAAIVRTCPHHEFQCNN-TLCKPLSWKCDGEDDCGDNSDET 3655          

HSP 7 Score: 62.7734 bits (151), Expect = 4.180e-10
Identity = 42/129 (32.56%), Postives = 54/129 (41.86%), Query Frame = 2
Query: 2111 PVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLEC-GGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQP 2494
            P C      CRNG CI     CD   DC DGSDED      C  + + C  +             W CDGEDDCG+  DE        +C  G +++C +          CD   +C +G DE  C +P
Sbjct: 3580 PRCDHDQFQCRNGHCIPQRWRCDADIDCIDGSDED-----NCAAIVRTCPHHEFQCNNTLCKPLSWKCDGEDDCGDNSDETPEMCLKFQCPPGRQFRCRNNRVCFWAGRQCDGVDNCGDGSDEENCEKP 3703          

HSP 8 Score: 51.9878 bits (123), Expect = 1.019e-6
Identity = 40/118 (33.90%), Postives = 54/118 (45.76%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFC--RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C NG+CI     CDG  DC D SDE   +C  RQC      C     +  +         C+G +DCG+  DE  C  N   CG  +++C DG+  I     C++  DC +  DE  C
Sbjct: 2509 CNNGDCIRYHLTCDGVADCKDKSDEKPFYCTSRQCKNGYVNCLNGRCMETLK-------LCNGVNDCGDNSDEIAC--NNSTCGADEFRCGDGS-CIANVTRCNQVVDCDDISDEIGC 2616          

HSP 9 Score: 51.2174 bits (121), Expect = 1.704e-6
Identity = 36/108 (33.33%), Postives = 51/108 (47.22%), Query Frame = 2
Query: 2153 CINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            C+  A  CDG  DC D +DE    C++    S  C       P  P     W CD E DC +G DE  C    + C    ++C++G K I + ++CD + DC +  DE
Sbjct: 2643 CVLPAWICDGANDCGDYADEKN--CKK-KSGSPGCSPDYFNCPSGPCIPTAWKCDREPDCDDGADELNC---DMLCAVDHFECDNG-KCITKRWMCDGEDDCGDRSDE 2743          

HSP 10 Score: 50.8322 bits (120), Expect = 2.017e-6
Identity = 42/153 (27.45%), Postives = 65/153 (42.48%), Query Frame = 2
Query: 2144 NGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVA--PINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQC-NDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPK 2593
            +G+CI     CDG  DC D SDE     ++CD + + C+     +           W CDG++DC +  DE  C    + C    + C ND +  +    +CD  +DC +G DE        +     ++      GE V  +C  +G  L K
Sbjct: 1045 DGQCIPLRWRCDGDTDCIDTSDE-----KECDGVVRTCDPTLQFSCRDTGRCISKTWFCDGDNDCEDNSDEEGC--ETMLCKPPSHSCANDSSICLSPKKLCDGHSDCPDGSDEGMLCDQCQVNNGGCTHNCTVAPGEGVVCSCP-SGMQLGK 1189          

HSP 11 Score: 50.447 bits (119), Expect = 2.469e-6
Identity = 34/95 (35.79%), Postives = 41/95 (43.16%), Query Frame = 2
Query: 2111 PVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKY 2395
            P CS     C +G CI +A  CD +PDC DG+DE       CD L   C   +            W CDGEDDCG+  DE         C  + Y
Sbjct: 2672 PGCSPDYFNCPSGPCIPTAWKCDREPDCDDGADE-----LNCDML---CAVDHFECDNGKCITKRWMCDGEDDCGDRSDEKDAHCTFRACANIAY 2758          

HSP 12 Score: 50.447 bits (119), Expect = 2.802e-6
Identity = 51/186 (27.42%), Postives = 67/186 (36.02%), Query Frame = 2
Query: 2072 KGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDE---------DQEF-------------CRQ---CDPLSKRCETYNGVAPINPIYQAH---------------------WACDGEDDCGNGYDEAKCF--GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            K +S  +        C +G   C NG C+ + K C+G  DC D SDE           EF             C Q   CD +S       G  P+N  +                        W CDG +DCG+  DE  C        C    + C  G   IP A+ CD++ DC +G DE  C
Sbjct: 2528 KDKSDEKPFYCTSRQCKNGYVNCLNGRCMETLKLCNGVNDCGDNSDEIACNNSTCGADEFRCGDGSCIANVTRCNQVVDCDDISDEI----GCGPMNCTHYHRLGVQASGYVSCNSTSLCVLPAWICDGANDCGDYADEKNCKKKSGSPGCSPDYFNCPSG-PCIPTAWKCDREPDCDDGADELNC 2708          

HSP 13 Score: 50.447 bits (119), Expect = 2.947e-6
Identity = 29/81 (35.80%), Postives = 45/81 (55.56%), Query Frame = 2
Query: 2114 VCSSGSRLCRNG-ECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEA 2353
             CS    +C++G  CI+    CDG+ DC DGSDE  E C++ + +  +   Y+ +     I+ +   CDG +DC +GYDE 
Sbjct:    4 TCSPTQFVCKDGLTCISLGWRCDGEKDCPDGSDESPEICQKPNEMKCQVNHYHCLGTELCIHMSK-LCDGNNDCPDGYDEG 83          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001137.1 (pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1 gene:ENSPMAG00000001008.1 transcript:ENSPMAT00000001137.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 8.874e-12
Identity = 45/118 (38.14%), Postives = 57/118 (48.31%), Query Frame = 2
Query: 2153 CINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCV-NGDDESRCIQPIII 2503
            CI     CDG  DC DGSDE  E C+Q   +S R +  N     N      W CDG++DCG   DE+     V  C   ++ C +G K IP A+ CD D DC  N D+   C  P  +
Sbjct:    1 CIQDQWRCDGDNDCQDGSDELPEICQQHTCISDRFKCKN-----NRCIPMRWLCDGDNDCGENEDESNTTCTVRTCPAEQFTCGNG-KCIPIAWKCDLDNDCSDNSDEPPSCAYPTCL 112          

HSP 2 Score: 67.781 bits (164), Expect = 1.288e-11
Identity = 47/131 (35.88%), Postives = 59/131 (45.04%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQ--EF----CRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECG-GLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
             C+     C+NG CI S   CDG  DC D SDE    EF     RQC     RC       P+       W CDG+ DC +  DE +C G    C  G  + C      I +A++CD D DC +  DE+ C
Sbjct:  149 TCADSQFSCKNGHCIPSQWVCDGDNDCGDVSDETHTCEFPARPLRQCREDEFRCAINGNCIPL------RWRCDGDADCMDISDEKECDGQRRTCNPGTHFTCVSNGICIRKAWVCDGDNDCEDNSDEAGC 273          

HSP 3 Score: 66.6254 bits (161), Expect = 2.687e-11
Identity = 44/126 (34.92%), Postives = 56/126 (44.44%), Query Frame = 2
Query: 2108 DPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            D  C      C+N  CI     CD   DC D SDE+    R C      C     +A         W CDG+ DC +G DE  C    L C   ++QC +G   IP+ + CD D DC++G DE  C
Sbjct:  873 DKTCEPYQFRCKNNRCIPGRWHCDYDNDCGDNSDEEGCTPRPCSESEFSCANGRCIA-------GRWRCDGDHDCMDGSDEKDC---SLRCEQDQFQCQNG-HCIPQRWRCDNDADCLDGSDEENC 987          

HSP 4 Score: 60.4622 bits (145), Expect = 2.058e-9
Identity = 43/120 (35.83%), Postives = 51/120 (42.50%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            CS     C NG CI     CDG  DC DGSDE           S RCE               W CD + DC +G DE  C   V  C   ++QCN  T   P ++ CD + DC +  DE
Sbjct:  915 CSESEFSCANGRCIAGRWRCDGDHDCMDGSDEKD--------CSLRCEQDQFQCQNGHCIPQRWRCDNDADCLDGSDEENCGSAVRLCPKDEFQCN-STLCKPFSWRCDGEDDCGDNSDE 1025          

HSP 5 Score: 53.9138 bits (128), Expect = 2.461e-7
Identity = 39/120 (32.50%), Postives = 52/120 (43.33%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLK-YQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQP 2494
            C+NG CI     CD   DC DGSDE  E C     L  + E         P     W CDGEDDCG+  DE        +C   + ++C +    +    +CD   +C +  DE  C +P
Sbjct:  960 CQNGHCIPQRWRCDNDADCLDGSDE--ENCGSAVRLCPKDEFQCNSTLCKPF---SWRCDGEDDCGDNSDEDADHCRAFQCPPRRQFRCRNDRVCVSLDRVCDGINNCGDHSDEEHCGEP 1074          

HSP 6 Score: 50.447 bits (119), Expect = 2.451e-6
Identity = 41/159 (25.79%), Postives = 61/159 (38.36%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCR--------------QCDPLSKRCETYNGVAPIN------------PIYQ----------AHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESR 2482
             C S    C+N  CI     CDG  DC +  DE    C               +C P++ +C+  N  +  +            P+ Q            W CD ++DC +  DEA C      C   ++ C +G   IP  ++CD D DC +  DE+ 
Sbjct:   29 TCISDRFKCKNNRCIPMRWLCDGDNDCGENEDESNTTCTVRTCPAEQFTCGNGKCIPIAWKCDLDNDCSDNSDEPPSCAYPTCLPLTQFSCNNGRCINIRWRCDSDNDCADSSDEAGCNNT---CADSQFSCKNG-HCIPSQWVCDGDNDCGDVSDETH 183          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: sorl1 (sortilin-related receptor, L(DLR class) A repeats containing [Source:ZFIN;Acc:ZDB-GENE-050208-22])

HSP 1 Score: 66.6254 bits (161), Expect = 2.434e-11
Identity = 52/141 (36.88%), Postives = 64/141 (45.39%), Query Frame = 2
Query: 2120 SSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCD--PLSKRCETYNGVAPIN-----------PIYQAHWACDGEDDCGNGYDEAKC----FGNVLECGGL--KYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            S G   C +G CI     CDG  DC DG+DE Q    QC   P +  C   +   PIN                HW CDG DDCG+  DEA C       V+ C  +  +++C DGT  I   F+CD   DC +G DE  C
Sbjct: 1049 SQGMECCPSGPCIPRRWLCDGDKDCLDGADEQQ----QCGTRPPAMWCSMLH--QPINCTSSEFQCRSGVCISLHWKCDGVDDCGDYSDEANCREMPSPEVVCCTVMIGEFRCGDGT-CIFDHFVCDGSPDCADGSDEYGC 1182          

HSP 2 Score: 59.6918 bits (143), Expect = 3.838e-9
Identity = 46/141 (32.62%), Postives = 62/141 (43.97%), Query Frame = 2
Query: 2099 VLVDPV-CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQ--------CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC---FGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            +L  P+ C+S    CR+G CI+    CDG  DC D SDE    CR+        C  +       +G    +     H+ CDG  DC +G DE  C    G    C   ++QC      +P +  CD   DCV+G DE  C
Sbjct: 1094 MLHQPINCTSSEFQCRSGVCISLHWKCDGVDDCGDYSDEAN--CREMPSPEVVCCTVMIGEFRCGDGTCIFD-----HFVCDGSPDCADGSDEYGCPTQHGRPSPCSFTQFQCLKDKTCVPASARCDGRKDCVDGSDELGC 1227          

