Neur_chan_LBD domain-containing protein

Overview
NameNeur_chan_LBD domain-containing protein
Smed IDSMED30020055
Length (bp)1542
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neur_chan_LBD domain-containing protein (SMED30020055) t-SNE clustered cells

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30020055) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neur_chan_LBD domain-containing protein (SMED30020055) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30020055) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020055

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020055SMESG000041829.1 SmedASXL_013220SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30020055SMESG000064433.1 SMESG000041829.1 SmedASXL_013222SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30020055SMESG000064433.1 SmedASXL_013223SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30020055SMESG000041829.1 dd_Smed_v4_19336_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020055SMESG000041829.1 dd_Smed_v4_19336_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30020055SMESG000041829.1 dd_Smed_v6_19336_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30020055SMESG000041829.1 DN298606ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30020055SMESG000064433.1 DN290586ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30020055SMESG000064433.1 DN290586ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30020055SMESG000041829.1 OX_Smed_1.0.01208ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30020055SMESG000064433.1 Contig53760newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020055SMESG000064433.1 Contig53760uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
nervous systemSMED30020055SMESG000064433.1 DN303054ncbi_smed_estsPMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30020055SMESG000064433.1 DN303054ncbi_smed_estsPMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRG3 (gamma-aminobutyric acid type A receptor gamma3 subunit [Source:HGNC Symbol;Acc:HGNC:4088])

HSP 1 Score: 60.4622 bits (145), Expect = 3.990e-9
Identity = 62/269 (23.05%), Postives = 118/269 (43.87%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSS-----FWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITVST-EYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFF 1143
            I  V ++N  Y  +IF    W +  L   S +K ++L+S      W P    + IF  +K++ +H ++   +      +  I    R++      L+L +FP D     +  S+  YP  E+          + N+++  + + W LY+   +  +           +  +MT     SRR  YF I  ++   +  +L++ SF I    T  R AL +TT+LT  T      ++LP++ Y+T +D  +    LF+      +A+ +++
Sbjct:   82 IGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNSNMVGLIWIP----DTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDEHSCPLIFSSYGYPKEEMIYRW------RKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYY 340          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:HGNC Symbol;Acc:HGNC:4083])

HSP 1 Score: 59.3066 bits (142), Expect = 8.660e-9
Identity = 64/281 (22.78%), Postives = 132/281 (46.98%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++      D   +  ++ +E  ++++ EH  + ++ ++      P+    ++ + R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   67 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNR--VAD----QLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD-KAVTGVERIELPQFSIVEH-RLVSRNVVFATGAYPR----LSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIF 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:HGNC Symbol;Acc:HGNC:4083])

HSP 1 Score: 58.9214 bits (141), Expect = 1.221e-8
Identity = 65/281 (23.13%), Postives = 132/281 (46.98%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++      D   +  ++ +E  ++++ EH  V ++ ++      P+    ++ + R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   34 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNR--VAD----QLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD-KAVTGVERIELPQFSIVEHRLV-SRNVVFATGAYPR----LSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIF 298          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:HGNC Symbol;Acc:HGNC:4083])

HSP 1 Score: 58.9214 bits (141), Expect = 1.287e-8
Identity = 65/281 (23.13%), Postives = 132/281 (46.98%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++      D   +  ++ +E  ++++ EH  V ++ ++      P+    ++ + R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:  123 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNR--VAD----QLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD-KAVTGVERIELPQFSIVEHRLV-SRNVVFATGAYPR----LSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIF 387          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:HGNC Symbol;Acc:HGNC:4083])

HSP 1 Score: 58.5362 bits (140), Expect = 1.571e-8
Identity = 65/281 (23.13%), Postives = 132/281 (46.98%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++      D   +  ++ +E  ++++ EH  V ++ ++      P+    ++ + R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   67 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNR--VAD----QLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD-KAVTGVERIELPQFSIVEHRLV-SRNVVFATGAYPR----LSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIF 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: CG8916 (gene:FBgn0030707 transcript:FBtr0301233)