HSP 3 Score: 58.151 bits (139), Expect = 1.185e-8
Identity = 42/125 (33.60%), Postives = 59/125 (47.20%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDG-KPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNV-LECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESR 2482
            VC+     C NG CIN    CD  + DC D SDE  +   Q      +C+            ++ W CDG++DC +  DE  C  +  +EC      C  G   IPR ++CD D DC++G DE +
Sbjct:  970 VCAESQFKCANGRCINILWKCDHDEDDCGDNSDEPADCPHQ------KCQATEFSCSNGRCVRSAWRCDGDNDCHDWSDEVNCSSSQGMEC------CPSG-PCIPRRWLCDGDKDCLDGADEQQ 1081          

HSP 4 Score: 53.1434 bits (126), Expect = 3.819e-7
Identity = 41/130 (31.54%), Postives = 53/130 (40.77%), Query Frame = 2
Query: 2126 GSRLCRNGECINSAKFCDGKPDCADGSDE-----DQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLE--------CGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            G   C +G CI     CDG PDCADGSDE            C     +C       P      A   CDG  DC +G DE  C+ +  +        CG  ++ C DG+  +    +CD   DC +  DE
Sbjct: 1151 GEFRCGDGTCIFDHFVCDGSPDCADGSDEYGCPTQHGRPSPCSFTQFQCLKDKTCVP------ASARCDGRKDCVDGSDELGCYDSGSQLCYSMPGVCGENQFACVDGSGCLEHFMLCDGYHDCQDRSDE 1274          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 67.0106 bits (162), Expect = 2.565e-11
Identity = 52/155 (33.55%), Postives = 69/155 (44.52%), Query Frame = 2
Query: 2111 PVCSSGSRL-CRNGECINSAKFCDGKPDCADGSDE-----DQEFC---------RQCDPLSKR--------------CETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCI 2488
            P CSS     C NG C+     CDG  DC DGSDE         C         R+C P+  R              C + N   P       +W CD ++DCG+G DE  C      C  +++QC D  + I  A++CD D+DCV+G DE  C+
Sbjct: 1000 PQCSSTEFFACANGRCVPRLFLCDGYDDCHDGSDERGCGTGNVTCSPYAFTCTNRRCIPIDWRPTRLATTCRADQFTCASGNRCIP------RYWICDTDNDCGDGSDERGC-DMSGTCHPMQFQCPD-HRCIDNAYVCDGDSDCVDGADERGCV 1146          

HSP 2 Score: 60.8474 bits (146), Expect = 1.893e-9
Identity = 38/120 (31.67%), Postives = 54/120 (45.00%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDE-AKCFGNVLECGGLKYQCNDGT----KSIPRAFICDKDTDCVNGDDESR 2482
            C NG+CI  +  CD + DC D +DE       C    + C                W CDG++DCG+G DE  +       CG  ++ C D +    + I R F+CD D DC +  DE +
Sbjct: 2833 CGNGQCIPLSWVCDSEQDCTDNADEPSS----CSDPGRTCPGTQFTCDSGRCIPGSWICDGDNDCGDGSDEDGRHACGARTCGPHEFTCADASPPRRRCIQRRFVCDGDADCSDALDEHQ 2948          

HSP 3 Score: 60.077 bits (144), Expect = 2.886e-9
Identity = 42/137 (30.66%), Postives = 57/137 (41.61%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEF---CRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESL 2515
             C      C +G CI  +  CDG  DC DGSDED       R C P    C   +   P     Q  + CDG+ DC +  DE +       C   ++ C++G   +   + CD+  DC +G DE  C  P   Q   
Sbjct: 2867 TCPGTQFTCDSGRCIPGSWICDGDNDCGDGSDEDGRHACGARTCGPHEFTCA--DASPPRRRCIQRRFVCDGDADCSDALDEHQ-NCTRRSCTAGEFACDNGL-CVHSRYRCDRRNDCGDGSDERGCTYPTCRQNQF 2999          

HSP 4 Score: 59.3066 bits (142), Expect = 5.665e-9
Identity = 60/201 (29.85%), Postives = 76/201 (37.81%), Query Frame = 2
Query: 2057 RFTCRKGRSTA-----------------EVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC--RQCDP------------------------------------LSKRCETYNGVA-PINPIYQAHWA-CDGEDDCGNGYDEAKCFGNVLECGGL-KYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            RF CR G  T+                 E  +  +  C+S    C N  CI +A  CDG PDC DGSDED   C  R C P                                     S RC+++   A   N      WA C+G DDC +  DE  C    + C  L  Y+C D  + IP  + CD+  DC +G DE  C
Sbjct: 3522 RFQCRDGNCTSSNLLCNGNNNCPDGSDEEDTLCFNHRCNSNQWQCMNKRCIPAAWLCDGGPDCQDGSDEDSATCAARTCAPGQFRCNNGRCIPRSWVCDVDDDCGDGSDEPHDTCMGPSHRCDSHTEFACRTNYRCIPTWAVCNGMDDCRDNSDEQGC--AEITCDPLGDYRC-DNHRCIPLRWRCDRYDDCGDGSDERNC 3719          

HSP 5 Score: 59.3066 bits (142), Expect = 5.810e-9
Identity = 41/125 (32.80%), Postives = 59/125 (47.20%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAK--CFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C++G   C NG C++S   CD + DC DGSDE       C      CE    +  I       +ACDG++DCG+G DE    C      C    ++C  G + +    +C++  DC +G DE  C
Sbjct: 2955 CTAGEFACDNGLCVHSRYRCDRRNDCGDGSDERGCTYPTCRQNQFTCENGRCIPRI-------FACDGDNDCGDGSDEDTHLCHQPSPTCAPGFFRCGAG-ECVAIHLVCNQANDCADGSDEKGC 3071          

HSP 6 Score: 58.9214 bits (141), Expect = 7.295e-9
Identity = 57/174 (32.76%), Postives = 72/174 (41.38%), Query Frame = 2
Query: 2051 GTRFTCRKGRSTAEVLVL-VDPVCSSGS----------RLCRNGE------------CINSAKFCDGKPDCADGSDEDQEFCRQ-CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESR--CIQP 2494
            GT+FTC  GR      +   D  C  GS          R C   E            CI     CDG  DC+D  DE Q   R+ C      C+  NG+        + + CD  +DCG+G DE  C      C   ++ C +G + IPR F CD D DC +G DE    C QP
Sbjct: 2870 GTQFTCDSGRCIPGSWICDGDNDCGDGSDEDGRHACGARTCGPHEFTCADASPPRRRCIQRRFVCDGDADCSDALDEHQNCTRRSCTAGEFACD--NGLC-----VHSRYRCDRRNDCGDGSDERGC--TYPTCRQNQFTCENG-RCIPRIFACDGDNDCGDGSDEDTHLCHQP 3033          

HSP 7 Score: 58.5362 bits (140), Expect = 8.932e-9
Identity = 42/124 (33.87%), Postives = 55/124 (44.35%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
             C+SG+R      CI     CD   DC DGSDE     R CD +S  C       P +      + CDG+ DC +G DE  C   V  C   ++ C+ G + I   + CD   DC +  DE  C
Sbjct: 1076 TCASGNR------CIPRYWICDTDNDCGDGSDE-----RGCD-MSGTCHPMQFQCPDHRCIDNAYVCDGDSDCVDGADERGC---VFNCTSYQFSCSSGDQCIATYYRCDGAFDCRDRSDEVGC 1184          

HSP 8 Score: 58.5362 bits (140), Expect = 1.031e-8
Identity = 45/131 (34.35%), Postives = 62/131 (47.33%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQ--CDPLSK-RCETYNGVAPINPIYQAHWACDGEDDCGNGYDEA--KCFGNVL-ECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQ 2491
            C   S  C N  CI  +  CDG  DC DGSDE+   C    C+P  + RC+        N    +H  C+  DDCG+G DE   KC       C   +++C  G + IP A +C+   +C +  DE+ C Q
Sbjct: 3807 CPPSSFECDNHVCIPPSWKCDGDNDCGDGSDEELHHCLDTPCNPPGRFRCDN-------NRCIYSHEICNAVDDCGDGSDETPDKCKEPTFAPCTEEEFKCASG-RCIPMAAVCNNYNECRDNTDETGCNQ 3929          

HSP 9 Score: 58.151 bits (139), Expect = 1.327e-8
Identity = 46/144 (31.94%), Postives = 62/144 (43.06%), Query Frame = 2
Query: 2060 FTCRKGRSTAEVLVLVDPVCSSGSRLCR-NGECINSAKFCDGKPDCADGSDEDQEFC--RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLEC-GGLKYQCNDGTKSIPRAFICDKDTDCVNGDDES 2479
            F CR              +C +    C+ +G CI +   CDG PDC DGSDE    C  R C     RC+  N V          W CDG++DC +G DE  C      C    ++ C +    +    +CD + DC +G DES
Sbjct: 1173 FDCRDRSDEVGCPTRAPGLCHNDEFQCQSDGLCIPAGWECDGHPDCDDGSDE-HPGCPPRTCAAGYLRCDNGNCVP-------ESWRCDGDNDCRDGTDERDCPTPPYRCQSPSQWLCPNHRACVDLRKVCDGNFDCPDGGDES 1308          

HSP 10 Score: 56.6102 bits (135), Expect = 4.074e-8
Identity = 43/129 (33.33%), Postives = 52/129 (40.31%), Query Frame = 2
Query: 2099 VLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            +  DP+   G   C N  CI     CD   DC DGSDE     R C     RC     +          W C+ E+DCG+  DE  C   +  C    +QC  G   IP    CD   DC +  DES C
Sbjct: 3682 ITCDPL---GDYRCDNHRCIPLRWRCDRYDDCGDGSDERNCAPRPCSESEFRCTNQRCIP-------GRWVCNHENDCGDNSDERDC--ELQTCLPGYFQCGSG-HCIPERLKCDGSADCQDFSDESLC 3797          

HSP 11 Score: 55.0694 bits (131), Expect = 1.021e-7
Identity = 34/87 (39.08%), Postives = 37/87 (42.53%), Query Frame = 2
Query: 2111 PVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQ----CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC 2359
            P C      C NG CI     CDG  DC DGSDED   C Q    C P   RC     VA        H  C+  +DC +G DE  C
Sbjct: 2992 PTCRQNQFTCENGRCIPRIFACDGDNDCGDGSDEDTHLCHQPSPTCAPGFFRCGAGECVA-------IHLVCNQANDCADGSDEKGC 3071          

HSP 12 Score: 53.5286 bits (127), Expect = 2.880e-7
Identity = 45/127 (35.43%), Postives = 57/127 (44.88%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAK-CFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQP 2494
            C SG   C +G CI  +  CD   DC+D SDE       C  L  RC + N       I +A + CDGE DC +  DE + C G+   C    + C  G   +  AF CD   DC +  DE  C  P
Sbjct:    1 CDSGQFRCGSGACIPRSWVCDSINDCSDDSDERGCSPATCTTLQFRCRSDNRC-----IARA-FVCDGEADCADRSDEHQNCPGST--CSSSHFTCASG-HCVQSAFRCDHFQDCDDRSDEQSCQYP 118          