HSP 1 Score: 55.4546 bits (132), Expect = 7.475e-8
Identity = 61/258 (23.64%), Postives = 112/258 (43.41%), Query Frame = 1
Query:  397 YSAEIFLQSKWREPLLDNRSDIKDISLS-----SFWNPKISIENIFMETKSSISHEVSYSGK----AREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFF 1143
            YS + + +  WR+  L  +  IK +SLS       W P    +  F   K S  H ++   K     +   I    R++      +ELQ+FP D Q   + + +   IN+  + E  +    ++ + GM   +++L   +     T+  + +       ++       R   YFLI  ++   +  +L++ SF I    T  R++LC+T++LT  T  +    +LPK+ Y T LD  +L + L+ +      A   +F
Sbjct:   52 YSMDCYFRQYWRDKRLSFKGPIKSLSLSIKMLDKIWRP----DTYFYNGKHSQIHMITVPNKLLRLDQNGGILYSMRLTIKATCPMELQNFPMDRQSCPLVIGSYGYINQQLIYEWKNQDDAVSFVPGMTLNQFDLISMMHRNFTTVRREGDFS-----VLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSFLYCIATLLEFAGVHYF 300          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: CG8916 (gene:FBgn0030707 transcript:FBtr0301232)

HSP 1 Score: 55.0694 bits (131), Expect = 1.035e-7
Identity = 61/258 (23.64%), Postives = 112/258 (43.41%), Query Frame = 1
Query:  397 YSAEIFLQSKWREPLLDNRSDIKDISLS-----SFWNPKISIENIFMETKSSISHEVSYSGK----AREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFF 1143
            YS + + +  WR+  L  +  IK +SLS       W P    +  F   K S  H ++   K     +   I    R++      +ELQ+FP D Q   + + +   IN+  + E  +    ++ + GM   +++L   +     T+  + +       ++       R   YFLI  ++   +  +L++ SF I    T  R++LC+T++LT  T  +    +LPK+ Y T LD  +L + L+ +      A   +F
Sbjct:  154 YSMDCYFRQYWRDKRLSFKGPIKSLSLSIKMLDKIWRP----DTYFYNGKHSQIHMITVPNKLLRLDQNGGILYSMRLTIKATCPMELQNFPMDRQSCPLVIGSYGYINQQLIYEWKNQDDAVSFVPGMTLNQFDLISMMHRNFTTVRREGDFS-----VLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSFLYCIATLLEFAGVHYF 402          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:ZFIN;Acc:ZDB-GENE-141215-66])

HSP 1 Score: 60.4622 bits (145), Expect = 2.631e-9
Identity = 63/242 (26.03%), Postives = 110/242 (45.45%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISI-ENIFMETKSSISHEVSYSGKAREAY----ITEKRRVSGGFREVLELQHFPFDCQDLSITVST-EYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLD 1074
            I  VD +N  Y+ +IF    W +  L   S +K + L+S    KI I +  F  ++ S +H ++   +    +    +    R++      L+L +FP D     +  S+  YP NE++         +  +++  + + W LY+   V  +   +  N    E  +MT     SRR  YF I  ++  SM  +L++ SF I       R +L +TT+LT  T      ++LPK+ Y+T +D
Sbjct:   95 IGPVDPINMEYTIDIFFAQTWYDSRLKFNSSMKLLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRLWSNGRVMYTLRLTINAECYLKLHNFPMDEHSCPLEFSSYGYPKNEIQYRW------QRRSVEVADQRYWRLYQFAFVGLRNSSDVANTQSGEYVVMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYVTAMD 330          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:ZFIN;Acc:ZDB-GENE-141215-66])

HSP 1 Score: 59.6918 bits (143), Expect = 3.906e-9
Identity = 63/242 (26.03%), Postives = 110/242 (45.45%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISI-ENIFMETKSSISHEVSYSGKAREAY----ITEKRRVSGGFREVLELQHFPFDCQDLSITVST-EYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLD 1074
            I  VD +N  Y+ +IF    W +  L   S +K + L+S    KI I +  F  ++ S +H ++   +    +    +    R++      L+L +FP D     +  S+  YP NE++         +  +++  + + W LY+   V  +   +  N    E  +MT     SRR  YF I  ++  SM  +L++ SF I       R +L +TT+LT  T      ++LPK+ Y+T +D
Sbjct:   95 IGPVDPINMEYTIDIFFAQTWYDSRLKFNSSMKLLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRLWSNGRVMYTLRLTINAECYLKLHNFPMDEHSCPLEFSSYGYPKNEIQYRW------QRRSVEVADQRYWRLYQFAFVGLRNSSDVANTQSGEYVVMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYVTAMD 330          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrb4 (gamma-aminobutyric acid type A receptor beta4 subunit [Source:ZFIN;Acc:ZDB-GENE-070424-211])