HSP 13 Score: 51.2174 bits (121), Expect = 1.691e-6
Identity = 45/131 (34.35%), Postives = 60/131 (45.80%), Query Frame = 2
Query: 2117 CSSGSRLCRNG-ECINSAKFCDGKPDCADGSDEDQEFCRQ---CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAK-CFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQP 2494
            C+S    C +G +CI +   CDG  DC D SDE     R    C     +C++     P      A W CDG  DC +G DE   C       G L+  C++G   +P ++ CD D DC +G DE  C  P
Sbjct: 1149 CTSYQFSCSSGDQCIATYYRCDGAFDCRDRSDEVGCPTRAPGLCHNDEFQCQSDGLCIP------AGWECDGHPDCDDGSDEHPGCPPRTCAAGYLR--CDNG-NCVPESWRCDGDNDCRDGTDERDCPTP 1270          

HSP 14 Score: 49.6766 bits (117), Expect = 5.144e-6
Identity = 37/115 (32.17%), Postives = 51/115 (44.35%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYN-GVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLE-CGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            C +  CI++A  CDG  DC DG+DE     R C      C +Y    +  +     ++ CDG  DC +  DE  C       C   ++QC      IP  + CD   DC +G DE
Sbjct: 1118 CPDHRCIDNAYVCDGDSDCVDGADE-----RGC---VFNCTSYQFSCSSGDQCIATYYRCDGAFDCRDRSDEVGCPTRAPGLCHNDEFQCQSDGLCIPAGWECDGHPDCDDGSDE 1224          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: sorl1 (sortilin-related receptor, L(DLR class) A repeats containing [Source:ZFIN;Acc:ZDB-GENE-050208-22])

HSP 1 Score: 65.0846 bits (157), Expect = 8.317e-11
Identity = 44/139 (31.65%), Postives = 59/139 (42.45%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQE----FCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGG------------LKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            CS+    C +G CI     CDG  DC DG+DE Q+       Q  P    C +             HW CDG DDCG+  DEA C  + + C               ++QC +  + +P  + CD D DC +  DE  C
Sbjct:  744 CSADGFQCPSGPCIPRRWLCDGDKDCLDGADEQQQCGGLVPPQPTPGHLNCTSSEFQCRSGVCISLHWKCDGVDDCGDYSDEANCRASCIICWSSGPTVAPRCLPLFQFQCRN-HRCVPVWWKCDNDNDCGDWSDEDTC 881          

HSP 2 Score: 62.003 bits (149), Expect = 6.237e-10
Identity = 48/140 (34.29%), Postives = 66/140 (47.14%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCR---------------QCDPLSK-RCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLE-CGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C+S    CR+G CI+    CDG  DC D SDE    CR               +C PL + +C  +  V    P++   W CD ++DCG+  DE  C   +   C   +++C DGT  I   F+CD   DC +G DE  C
Sbjct:  794 CTSSEFQCRSGVCISLHWKCDGVDDCGDYSDEAN--CRASCIICWSSGPTVAPRCLPLFQFQCRNHRCV----PVW---WKCDNDNDCGDWSDEDTCPSKLPSGCPAHQFRCGDGT-CIFDHFVCDGSPDCADGSDEYGC 923          

HSP 3 Score: 61.2326 bits (147), Expect = 1.200e-9
Identity = 49/164 (29.88%), Postives = 73/164 (44.51%), Query Frame = 2
Query: 2117 CSSGSRLCRN-GECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCF---GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCI------QPIIIQESLDSYKINARRGETVTLTCQVTG 2578
            C +    C+N G CI  +  CD + DC D SDE  +   Q      +C+            ++ W CDG++DC +  DE  C    GN+  C    +QC  G   IPR ++CD D DC++G DE +        QP     +  S +   R G  ++L  +  G
Sbjct:  660 CGTNQFRCQNSGRCIPMSYKCDQEDDCGDNSDEPADCPHQ------KCQATEFSCSNGRCVRSAWRCDGDNDCHDWSDEVNCSSSQGNI-SCSADGFQCPSG-PCIPRRWLCDGDKDCLDGADEQQQCGGLVPPQPTPGHLNCTSSEFQCRSGVCISLHWKCDG 815          

HSP 4 Score: 57.3806 bits (137), Expect = 1.588e-8
Identity = 47/138 (34.06%), Postives = 58/138 (42.03%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDE-AKCFGNV--------LECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIII 2503
            C +    C NG C+ SA  CDG  DC D SDE      Q +     C       P  P     W CDG+ DC +G DE  +C G V        L C   ++QC  G   I   + CD   DC +  DE+ C    II
Sbjct:  701 CQATEFSCSNGRCVRSAWRCDGDNDCHDWSDEVNCSSSQGN---ISCSADGFQCPSGPCIPRRWLCDGDKDCLDGADEQQQCGGLVPPQPTPGHLNCTSSEFQCRSGV-CISLHWKCDGVDDCGDYSDEANCRASCII 834          

HSP 5 Score: 52.7582 bits (125), Expect = 4.039e-7
Identity = 40/123 (32.52%), Postives = 51/123 (41.46%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDED---QEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKC-------FGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            CRN  C+     CD   DC D SDED    +    C     RC   +G    +     H+ CDG  DC +G DE  C        G    C   ++QC      +P +  CD   DCV+G DE
Sbjct:  854 CRNHRCVPVWWKCDNDNDCGDWSDEDTCPSKLPSGCPAHQFRCG--DGTCIFD-----HFVCDGSPDCADGSDEYGCPTQHAVITGRPSPCSFTQFQCLKDKTCVPASARCDGRKDCVDGSDE 969          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO45218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTH9])

HSP 1 Score: 77.7962 bits (190), Expect = 2.170e-14
Identity = 49/153 (32.03%), Postives = 74/153 (48.37%), Query Frame = 2
Query: 2045 DNGTRFTCRKGRSTAEVLVLVDP------VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            D  +RFT + G +    L +          C+ G   C NG+CI S+  CD   DC D SDE+      C+P   +C+    ++       + W CD ++DCG+  DE  C G    C   +++C +G K IP ++ CD D DC +  DE+ C
Sbjct:  920 DGSSRFTIKSGLTGVMDLKVFHQDAQTAGTCAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNCPYSTCNPSQFKCDNGRCIS-------SKWRCDHDNDCGDMSDERNCTGT---CAPGQFKCGNG-KCIPSSWKCDHDNDCGDNSDENNC 1061          

HSP 2 Score: 67.781 bits (164), Expect = 2.043e-11
Identity = 41/126 (32.54%), Postives = 56/126 (44.44%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQP 2494
            C+S    C N  CI     CD   DC D SDE     R C P    C +              W CD ++DC +  DE  C      C   ++ C++G + I R+++CD+D DC +G DE  C  P
Sbjct: 1105 CASNYFRCANQRCIPMRWVCDFDNDCRDNSDE-----RDCTPTFSTCASNYFRCANQRCIPMRWVCDFDNDCRDNSDERDCTPTGRSCNSGQFSCSNG-RCISRSWVCDRDNDCGDGSDERNCSYP 1224          

HSP 3 Score: 67.781 bits (164), Expect = 2.149e-11
Identity = 40/123 (32.52%), Postives = 60/123 (48.78%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C+ G   C NG+CI S+  CD   DC D SDE+      C+P   +C+    ++       + W CD ++DCG+  DE  C      C    ++C +  + IP  ++CD D DC +  DE  C
Sbjct: 1027 CAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNCPYSTCNPSQFKCDNGRCIS-------SKWRCDHDNDCGDMSDERNC--TFSTCASNYFRCAN-QRCIPMRWVCDFDNDCRDNSDERDC 1139          

HSP 4 Score: 57.3806 bits (137), Expect = 3.860e-8
Identity = 45/148 (30.41%), Postives = 59/148 (39.86%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAH-W--------------ACDGEDDCGNGYDEAKCFGNVL-----ECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPII 2500
            C+SG   C NG CI+ +  CD   DC DGSDE         P + R        P  PI+    W               CDG DDCG+  DE  C           C   ++QC +  + +  +  CD   DC +  DE+ C  P I
Sbjct: 1187 CNSGQFSCSNGRCISRSWVCDRDNDCGDGSDERNCSYPTTGPWTTR--------PWTPIFSCRSWEFSCLNGRCVFYRLVCDGVDDCGDSSDEMSCNATATPFVPRSCHYWEFQCAN-RRCVYNSQRCDGQNDCGDWSDETGCSTPPI 1325          

HSP 5 Score: 56.6102 bits (135), Expect = 6.094e-8
Identity = 32/120 (26.67%), Postives = 51/120 (42.50%), Query Frame = 2
Query: 2144 NGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIII 2503
            +G CI+++  C+G+ DC D  DE    CR     ++ C              + + CDG   C +G DE  C   +       + C+  T  +P    CD   DC +  DE  C  P+++
Sbjct: 1341 SGLCISTSWLCNGRVDCPDAWDEQPAQCRTSPAPTRTCSPQEYQCDNGACIPSRYECDGRIQCSDGSDETGCTATISPSSCPGFLCDGNTLCLPFYKRCDGSYDCKDYTDEFNCSMPLMV 1460          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO49498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB0])

HSP 1 Score: 72.7886 bits (177), Expect = 4.620e-13
Identity = 45/120 (37.50%), Postives = 63/120 (52.50%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            C+     C NG+CI+ A  CDG  DCAD SDE     + C P    C   NG   I    Q  W CDGE+DCG+  DE  C   +  CG  +++C++ ++ I ++ +CD   DC +  DE
Sbjct:  164 CTDSQFSCSNGQCISLAWRCDGDHDCADKSDERNCTGKTCKPFEFACA--NGRHCI----QRKWICDGENDCGDRSDEVDC--GLESCGNDRWRCSNTSRCIAKSQVCDGRVDCPDASDE 275          

HSP 2 Score: 70.8626 bits (172), Expect = 1.706e-12
Identity = 56/162 (34.57%), Postives = 75/162 (46.30%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQ------------EF----CRQCDPLSKRCE-TYNGVAP--------------INPIYQA--------HWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            CS+G   C+NG CI+    CDG+ DC D SDED+            EF     R+C PLS RC+  Y+ +AP                 +++          W CDG DDCG+G DE  C  +   C   ++ C  G + IP  + CD D DC +G DE  C
Sbjct:    1 CSAGKFTCKNGHCISLRWKCDGENDCVDNSDEDEYAGCAEWSCRASEFRCQASRKCIPLSWRCDGDYDCLAPDLSDEANCSVATNCSASMFRCANGQCKPRDWVCDGFDDCGDGSDEKGCANH--SCTPAQFSCPSG-RCIPLRWRCDGDGDCSDGADERGC 159          

HSP 3 Score: 60.4622 bits (145), Expect = 2.685e-9
Identity = 43/123 (34.96%), Postives = 54/123 (43.90%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            CS+    C NG+C      CDG  DC DGSDE       C P    C       P        W CDG+ DC +G DE  C      C   ++ C++G + I  A+ CD D DC +  DE  C
Sbjct:   86 CSASMFRCANGQCKPRDWVCDGFDDCGDGSDEKGCANHSCTPAQFSC-------PSGRCIPLRWRCDGDGDCSDGADERGCPPK--NCTDSQFSCSNG-QCISLAWRCDGDHDCADKSDERNC 198          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO40539 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6X5])

HSP 1 Score: 66.2402 bits (160), Expect = 2.062e-12
Identity = 58/160 (36.25%), Postives = 74/160 (46.25%), Query Frame = 2
Query: 2012 VQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAH--WACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            V   ++   +ND      CR G  T EV       C S    CRNG CIN    CD   DC DGSDE       C  L+  C+        N  +  H  W CDG +DC +G DE  C     +CG  +++C +G   I R ++CDKD DC +G DE  C
Sbjct:    2 VHRNWKCDGSND------CRDG--TDEVGC---GKCGSTQFRCRNGNCINRNYVCDKDNDCGDGSDE-----VACSRLNGGCQF-----KCNNGHCVHRNWKCDGSNDCRDGTDEVGCG----KCGSTQFRCRNGN-CINRNYVCDKDNDCGDGSDEVAC 135          

HSP 2 Score: 60.8474 bits (146), Expect = 1.489e-10
Identity = 58/159 (36.48%), Postives = 73/159 (45.91%), Query Frame = 2
Query: 2054 TRFTCRKGRSTAEVLVL-VDPVCSSGS------RL-------CRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFG-NVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            T+F CR G       V   D  C  GS      RL       C NG C++    CDG  DC DG+DE    C +C     RC   N    IN  Y     CD ++DCG+G DE  C   N   CG  +Y+C D  + IP  ++CD+  DC +  DES C
Sbjct:   29 TQFRCRNGNCINRNYVCDKDNDCGDGSDEVACSRLNGGCQFKCNNGHCVHRNWKCDGSNDCRDGTDE--VGCGKCGSTQFRCRNGN---CINRNY----VCDKDNDCGDGSDEVACSRLNGGWCGAGQYRC-DNDRCIPLNWVCDRLNDCHDNSDESGC 177          

HSP 3 Score: 49.2914 bits (116), Expect = 1.394e-6
Identity = 43/118 (36.44%), Postives = 59/118 (50.00%), Query Frame = 2
Query: 2153 CINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQ 2506
            C++    CDG  DC DG+DE    C +C     RC   N    IN  Y     CD ++DCG+G DE  C  + L  GG +++CN+G   + R + CD   DC +G DE  C +    Q
Sbjct:    1 CVHRNWKCDGSNDCRDGTDE--VGCGKCGSTQFRCRNGN---CINRNY----VCDKDNDCGDGSDEVAC--SRLN-GGCQFKCNNG-HCVHRNWKCDGSNDCRDGTDEVGCGKCGSTQ 105          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO43726 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXU8])

HSP 1 Score: 67.3958 bits (163), Expect = 2.382e-11
Identity = 50/171 (29.24%), Postives = 72/171 (42.11%), Query Frame = 2
Query: 2105 VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC----------------RQCDPLSKRCETYNG-----------VAPINP--------------IYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQP 2494
            V   C+S    C NG+CI+++  CDG  DC DGSDE +  C                R+C P   +C+  N             A ++P                  HW CDGE DC +G DE  C  +   C   ++ C +G + IP +  CD  ++C +  DE  C+ P
Sbjct:  116 VQRTCASNQFTCSNGDCISNSWTCDGDNDCNDGSDEKESLCASKSCKITEFTCRTSRRKCIPSQWKCDGDNDCPDSSDESGCPTASVSPRRCSVGMFKCRNGECVLGHWRCDGEKDCSDGSDEKGCRKS--NCASSEFTCANG-QCIPSSQRCDGTSNCRDSSDEKACVTP 283          

HSP 2 Score: 65.0846 bits (157), Expect = 1.168e-10
Identity = 51/182 (28.02%), Postives = 76/182 (41.76%), Query Frame = 2
Query: 2012 VQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDG-TKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETV 2554
            +Q T++    +D      CR G  + E     +  C +   +C N +CI+ +  CD + DC D SDED+   R C      C   + ++         W CDG++DC +G DE +       C   ++ C     K IP  + CD D DC +  DES C    +            R GE V
Sbjct:   53 IQATWKCDGEDD------CRDGYRSDES-NCGNVTCGADEFMCSNRKCISRSWTCDNQDDCGDNSDEDRNVQRTCASNQFTCSNGDCIS-------NSWTCDGDNDCNDGSDEKESLCASKSCKITEFTCRTSRRKCIPSQWKCDGDNDCPDSSDESGCPTASVSPRRCSVGMFKCRNGECV 220          

HSP 3 Score: 63.929 bits (154), Expect = 2.842e-10
Identity = 52/128 (40.62%), Postives = 66/128 (51.56%), Query Frame = 2
Query: 2117 CSSGSRLC-RNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGY--DEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQ 2491
            CS G   C  + +CI     CDG+ DC+DGSDE      Q  P  K C             QA W CDGEDDC +GY  DE+ C GNV  CG  ++ C++  K I R++ CD   DC +  DE R +Q
Sbjct:    1 CSHGQFECVSDQKCIVLRWRCDGEDDCSDGSDE------QGSP--KTCLQDQFTCRNGKCIQATWKCDGEDDCRDGYRSDESNC-GNVT-CGADEFMCSN-RKCISRSWTCDNQDDCGDNSDEDRNVQ 117          

HSP 4 Score: 58.9214 bits (141), Expect = 1.010e-8
Identity = 44/120 (36.67%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            CS G   CRNGEC+     CDG+ DC+DGSDE  + CR+ +  S      NG     P  Q    CDG  +C +  DE  C      C   +++C    + IP + +CD   DC +G+DE
Sbjct:  207 CSVGMFKCRNGECVLGHWRCDGEKDCSDGSDE--KGCRKSNCASSEFTCANGQCI--PSSQR---CDGTSNCRDSSDEKACV-TPPPCMPGEFKCQSTGRCIPESKVCDGTRDCQDGEDE 318          

HSP 5 Score: 57.7658 bits (138), Expect = 2.235e-8
Identity = 39/114 (34.21%), Postives = 55/114 (48.25%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLE-CGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDE 2476
            CRNG+CI +   CDG+ DC DG   D+  C      +  C     +          W CD +DDCG+  DE +   NV   C   ++ C++G   I  ++ CD D DC +G DE
Sbjct:   47 CRNGKCIQATWKCDGEDDCRDGYRSDESNCG-----NVTCGADEFMCSNRKCISRSWTCDNQDDCGDNSDEDR---NVQRTCASNQFTCSNG-DCISNSWTCDGDNDCNDGSDE 151          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO43938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXB8])

HSP 1 Score: 66.6254 bits (161), Expect = 4.098e-11
Identity = 44/116 (37.93%), Postives = 53/116 (45.69%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            CRNG C+     CDG  DC D SDED    R   P  K  +     A  N      W CDGE DC +G DEA C    + C   ++ C +  K IP    CD   +C +G DE  C
Sbjct:  128 CRNGRCVLKEWLCDGMDDCGDSSDEDNCLTRPTPPPVKCRKNERMCADGNGCVHRRWICDGERDCLDGSDEAGC--GTIGCSSDEFTCTN-QKCIPLPQKCDGTDNCGDGSDEKMC 240          

HSP 2 Score: 59.3066 bits (142), Expect = 7.006e-9
Identity = 48/164 (29.27%), Postives = 63/164 (38.41%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDP------LSKRC--------------------ETYNGVAPINPIYQ----------AHWACDGEDDCGNGYDEAKCFGN----VLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
             CS+    C +G CI S   CD + DC D SDE     + C P       S RC                       N     NP+              W CDG DDCG+  DE  C        ++C   +  C DG   + R +ICD + DC++G DE+ C
Sbjct:   38 TCSANEFRCDDGRCITSTFRCDREFDCTDRSDERGCVNKTCAPYEFTCAFSGRCIPGRFRCDHRSDCLDGSDEQNCQNAAKTCNPVTDHTCRNGRCVLKEWLCDGMDDCGDSSDEDNCLTRPTPPPVKCRKNERMCADGNGCVHRRWICDGERDCLDGSDEAGC 201          

HSP 3 Score: 51.6026 bits (122), Expect = 1.701e-6
Identity = 38/123 (30.89%), Postives = 54/123 (43.90%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C      C N +C+ ++  CDG+ DC D SDE  E    C     RC+    +        + + CD E DC +  DE  C      C   ++ C    + IP  F CD  +DC++G DE  C
Sbjct:    1 CPPSDFTCANSQCVPNSFRCDGENDCGDRSDE-SEPTTTCSANEFRCDDGRCIT-------STFRCDREFDCTDRSDERGCVNKT--CAPYEFTCAFSGRCIPGRFRCDHRSDCLDGSDEQNC 113          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:NCBI gene;Acc:101159991])

HSP 1 Score: 121.709 bits (304), Expect = 2.097e-27
Identity = 76/212 (35.85%), Postives = 106/212 (50.00%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCF-GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSG 2749
            C +    C++GECI+    CDG+ DCADGSDE +     C+P   RC+  NG   +       W CDG++DC +  DE  C  G   +C    ++C    K IP ++ CD++ DC +  DE  C  P +     +S  I A RG TV  TC+  G P P I WR NWG +    R+ +     N      TLTI + +  D G Y CEA++ 
Sbjct:  183 CRADQATCQSGECISRDYICDGERDCADGSDEFRCTPSPCEPNEFRCK--NGRCALK-----LWRCDGDNDCEDNSDEMDCTKGPEEQCASKHFECVSDRKCIPASYQCDEEPDCADRSDEYGC-PPTVTTPPEES--IQAVRGSTVMFTCRAVGVPTPMITWRLNWGHIPVSGRVSM-----NNKNGFGTLTIRDVKESDQGAYTCEAINA 379          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: lrp8 (low-density lipoprotein receptor-related protein 8 [Source:NCBI gene;Acc:101167610])

HSP 1 Score: 91.6633 bits (226), Expect = 2.485e-18
Identity = 51/140 (36.43%), Postives = 69/140 (49.29%), Query Frame = 2
Query: 2102 LVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQ--CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESL 2515
            L    C++    C+NG+C+ S   CDG+P+CADGSDE    C +  C P     E ++     +      W CDGE DC NG DE +C  +   C    +QC +G K I   F+CD D DC +  DE +C  P   Q   
Sbjct:   10 LSKKTCATTDFTCKNGQCLPSKWRCDGEPECADGSDEADAICSRQTCPP-----EKFDCGGAASKCVSLSWRCDGERDCENGADEEQCAADAKACASKDFQCRNG-KCIGPTFVCDGDNDCGDSSDEEKCSSPTCGQHEF 143          