HSP 1 Score: 59.3066 bits (142), Expect = 6.008e-9
Identity = 62/275 (22.55%), Postives = 125/275 (45.45%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWREPLLDNRSDIKDISLSS-----FWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D+++E    Y+  ++ Q  WR+  L       +++L +      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  +++       D    N + G++  E   +  VE+   +       G   R  ++F  R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   68 INIASIDSISEVNMDYTITMYFQQSWRDKRLAYAEMALNLTLDNRVADQLWLP----DTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGD----NAVTGVDKLELPQFSIVELRLVSREVRFTTGSYPRLSLSF--RIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVF 332          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrb4 (gamma-aminobutyric acid type A receptor beta4 subunit [Source:ZFIN;Acc:ZDB-GENE-070424-211])

HSP 1 Score: 58.9214 bits (141), Expect = 7.855e-9
Identity = 62/275 (22.55%), Postives = 125/275 (45.45%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWREPLLDNRSDIKDISLSS-----FWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D+++E    Y+  ++ Q  WR+  L       +++L +      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  +++       D    N + G++  E   +  VE+   +       G   R  ++F  R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   68 INIASIDSISEVNMDYTITMYFQQSWRDKRLAYAEMALNLTLDNRVADQLWLP----DTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGD----NAVTGVDKLELPQFSIVELRLVSREVRFTTGSYPRLSLSF--RIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVF 332          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrb1 (gamma-aminobutyric acid type A receptor beta1 subunit [Source:ZFIN;Acc:ZDB-GENE-090313-230])

HSP 1 Score: 57.7658 bits (138), Expect = 2.035e-8
Identity = 65/281 (23.13%), Postives = 131/281 (46.62%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++        S +  +D +E  ++++ ++  +  K +      G   R  ++F  +  R   YF++  ++ S++  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   75 IDISSIDMVSEVNMDYTITMYFQQSWRDKRLSYTGIPLNLTLDNR--VAD----QLWVP----DTYFINDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW--QGGSSVTGVDNIELPQFSIIDYKTLSKKVVFA---TGSYPRLSLSFKLK--RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIF 338          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000020814.1 (gamma-aminobutyric acid type A receptor theta subunit [Source:NCBI gene;Acc:100496398])

HSP 1 Score: 62.7734 bits (151), Expect = 6.027e-10
Identity = 63/276 (22.83%), Postives = 129/276 (46.74%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I ++  VN  Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y I+++K      + + +  +  +E  ++ + E   + +K ++      P+    ++ + R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   60 IDQISEVNMDYTITMYFQQSWRDKRLAYTALPLNLTLDNR--VAD----QLWLP----DTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDQQNCTLEIESYGYTIDDIKFFWQGGEEAAVTGVSALELPQFTIIE-TRLVSKNVVFTTGSYPR----LSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVF 320          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000020832.1 (gamma-aminobutyric acid type A receptor theta subunit [Source:NCBI gene;Acc:100496398])

HSP 1 Score: 62.7734 bits (151), Expect = 6.183e-10
Identity = 63/276 (22.83%), Postives = 129/276 (46.74%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I ++  VN  Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y I+++K      + + +  +  +E  ++ + E   + +K ++      P+    ++ + R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   77 IDQISEVNMDYTITMYFQQSWRDKRLAYTALPLNLTLDNR--VAD----QLWLP----DTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDQQNCTLEIESYGYTIDDIKFFWQGGEEAAVTGVSALELPQFTIIE-TRLVSKNVVFTTGSYPR----LSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVF 337          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000004017.1 (gamma-aminobutyric acid (GABA) A receptor, beta 1 [Source:NCBI gene;Acc:100489344])