HSP 2 Score: 72.7886 bits (177), Expect = 1.671e-12
Identity = 53/159 (33.33%), Postives = 66/159 (41.51%), Query Frame = 2
Query: 2060 FTCRKGRSTAEVLVL---------------VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC-RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCI 2488
            F CR G+      V                  P C      C N ECI +   CDG PDC D SDE  E C R  +P   RC               +W CDG+ DC +  DEA C   +L C   ++QC DGT  I     C+K  DC +  DE+ C+
Sbjct:  104 FQCRNGKCIGPTFVCDGDNDCGDSSDEEKCSSPTCGQHEFRCNNSECIPALWSCDGDPDCKDKSDESAERCSRGKEPQKPRCPVGEFQCGSGECVHMNWKCDGDADCKDKSDEANC--PLLTCRPDEFQCGDGT-CIHGTKQCNKVHDCPDYSDEAGCV 259          

HSP 3 Score: 58.9214 bits (141), Expect = 2.383e-8
Identity = 55/189 (29.10%), Postives = 79/189 (41.80%), Query Frame = 2
Query: 1949 ANGGRAADT----QRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEA--KCF----GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            A+G   AD     Q    EK + G       +++   +G R  C  G +  E        C+S    CRNG+CI     CDG  DC D SDE++     C     RC     +        A W+CDG+ DC +  DE+  +C          C   ++QC  G + +   + CD D DC +  DE+ C
Sbjct:   41 ADGSDEADAICSRQTCPPEKFDCGGAASKCVSLSWRCDGER-DCENG-ADEEQCAADAKACASKDFQCRNGKCIGPTFVCDGDNDCGDSSDEEKCSSPTCGQHEFRCNNSECIP-------ALWSCDGDPDCKDKSDESAERCSRGKEPQKPRCPVGEFQCGSG-ECVHMNWKCDGDADCKDKSDEANC 219          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: lrp8 (low-density lipoprotein receptor-related protein 8 [Source:NCBI gene;Acc:101167610])

HSP 1 Score: 91.2781 bits (225), Expect = 2.807e-18
Identity = 50/136 (36.76%), Postives = 68/136 (50.00%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQ--CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESL 2515
             C++    C+NG+C+ S   CDG+P+CADGSDE    C +  C P     E ++     +      W CDGE DC NG DE +C  +   C    +QC +G K I   F+CD D DC +  DE +C  P   Q   
Sbjct:   81 TCATTDFTCKNGQCLPSKWRCDGEPECADGSDEADAICSRQTCPP-----EKFDCGGAASKCVSLSWRCDGERDCENGADEEQCAADAKACASKDFQCRNG-KCIGPTFVCDGDNDCGDSSDEEKCSSPTCGQHEF 210          

HSP 2 Score: 72.7886 bits (177), Expect = 1.452e-12
Identity = 53/159 (33.33%), Postives = 66/159 (41.51%), Query Frame = 2
Query: 2060 FTCRKGRSTAEVLVL---------------VDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFC-RQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCI 2488
            F CR G+      V                  P C      C N ECI +   CDG PDC D SDE  E C R  +P   RC               +W CDG+ DC +  DEA C   +L C   ++QC DGT  I     C+K  DC +  DE+ C+
Sbjct:  171 FQCRNGKCIGPTFVCDGDNDCGDSSDEEKCSSPTCGQHEFRCNNSECIPALWSCDGDPDCKDKSDESAERCSRGKEPQKPRCPVGEFQCGSGECVHMNWKCDGDADCKDKSDEANC--PLLTCRPDEFQCGDGT-CIHGTKQCNKVHDCPDYSDEAGCV 326          

HSP 3 Score: 59.3066 bits (142), Expect = 2.072e-8
Identity = 55/189 (29.10%), Postives = 79/189 (41.80%), Query Frame = 2
Query: 1949 ANGGRAADT----QRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEA--KCF----GNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            A+G   AD     Q    EK + G       +++   +G R  C  G +  E        C+S    CRNG+CI     CDG  DC D SDE++     C     RC     +        A W+CDG+ DC +  DE+  +C          C   ++QC  G + +   + CD D DC +  DE+ C
Sbjct:  108 ADGSDEADAICSRQTCPPEKFDCGGAASKCVSLSWRCDGER-DCENG-ADEEQCAADAKACASKDFQCRNGKCIGPTFVCDGDNDCGDSSDEEKCSSPTCGQHEFRCNNSECIP-------ALWSCDGDPDCKDKSDESAERCSRGKEPQKPRCPVGEFQCGSG-ECVHMNWKCDGDADCKDKSDEANC 286          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: ldlrb (low-density lipoprotein receptor [Source:NCBI gene;Acc:101161779])

HSP 1 Score: 89.7373 bits (221), Expect = 9.816e-18
Identity = 52/129 (40.31%), Postives = 67/129 (51.94%), Query Frame = 2
Query: 2114 VCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRC--ETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQP 2494
             CSS    C NG C+     CDG  DC DG+DE    C      SK C    +N  APIN      W CDG+ DC NG DE  C   V +C   +++C +G + I  +F+CD D DC +G DE+ C +P
Sbjct:   29 TCSSSQLKCGNGRCVTRRWICDGTDDCGDGTDELLSTC-----ASKTCLPSQFNCGAPINQCVPKSWHCDGKADCSNGADEKNC--TVKQCKNDEFRCANG-QCISLSFVCDNDNDCSDGSDETTCSKP 149          

HSP 2 Score: 70.4774 bits (171), Expect = 6.713e-12
Identity = 44/127 (34.65%), Postives = 67/127 (52.76%), Query Frame = 2
Query: 2138 CRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDE--AKCFGN--VLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQ 2506
            C NG+CI+ +  CD   DC+DGSDE       C+PLS +C     V  +       W CDG++DC +G DE    C G     +C   +++C +G + IP ++ CD   DC +  DE  C +P+ ++
Sbjct:  119 CANGQCISLSFVCDNDNDCSDGSDETTCSKPTCNPLSFQCNNSVCVPSL-------WRCDGDEDCADGSDEWPETCGGKKPAAKCSVSEFECANG-QCIPGSWRCDGGIDCDDRSDELNCSRPVCLE 237          

HSP 3 Score: 60.8474 bits (146), Expect = 5.924e-9
Identity = 45/125 (36.00%), Postives = 56/125 (44.80%), Query Frame = 2
Query: 2111 PVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            P C+  S  C N  C+ S   CDG  DCADGSDE  E C    P +K C                W CDG  DC +  DE  C   V  C   ++QC DG+  +     C+   DC +G DE+ C
Sbjct:  149 PTCNPLSFQCNNSVCVPSLWRCDGDEDCADGSDEWPETCGGKKPAAK-CSVSEFECANGQCIPGSWRCDGGIDCDDRSDELNCSRPV--CLEGQFQCGDGS-CLQGNLKCNSVRDCSDGSDETDC 269          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: ENSORLT00000036597.1 (low-density lipoprotein receptor-related protein 1B [Source:NCBI gene;Acc:100049327])

HSP 1 Score: 81.2629 bits (199), Expect = 4.172e-15
Identity = 45/123 (36.59%), Postives = 62/123 (50.41%), Query Frame = 2
Query: 2117 CSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            CSS    C +G+C++++  CDG PDC DGSDE  E C +    +  C T +            W CDG+ DC +G DE  C     +C   ++QC  G+  IP A+ CD   DC +  DE  C
Sbjct:  304 CSSSEFKCTSGQCVSASMHCDGHPDCWDGSDE--ESCVK----APVCTTNHRCTQSKECLLQEWMCDGDQDCKDGSDEKDCPVAPADCEDFQWQCRSGSACIPTAWRCDGTKDCDDNSDEHEC 420          

HSP 2 Score: 73.1738 bits (178), Expect = 1.417e-12
Identity = 44/126 (34.92%), Postives = 66/126 (52.38%), Query Frame = 2
Query: 2117 CSSGSRLCRNG-ECINSAKFCDGKPDCADGSDED--QEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRC 2485
            C  G+ LC++G ECI  +  CDG+ DCADGSDE+  +  CR+        + +        I + H  CDG   C +  DE +C      C    +QC+D  + +P  F+CD + DC++G DE+ C
Sbjct:   48 CKVGTVLCKDGSECIQYSLLCDGEQDCADGSDEEDCESGCRE--------DQFQCAHGKKCIDKQH-VCDGTAHCQDHSDEQQCMKRTDNCA---HQCDDKNRCLPATFVCDGERDCLDGTDEASC 161          

HSP 3 Score: 70.4774 bits (171), Expect = 8.193e-12
Identity = 50/157 (31.85%), Postives = 77/157 (49.04%), Query Frame = 2
Query: 2117 CSSGSRLCRN-GECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFP 2584
            C  GS+LCR+  +C++    CDG+PDC DGSDE ++    CD    +C      A      +    CDG   C +  DE +C    +E  G  +QC D ++ IP +F+CD + DC +G DE+ C      ++   S +     G+ V+ +    G P
Sbjct:  187 CPLGSKLCRDKSDCVHYNHVCDGEPDCRDGSDE-EDCLSTCDSDQFQC------AHGKKCIEKSQVCDGVPQCQDRSDELEC-AKYME--GCAHQC-DKSRCIPSSFLCDGEQDCADGSDEASC-----AEKECSSSEFKCTSGQCVSASMHCDGHP 327          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000012051.1 (SMESG000012051.1)

HSP 1 Score: 1862.43 bits (4823), Expect = 0.000e+0
Identity = 908/914 (99.34%), Postives = 910/914 (99.56%), Query Frame = 2
Query:   59 MKYLSLFFAILSFLYVVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYEWIDPRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSSFFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIXXXXXXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMNFRN 2800
            MKYLSLFFAILSFLYVVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYEWIDPRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSSFFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKS SKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIDSRWSRSDDS AEETSFIILTQAEMKDAG YICTEPQTRDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCR CDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIP+AFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTG+PLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMNFRN
Sbjct:    1 MKYLSLFFAILSFLYVVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYEWIDPRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPSGERQSSSSFFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSGSKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIDSRWSRSDDSTAEETSFIILTQAEMKDAGAYICTEPQTRDTARATLIVESDLRIIVTPPIIKLRSGQTATFQCYVLGAGRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRLCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPKAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGYPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLMNFRN 914          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000027815.1 (SMESG000027815.1)

HSP 1 Score: 473.781 bits (1218), Expect = 2.210e-152
Identity = 281/802 (35.04%), Postives = 429/802 (53.49%), Query Frame = 2
Query:  437 IIFMACKEASGASANYKYEWITPSGERQSSSSF-FKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVFGETVEFKCQVDKSKTD-----NKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRL---YVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQT-RNRDVIWSFLSKETGQITNIXXXX-XXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDL---RIIVTPPIIKLRSGQTATFQCYVLGA-GRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRA-VTTNDNGTRFTCR-KGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVL-ECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLM 2788
             I +AC   + A       W+   G+  +++ + +   +  +  G Y C + ++ D Q+     F +   L I I  +S + +  E+++   Q+ +  +D       +   +TY+WL+ +N  I N  IL++ + D++  G Y C+  ++  +  Y     + ++              Y  +  +NP   R+ E   L CEV P  +++ Y  Y  D  I       I    K N+G Y+CV+  +  +    ++     + Q  F   SKIEL+  PGPQ++V  G+K+ELHCEI  ++G +GK A WY  G++  + D     I ++ RL   YVS++V+ +I Q NEG YECRV    KE  +IV+      E SP     KV +G  VEFHCRVE   + +N ++ W+F SKE     NI        +D  A++TSFI+L +AE+ D+G YICTEP  + TAR+ LIV  D     + +TP  I++R+GQ    +C+     GR+   PEF   N        R  +  +     +LT    ++ +DN     C  +GR  +  + + D +C  G R C+NGEC+ +AKFCD    CAD SDED   CR+CDP+S++CE  N + P    +  HW CDGE+DCGNGYDE  C G  L  CGG  + C+D  K+IPR ++CD++ DC  G+DE+ C  P I + S  + K+ A + + VTLTC+ TG PLP ++WRFNWGC+ N  R        +C    S+LTI +F+ GDDGIYNCEALS  +R++S D+Q+++
Sbjct:   53 FINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIR----FNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLK----------QSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGK--LDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGD-----IPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPP--ILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQ-TARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSD-ICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSD-NKTIPRGYVCDENIDCSQGEDETGCTSPQITKTS--ATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNFVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVIL 826          

HSP 2 Score: 65.855 bits (159), Expect = 1.580e-10
Identity = 104/501 (20.76%), Postives = 199/501 (39.72%), Query Frame = 2
Query:  197 TTYEWIDPRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASA----NYKYEWITPSGERQSSSSFFKNQVGPE-FTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPV---FGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQ--SMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPK-NVRFFEPLELNCEV--TPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKI-----ELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQE------INSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYEC-RVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTR 1624
            T+  W+D    +  +N  L I +   +  G Y C   ++ D ++   N++L L++     + S +  ++  +  +    G I   C +          ++ Y W+    +   +++  +  V  E   G+Y C+      +++ E   +V +K       K+  NP    +GE    +C+V+        + +  Y+W   K+  I NDQ L +K   +   GTY C  + Q  S     ++  + +  F  +S        E +T+    P+  V   E  EL+CE+  +   R    E Y N +         + RLD       Q VS    S+ +++   N    + +  K  + I      L E   P + V+ G   E HC +     ++  N  W F+ +E      I  + +   N ++  +   S +VL   + ++ G Y C    G+T  + +IV+       ++ + +  +V  G  V+  C  +  Q R
Sbjct:   68 TSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIR-FNRTLHLKIT----IPSISIDILPEESLKI--GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVE------PFYQNIKYTWY-KKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKI------ELTTK--PGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDG------QYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQ--TSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGR 538          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000027815.1 (SMESG000027815.1)

HSP 1 Score: 473.396 bits (1217), Expect = 2.466e-152
Identity = 281/802 (35.04%), Postives = 429/802 (53.49%), Query Frame = 2
Query:  437 IIFMACKEASGASANYKYEWITPSGERQSSSSF-FKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVFGETVEFKCQVDKSKTD-----NKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRL---YVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQT-RNRDVIWSFLSKETGQITNIXXXX-XXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDL---RIIVTPPIIKLRSGQTATFQCYVLGA-GRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRA-VTTNDNGTRFTCR-KGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVL-ECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLM 2788
             I +AC   + A       W+   G+  +++ + +   +  +  G Y C + ++ D Q+     F +   L I I  +S + +  E+++   Q+ +  +D       +   +TY+WL+ +N  I N  IL++ + D++  G Y C+  ++  +  Y     + ++              Y  +  +NP   R+ E   L CEV P  +++ Y  Y  D  I       I    K N+G Y+CV+  +  +    ++     + Q  F   SKIEL+  PGPQ++V  G+K+ELHCEI  ++G +GK A WY  G++  + D     I ++ RL   YVS++V+ +I Q NEG YECRV    KE  +IV+      E SP     KV +G  VEFHCRVE   + +N ++ W+F SKE     NI        +D  A++TSFI+L +AE+ D+G YICTEP  + TAR+ LIV  D     + +TP  I++R+GQ    +C+     GR+   PEF   N        R  +  +     +LT    ++ +DN     C  +GR  +  + + D +C  G R C+NGEC+ +AKFCD    CAD SDED   CR+CDP+S++CE  N + P    +  HW CDGE+DCGNGYDE  C G  L  CGG  + C+D  K+IPR ++CD++ DC  G+DE+ C  P I + S  + K+ A + + VTLTC+ TG PLP ++WRFNWGC+ N  R        +C    S+LTI +F+ GDDGIYNCEALS  +R++S D+Q+++
Sbjct:   49 FINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIR----FNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLK----------QSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGK--LDLMEESIQQFAFFRESKIELTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGD-----IPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPP--ILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQ-TARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSD-ICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSD-NKTIPRGYVCDENIDCSQGEDETGCTSPQITKTS--ATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNFVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVIL 822          

HSP 2 Score: 65.855 bits (159), Expect = 1.485e-10
Identity = 104/501 (20.76%), Postives = 199/501 (39.72%), Query Frame = 2
Query:  197 TTYEWIDPRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASA----NYKYEWITPSGERQSSSSFFKNQVGPE-FTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPV---FGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQ--SMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPK-NVRFFEPLELNCEV--TPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELS-----EPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQE------INSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYEC-RVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTR 1624
            T+  W+D    +  +N  L I +   +  G Y C   ++ D ++   N++L L++     + S +  ++  +  +    G I   C +          ++ Y W+    +   +++  +  V  E   G+Y C+      +++ E   +V +K       K+  NP    +GE    +C+V+        + +  Y+W   K+  I NDQ L +K   +   GTY C  + Q  S     ++  + +  F  +S        E +T+    P+  V   E  EL+CE+  +   R    E Y N +         + RLD       Q VS    S+ +++   N    + +  K  + I L      E   P + V+ G   E HC +     ++  N  W F+ +E      I  + +   N ++  +   S +VL   + ++ G Y C    G+T  + +IV+       ++ + +  +V  G  V+  C  +  Q R
Sbjct:   64 TSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIR-FNRTLHLKIT----IPSISIDILPEESLKI--GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVE------PFYQNIKYTWY-KKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFRESKI------ELTTK--PGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDG------QYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQ--TSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGR 534          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000027815.1 (SMESG000027815.1)

HSP 1 Score: 462.225 bits (1188), Expect = 5.070e-148
Identity = 277/802 (34.54%), Postives = 427/802 (53.24%), Query Frame = 2
Query:  437 IIFMACKEASGASANYKYEWITPSGERQSSSSF-FKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVFGETVEFKCQVDKSKTD-----NKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRL---YVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQT-RNRDVIWSFLSKETGQITNIXXXX-XXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDL---RIIVTPPIIKLRSGQTATFQCYVLGA-GRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRA-VTTNDNGTRFTCR-KGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVL-ECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLM 2788
             I +AC   + A       W+   G+  +++ + +   +  +  G Y C + ++ D Q+     F +   L I I  +S + +  E+++   Q+ +  +D       +   +TY+WL+ +N  I N  IL++ + D++  G Y C+  ++  +  Y     + ++              Y  +  +NP   R+ E   L CEV P  +++ Y  Y  D  I       I    K N+G Y+CV+  +  +    ++     + Q  F    + +L+  PGPQ++V  G+K+ELHCEI  ++G +GK A WY  G++  + D     I ++ RL   YVS++V+ +I Q NEG YECRV    KE  +IV+      E SP     KV +G  VEFHCRVE   + +N ++ W+F SKE     NI        +D  A++TSFI+L +AE+ D+G YICTEP  + TAR+ LIV  D     + +TP  I++R+GQ    +C+     GR+   PEF   N        R  +  +     +LT    ++ +DN     C  +GR  +  + + D +C  G R C+NGEC+ +AKFCD    CAD SDED   CR+CDP+S++CE  N + P    +  HW CDGE+DCGNGYDE  C G  L  CGG  + C+D  K+IPR ++CD++ DC  G+DE+ C  P I + S  + K+ A + + VTLTC+ TG PLP ++WRFNWGC+ N  R        +C    S+LTI +F+ GDDGIYNCEALS  +R++S D+Q+++
Sbjct:   53 FINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIR----FNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLK----------QSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGK--LDLMEESIQQFAF---FREKLTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGD-----IPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPP--ILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQ-TARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSD-ICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSD-NKTIPRGYVCDENIDCSQGEDETGCTSPQITKTS--ATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNFVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVIL 823          

HSP 2 Score: 65.855 bits (159), Expect = 1.376e-10
Identity = 102/500 (20.40%), Postives = 194/500 (38.80%), Query Frame = 2
Query:  197 TTYEWIDPRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASA----NYKYEWITPSGERQSSSSFFKNQVGPE-FTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPV---FGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQ--SMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEV--TPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKI-----ELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQE------INSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYEC-RVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTR 1624
            T+  W+D    +  +N  L I +   +  G Y C   ++ D ++   N++L L++     + S +  ++  +  +    G I   C +          ++ Y W+    +   +++  +  V  E   G+Y C+      +++ E   +V +K       K+  NP    +GE    +C+V+        + +  Y+W   K+  I NDQ L +K   +   GTY C  + Q  S     ++  + +  F  +  T       Y  R           E  EL+CE+  +   R    E Y N +         + RLD       Q VS    S+ +++   N    + +  K  + I      L E   P + V+ G   E HC +     ++  N  W F+ +E      I  + +   N ++  +   S +VL   + ++ G Y C    G+T  + +IV+       ++ + +  +V  G  V+  C  +  Q R
Sbjct:   68 TSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIR-FNRTLHLKIT----IPSISIDILPEESLKI--GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVE------PFYQNIKYTWY-KKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFREKLTTKPGPQVYVHR----------GEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDG------QYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQ--TSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGR 535          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000027815.1 (SMESG000027815.1)

HSP 1 Score: 461.84 bits (1187), Expect = 5.488e-148
Identity = 277/802 (34.54%), Postives = 427/802 (53.24%), Query Frame = 2
Query:  437 IIFMACKEASGASANYKYEWITPSGERQSSSSF-FKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPVFGETVEFKCQVDKSKTD-----NKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVIPRL---YVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQT-RNRDVIWSFLSKETGQITNIXXXX-XXXXXXAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDL---RIIVTPPIIKLRSGQTATFQCYVLGA-GRSPDYPEFFMANGGRAADTQRTTVEKLEAGKVQLTYRA-VTTNDNGTRFTCR-KGRSTAEVLVLVDPVCSSGSRLCRNGECINSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHWACDGEDDCGNGYDEAKCFGNVL-ECGGLKYQCNDGTKSIPRAFICDKDTDCVNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRFNWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKRAWSKDYQLLM 2788
             I +AC   + A       W+   G+  +++ + +   +  +  G Y C + ++ D Q+     F +   L I I  +S + +  E+++   Q+ +  +D       +   +TY+WL+ +N  I N  IL++ + D++  G Y C+  ++  +  Y     + ++              Y  +  +NP   R+ E   L CEV P  +++ Y  Y  D  I       I    K N+G Y+CV+  +  +    ++     + Q  F    + +L+  PGPQ++V  G+K+ELHCEI  ++G +GK A WY  G++  + D     I ++ RL   YVS++V+ +I Q NEG YECRV    KE  +IV+      E SP     KV +G  VEFHCRVE   + +N ++ W+F SKE     NI        +D  A++TSFI+L +AE+ D+G YICTEP  + TAR+ LIV  D     + +TP  I++R+GQ    +C+     GR+   PEF   N        R  +  +     +LT    ++ +DN     C  +GR  +  + + D +C  G R C+NGEC+ +AKFCD    CAD SDED   CR+CDP+S++CE  N + P    +  HW CDGE+DCGNGYDE  C G  L  CGG  + C+D  K+IPR ++CD++ DC  G+DE+ C  P I + S  + K+ A + + VTLTC+ TG PLP ++WRFNWGC+ N  R        +C    S+LTI +F+ GDDGIYNCEALS  +R++S D+Q+++
Sbjct:   49 FINIACNVTNYALNETSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIR----FNRTLHLKITIPSISIDILPEESLKIGGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLK----------QSVSYKIKIITNPALFRYGERFSLRCEVEPFYQNIKYTWYKKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGK--LDLMEESIQQFAF---FREKLTTKPGPQVYVHRGEKKELHCEIETSSGNRGKEAEWYINGKKFKNGD-----IPLVNRLDGQYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPP--ILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQTSFIVLMKAEVSDSGYYICTEPNGQ-TARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGRASGNPEFSFTNNKPIGRDGRFKISNVGPAHKRLTAPGGLSLSDNNMDVFCSLEGRQVSSKIYVSD-ICPPGYRFCQNGECLENAKFCDKINHCADKSDEDPITCRECDPISRKCEINNQILPKKNYFLIHWICDGEEDCGNGYDEQNCDGFSLNNCGGKFFTCSD-NKTIPRGYVCDENIDCSQGEDETGCTSPQITKTS--ATKVVATKSQLVTLTCEATGKPLPVLVWRFNWGCIQNSTRFSTNFFSTDCNFVTSSLTIKDFKAGDDGIYNCEALSSRQRSFSNDFQVIL 819          

HSP 2 Score: 65.855 bits (159), Expect = 1.316e-10
Identity = 102/500 (20.40%), Postives = 194/500 (38.80%), Query Frame = 2
Query:  197 TTYEWIDPRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQVKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASA----NYKYEWITPSGERQSSSSFFKNQVGPE-FTGQYTCRMTRISDNQVSEGKAFVQVKALPIMIEKVSGNPV---FGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQILRLKLDDQTKFGTYTCRINTQ--SMNPPYVQNQVIEIRFTGDSNTGGRSRNEYSTRFSSNPKNVRFFEPLELNCEV--TPPLRDVTYEIYFNDRLISQSSRHTIPRLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKI-----ELSEPPGPQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQE------INSNDYARYNIQVIPRLYVSIMVLRNIQQTNEGKYEC-RVRGETKEAYIIVMAKSKNTEVSPSQQTRKVGDGIPVEFHCRVEGYQTR 1624
            T+  W+D    +  +N  L I +   +  G Y C   ++ D ++   N++L L++     + S +  ++  +  +    G I   C +          ++ Y W+    +   +++  +  V  E   G+Y C+      +++ E   +V +K       K+  NP    +GE    +C+V+        + +  Y+W   K+  I NDQ L +K   +   GTY C  + Q  S     ++  + +  F  +  T       Y  R           E  EL+CE+  +   R    E Y N +         + RLD       Q VS    S+ +++   N    + +  K  + I      L E   P + V+ G   E HC +     ++  N  W F+ +E      I  + +   N ++  +   S +VL   + ++ G Y C    G+T  + +IV+       ++ + +  +V  G  V+  C  +  Q R
Sbjct:   64 TSIRWLDKDGKVAAANRYLYIKSLLKQDEGIYNCSVEKVKDPQIR-FNRTLHLKIT----IPSISIDILPEESLKI--GGQIKRQCSDLGLPQETIVDDFTYTWLNQQNKTIGNTNILQIPVVDESVVGRYICQYKSKETSKIYEAATYVNLKQSVSYKIKIITNPALFRYGERFSLRCEVE------PFYQNIKYTWY-KKDEFIGNDQELVIKSFKKDNVGTYKCVASLQLPSGKLDLMEESIQQFAFFREKLTTKPGPQVYVHR----------GEKKELHCEIETSSGNRGKEAEWYINGKKFKNGDIPLVNRLDG------QYVSMLVISDISQINEGNYECRVGSSIKEVNLIVLLDEGLIETSPPILKVKEGQSVEFHCRVENIPSVKNVNLKWNFESKEGLVRNNIPDSRWQLMNDEIADQ--TSFIVLMKAEVSDSGYYICTEPNGQTARSELIVIPDKDKNSLTITPREIRVRAGQRVDIECFSKNTQGR 531          
The following BLAST results are available for this feature:
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPG21.317e-2737.38heparan sulfate proteoglycan 2 [Source:HGNC Symbol... [more]
LDLR9.748e-1730.41low density lipoprotein receptor [Source:HGNC Symb... [more]
LDLR1.775e-1539.84low density lipoprotein receptor [Source:HGNC Symb... [more]
LDLR2.670e-1538.46low density lipoprotein receptor [Source:HGNC Symb... [more]
LDLR2.735e-1538.46low density lipoprotein receptor [Source:HGNC Symb... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-524.627e-2731.46Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-524.643e-2731.46Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-524.956e-2731.46Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-525.105e-2731.46Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-525.413e-2731.46Basement membrane proteoglycan [Source:UniProtKB/... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trol6.431e-2834.74gene:FBgn0284408 transcript:FBtr0342821[more]
trol6.633e-2834.74gene:FBgn0284408 transcript:FBtr0342809[more]
trol7.005e-2834.74gene:FBgn0284408 transcript:FBtr0342825[more]
trol7.158e-2834.74gene:FBgn0284408 transcript:FBtr0342823[more]
trol7.353e-2834.74gene:FBgn0284408 transcript:FBtr0342811[more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg21.885e-2935.35heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg21.969e-2935.35heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg22.399e-2935.51heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
vldlr3.469e-1540.31very low density lipoprotein receptor [Source:ZFIN... [more]
vldlr3.671e-1540.31very low density lipoprotein receptor [Source:ZFIN... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sel1l8.952e-2735.61SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
sel1l3.509e-2635.75SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
sel1l4.745e-2536.10SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
ppp2r2b7.768e-1438.05protein phosphatase 2 regulatory subunit B, beta [... [more]
ppp2r2b8.011e-1438.05protein phosphatase 2 regulatory subunit B, beta [... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspg22.693e-2936.41perlecan (heparan sulfate proteoglycan 2) [Source:... [more]
Hspg22.786e-2936.41perlecan (heparan sulfate proteoglycan 2) [Source:... [more]
Vldlr1.618e-1437.69very low density lipoprotein receptor [Source:MGI ... [more]
Vldlr1.712e-1437.69very low density lipoprotein receptor [Source:MGI ... [more]
Vldlr3.544e-1432.32very low density lipoprotein receptor [Source:MGI ... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P98160|PGBM_HUMAN6.323e-2737.38Basement membrane-specific heparan sulfate proteog... [more]
sp|Q05793|PGBM_MOUSE4.264e-2637.02Basement membrane-specific heparan sulfate proteog... [more]
sp|Q06561|UNC52_CAEEL6.304e-2631.46Basement membrane proteoglycan OS=Caenorhabditis e... [more]
sp|P35950|LDLR_CRIGR1.358e-1541.46Low-density lipoprotein receptor OS=Cricetulus gri... [more]
sp|P01131|LDLR_BOVIN7.783e-1536.92Low-density lipoprotein receptor OS=Bos taurus OX=... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z1R3130.000e+092.77Low density lipoprotein receptor-related 3 (Fragme... [more]
A0A1Z1R2751.327e-14935.16Low density lipoprotein receptor-related 1 (Fragme... [more]
T1DBM03.090e-14836.09LDL-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A504YLF07.868e-13833.49Basement membrane-specific heparan sulfate proteog... [more]
A0A4E0RPR12.792e-13634.11Basement membrane-specific heparan sulfate proteog... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg22.494e-2833.33heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg23.138e-2833.33heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg26.280e-2834.72heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg26.617e-2834.72heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
vldlr7.042e-1742.64very low density lipoprotein receptor [Source:NCBI... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp1ab1.544e-1631.28low density lipoprotein receptor-related protein 1... [more]
ENSPMAT00000001137.18.874e-1238.14pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1... [more]
sorl12.434e-1136.88sortilin-related receptor, L(DLR class) A repeats ... [more]
lrp2a2.565e-1133.55low density lipoprotein receptor-related protein 2... [more]
sorl18.317e-1131.65sortilin-related receptor, L(DLR class) A repeats ... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO452182.170e-1432.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494984.620e-1337.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405392.062e-1236.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437262.382e-1129.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439384.098e-1137.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg22.097e-2735.85heparan sulfate proteoglycan 2 [Source:NCBI gene;A... [more]
lrp82.485e-1836.43low-density lipoprotein receptor-related protein 8... [more]
lrp82.807e-1836.76low-density lipoprotein receptor-related protein 8... [more]
ldlrb9.816e-1840.31low-density lipoprotein receptor [Source:NCBI gene... [more]
ENSORLT00000036597.14.172e-1536.59low-density lipoprotein receptor-related protein 1... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012051.10.000e+099.34SMESG000012051.1[more]
SMESG000027815.12.210e-15235.04SMESG000027815.1[more]
SMESG000027815.12.466e-15235.04SMESG000027815.1[more]
SMESG000027815.15.070e-14834.54SMESG000027815.1[more]
SMESG000027815.15.488e-14834.54SMESG000027815.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020058 ID=SMED30020058|Name=Basement membrane-specific heparan sulfate proteoglycan core protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3105bp
TATATGACCATATAAACATAACTAACGTCACCTAAGGTTATTTCATAATT
TCAACTGAATGAAGTATCTATCGTTGTTTTTCGCTATTCTGTCGTTTCTA
TATGTTGTTAATGCTCAAGAAGAGGCCATATTCGTTGAACTTGGCCATAC
AGTTATTCTGCAATGCAGGCCACAATCGGTGATGTCAAACGTTCCAACAA
CATACGAATGGATAGATCCTAGAAACAATCTACGGGGATCAAACGTCAAT
TTAACTATAACAAATTTTTCCTATGAACATGTAGGCAGATATACGTGCAA
AGCTAGCCAAATCATTGACGGTAGGCTCTCAACAACTAACAAATCGCTCC
GACTACAAGTCAAAGATAAGACTGGTCTAGGTTCGAATAATTTCCAAGTG
ATTGTTCCTCAAGTTTACGAAACATTCGCAAGTGGGATAATATTTATGGC
ATGTAAAGAGGCATCCGGTGCGTCAGCAAATTATAAATATGAATGGATCA
CTCCAAGTGGAGAAAGACAAAGTTCATCGTCGTTTTTTAAAAACCAAGTC
GGTCCGGAATTCACGGGCCAATACACTTGTAGAATGACTCGAATCTCGGA
TAATCAAGTGTCTGAAGGTAAAGCCTTTGTACAAGTTAAAGCACTTCCTA
TCATGATTGAAAAGGTATCTGGAAACCCTGTGTTTGGTGAAACGGTTGAA
TTCAAATGCCAAGTTGATAAATCAAAGACGGACAATAAAGTATTCTCGTC
GTACACGTATTCTTGGTTGGATTCGAAAAATAATATCATTTCGAATGATC
AAATTTTGAGATTGAAACTCGACGACCAAACCAAGTTTGGAACCTATACT
TGTAGAATAAATACTCAGTCCATGAATCCTCCATACGTTCAGAACCAAGT
AATCGAAATCAGATTTACCGGTGATTCAAACACTGGAGGTAGATCAAGAA
ATGAATATTCAACCCGTTTTAGCAGCAATCCGAAAAATGTTCGGTTCTTC
GAACCGTTAGAACTCAACTGCGAAGTAACTCCACCATTGAGAGACGTGAC
CTATGAAATCTACTTCAATGACAGACTAATTTCCCAGTCGAGCAGGCACA
CCATTCCAAGGCTGGACAAAACAAATATGGGAGTTTATCAATGCGTTTCT
AGAGGAAGAGATTCAAACACTAACGAGTTGATAAACTACAATTCTACATA
CGTTATTCAAGCAGAATTCAAATCTGCATCTAAAATCGAATTATCAGAAC
CACCGGGACCTCAGATCTTTGTTCGAGCAGGAGATAAAAGAGAATTGCAC
TGTGAAATTGGTGTAAATACCGGCTTGCAAGGTAAAAATGCCATCTGGTA
CTTTAAAGGTCAAGAAATAAACTCGAACGATTATGCGAGATATAACATTC
AAGTGATTCCAAGACTCTATGTGAGCATCATGGTACTCAGAAATATTCAA
CAAACCAATGAAGGAAAATACGAATGCAGGGTCCGAGGCGAAACCAAAGA
GGCTTACATCATTGTAATGGCTAAAAGCAAAAATACAGAAGTTTCTCCAA
GTCAACAAACTCGAAAAGTTGGCGATGGAATACCTGTAGAATTCCATTGT
AGAGTCGAAGGATATCAAACTAGAAATCGGGATGTTATATGGTCATTTTT
GAGCAAAGAGACAGGACAAATAACTAATATAGATTCAAGATGGAGTCGAT
CTGATGATTCAGCAGCCGAAGAAACGAGTTTCATTATTCTCACCCAAGCA
GAAATGAAAGATGCAGGAGTGTATATTTGTACGGAACCTCAAACCCGAGA
TACGGCTAGAGCCACTTTAATTGTTGAAAGTGACCTGAGAATCATTGTAA
CACCTCCAATCATCAAACTCAGATCTGGGCAAACAGCAACATTCCAGTGC
TATGTTTTAGGTGCAGGAAGAAGTCCAGACTATCCAGAATTTTTCATGGC
TAATGGCGGTCGAGCAGCGGACACTCAAAGAACAACTGTTGAAAAGTTGG
AAGCAGGAAAAGTGCAACTTACCTATCGGGCAGTGACTACAAATGACAAC
GGCACCCGATTCACTTGCCGAAAAGGAAGGTCAACGGCTGAAGTTTTAGT
CTTGGTTGACCCTGTCTGCTCATCTGGATCAAGATTATGTCGAAATGGTG
AATGCATAAATTCAGCAAAATTTTGTGACGGAAAACCAGACTGTGCAGAT
GGATCCGATGAAGATCAAGAATTTTGCCGCCAATGTGATCCGCTTTCAAA
GCGTTGCGAAACCTATAATGGCGTCGCACCTATAAATCCAATTTATCAAG
CACACTGGGCCTGTGATGGTGAAGACGACTGCGGCAACGGATACGATGAA
GCTAAATGTTTTGGTAATGTTCTTGAATGTGGAGGTTTGAAGTACCAATG
TAATGATGGAACCAAATCCATTCCAAGAGCTTTTATTTGCGATAAAGACA
CTGACTGTGTCAATGGAGATGATGAAAGCCGATGCATCCAACCAATAATA
ATACAAGAATCATTAGATTCATACAAGATCAATGCTCGAAGGGGGGAAAC
TGTTACCCTCACATGTCAGGTTACTGGATTTCCATTGCCAAAAATCATTT
GGCGATTCAATTGGGGCTGTTTGACGAATGAGCGCCGAATGGTCGTCATA
GAATCATATAGAAATTGTGGTGCCACAGTTAGCACCTTGACTATCTCAGA
ATTCCAACCGGGAGATGATGGCATTTACAATTGCGAAGCTCTGTCAGGAG
GAAAGAGAGCCTGGTCCAAAGATTATCAACTGTTGATGAATTTTCGAAAT
TAAGGCCGTAGATTTTGTTTATTAGAAAACTCACATCTAACATCCTCTCT
ATCTCTCTATAAATATATATTAATACCAACAAAATAACTATTTTTTCTAT
TATTAATTTATCAAATACTTACTTAAAGTTGTGATGAAAGCGCTTTTGTA
ACCTGTGTTATTGACAGTACAAAGGTAAGGCTAAAGATTAGAATTGTAAT
GGATAAATTGGCTTGATTTTGTGTTTTGCTTTTTATCTGTGGACAATTTG
GTGTTGAGGGGCATCATGGTAAATTTATCATTTTTATACTGAAATTCAAA
TTAAT
back to top

protein sequence of SMED30020058-orf-1

>SMED30020058-orf-1 ID=SMED30020058-orf-1|Name=SMED30020058-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=915bp
MKYLSLFFAILSFLYVVNAQEEAIFVELGHTVILQCRPQSVMSNVPTTYE
WIDPRNNLRGSNVNLTITNFSYEHVGRYTCKASQIIDGRLSTTNKSLRLQ
VKDKTGLGSNNFQVIVPQVYETFASGIIFMACKEASGASANYKYEWITPS
GERQSSSSFFKNQVGPEFTGQYTCRMTRISDNQVSEGKAFVQVKALPIMI
EKVSGNPVFGETVEFKCQVDKSKTDNKVFSSYTYSWLDSKNNIISNDQIL
RLKLDDQTKFGTYTCRINTQSMNPPYVQNQVIEIRFTGDSNTGGRSRNEY
STRFSSNPKNVRFFEPLELNCEVTPPLRDVTYEIYFNDRLISQSSRHTIP
RLDKTNMGVYQCVSRGRDSNTNELINYNSTYVIQAEFKSASKIELSEPPG
PQIFVRAGDKRELHCEIGVNTGLQGKNAIWYFKGQEINSNDYARYNIQVI
PRLYVSIMVLRNIQQTNEGKYECRVRGETKEAYIIVMAKSKNTEVSPSQQ
TRKVGDGIPVEFHCRVEGYQTRNRDVIWSFLSKETGQITNIDSRWSRSDD
SAAEETSFIILTQAEMKDAGVYICTEPQTRDTARATLIVESDLRIIVTPP
IIKLRSGQTATFQCYVLGAGRSPDYPEFFMANGGRAADTQRTTVEKLEAG
KVQLTYRAVTTNDNGTRFTCRKGRSTAEVLVLVDPVCSSGSRLCRNGECI
NSAKFCDGKPDCADGSDEDQEFCRQCDPLSKRCETYNGVAPINPIYQAHW
ACDGEDDCGNGYDEAKCFGNVLECGGLKYQCNDGTKSIPRAFICDKDTDC
VNGDDESRCIQPIIIQESLDSYKINARRGETVTLTCQVTGFPLPKIIWRF
NWGCLTNERRMVVIESYRNCGATVSTLTISEFQPGDDGIYNCEALSGGKR
AWSKDYQLLMNFRN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR036179Ig-like_dom_sf
IPR002172LDrepeatLR_classA_rpt
IPR003599Ig_sub
IPR003598Ig_sub2
IPR013098Ig_I-set
IPR013783Ig-like_fold
IPR023415LDLR_class-A_CS
IPR007110Ig-like_dom
IPR019774Aromatic-AA_hydroxylase_C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0005509calcium ion binding
GO:0008022protein C-terminus binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0001523retinoid metabolic process
GO:0001525angiogenesis
GO:0006024glycosaminoglycan biosynthetic process
GO:0006027glycosaminoglycan catabolic process
GO:0022617extracellular matrix disassembly
GO:0030198extracellular matrix organization
GO:0030203glycosaminoglycan metabolic process
GO:0044267cellular protein metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
GO:0005604basement membrane
GO:0005615extracellular space
GO:0005796Golgi lumen
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0031012extracellular matrix
GO:0043202lysosomal lumen
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPRINTSPR00261LDLRECEPTORcoord: 697..718
score: 52.33
coord: 743..764
score: 42.68
coord: 785..806
score: 42.13
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 725..769
e-value: 0.031
score: 17.7
coord: 773..811
e-value: 2.3E-4
score: 30.5
coord: 686..724
e-value: 2.4E-8
score: 43.7
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPFAMPF00057Ldl_recept_acoord: 687..721
e-value: 6.8E-8
score: 32.6
coord: 773..809
e-value: 8.4E-6
score: 25.9
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 725..768
score: 8.7
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 773..810
score: 10.0
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 686..724
score: 12.1
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 687..719
e-value: 1.54302E-10
score: 54.5202
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 774..809
e-value: 2.13171E-5
score: 40.2678
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 748..767
e-value: 2.48953E-4
score: 37.1862
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 406..480
e-value: 1.0
score: 7.1
coord: 27..87
e-value: 0.1
score: 16.5
coord: 827..899
e-value: 3.7E-10
score: 49.7
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 117..194
e-value: 6.2
score: 13.3
coord: 821..911
e-value: 2.2E-8
score: 43.8
coord: 21..102
e-value: 8.2E-7
score: 38.6
coord: 200..386
e-value: 4.2
score: 14.7
coord: 599..682
e-value: 19.0
score: 9.1
coord: 497..590
e-value: 2.2
score: 17.1
coord: 400..487
e-value: 0.77
score: 18.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 15..102
e-value: 5.2E-10
score: 41.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 389..493
e-value: 3.0E-9
score: 38.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 195..274
e-value: 6.5E-6
score: 28.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 303..375
e-value: 1.2E-5
score: 27.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 813..908
e-value: 6.5E-16
score: 60.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 494..591
e-value: 1.3E-8
score: 36.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 592..683
e-value: 1.1E-5
score: 27.3
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 730..769
e-value: 2.4E-5
score: 25.9
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 770..810
e-value: 6.6E-7
score: 31.1
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 684..725
e-value: 2.6E-10
score: 41.8
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 681..721
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 773..812
NoneNo IPR availablePFAMPF13927Ig_3coord: 821..894
e-value: 5.6E-12
score: 46.1
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 687..895
NoneNo IPR availablePANTHERPTHR11640:SF79HEPARAN SULFATE PROTEOGLYCAN 2coord: 687..895
NoneNo IPR availableCDDcd00096Igcoord: 32..83
e-value: 0.00426561
score: 34.9105
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.898
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 402..482
e-value: 1.4E-5
score: 25.1
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 699..723
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 812..894
score: 11.914
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 197..283
score: 7.903
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 398..485
score: 7.831
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 497..586
score: 8.266
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 29..98
score: 8.829
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 205..365
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 496..590
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 823..908
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 402..485
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 20..83