HSP 1 Score: 60.077 bits (144), Expect = 4.800e-9
Identity = 66/285 (23.16%), Postives = 133/285 (46.67%), Query Frame = 1
Query:  340 VYLRCVFIKIFKVDTVNEFYSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            V +R     I  V  VN  Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  +++K      D   +  ++ +E  ++++ ++  V ++ +I      P+    ++ + R  R   YF++  ++ S++  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   63 VGMRIDVASIDMVSEVNMDYTLTMYFQQSWRDKRLSYSGIPLNLTLDNR--VAD----QLWVP----DTYFLNDKRSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIKFYWNGGD-KAITGVEKIELPQFSIIDYKMV-SRNVIFSTGAYPR----LSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIF 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: ccdc134 (coiled-coil domain containing 134 [Source:Xenbase;Acc:XB-GENE-951215])

HSP 1 Score: 58.5362 bits (140), Expect = 1.323e-8
Identity = 62/269 (23.05%), Postives = 117/269 (43.49%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSS-----FWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITVST-EYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFF 1143
            I  V ++N  Y  +IF    W +  L   S +K ++L+S      W P    + IF  +K++ +H ++   +      +  I    R++      L+L +FP D     +  S+  YP  E+          + N+++    + W LY+   +  +           +  +MT     SRR  YF I  ++   +  +L++ SF I    T  R AL +TT+LT  T      ++LP++ Y+T +D  +    LF+      +A+ +++
Sbjct:   85 IGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNSNMVGLIWIP----DTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDEHSCPLIFSSYGYPREEMVYRW------RKNSVETANQKSWRLYQFDFMGLRNTTEIVKTSAGDYIVMTVYFDLSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVFAALIEYAALNYY 343          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: dusp5 (dual specificity phosphatase 5 [Source:Xenbase;Acc:XB-GENE-957572])

HSP 1 Score: 58.151 bits (139), Expect = 1.876e-8
Identity = 63/281 (22.42%), Postives = 134/281 (47.69%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++      D + +  ++ +E  ++++ +H ++ +K ++      P+    ++ + +  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   67 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYTGIPLNLTLDNR--VAD----QLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWLGGD-NAVTGVERIELPQFSIMDH-KLVSKNVVFATGSYPR----LSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIF 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrg3 (gamma-aminobutyric acid (GABA) A receptor, subunit gamma 3 [Source:MGI Symbol;Acc:MGI:95624])

HSP 1 Score: 61.6178 bits (148), Expect = 1.034e-9
Identity = 62/269 (23.05%), Postives = 118/269 (43.87%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSS-----FWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITVST-EYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFF 1143
            I  V ++N  Y  +IF    W +  L   S +K ++L+S      W P    + IF  +K++ +H ++   +      +  I    R++      L+L +FP D     +T S+  YP  E+          + N+++  + + W LY+   +  +           +  +MT     SRR  YF I  ++   +  +L++ SF I    T  R  L +TT+LT  T      ++LP++ Y+T +D  +    LF+      +A+ +++
Sbjct:   82 IGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNSNMVGLIWIP----DTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDAHACPLTFSSYGYPKEEMIYRW------RKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYY 340          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 59.3066 bits (142), Expect = 7.273e-9
Identity = 64/281 (22.78%), Postives = 132/281 (46.98%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++      D   +  ++ +E  ++++ EH  + ++ ++      P+    ++ + R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   67 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNR--VAD----QLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD-KAVTGVERIELPQFSIVEH-RLVSRNVVFATGAYPR----LSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIF 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 58.9214 bits (141), Expect = 9.215e-9
Identity = 65/281 (23.13%), Postives = 132/281 (46.98%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++      D   +  ++ +E  ++++ EH  V ++ ++      P+    ++ + R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   67 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNR--VAD----QLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD-KAVTGVERIELPQFSIVEHRLV-SRNVVFATGAYPR----LSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIF 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 58.5362 bits (140), Expect = 1.036e-8
Identity = 65/281 (23.13%), Postives = 132/281 (46.98%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++      D   +  ++ +E  ++++ EH  V ++ ++      P+    ++ + R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   89 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNR--VAD----QLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD-KAVTGVERIELPQFSIVEHRLV-SRNVVFATGAYPR----LSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIF 353          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrb2 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 2 [Source:MGI Symbol;Acc:MGI:95620])

HSP 1 Score: 57.3806 bits (137), Expect = 2.782e-8
Identity = 66/281 (23.49%), Postives = 127/281 (45.20%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++      D    N + G+   E   +  V+ +  T     + G   R  ++F  +  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ +    +A  ++ F
Sbjct:   66 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNR--VAD----QLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDD----NAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLK--RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIF 330          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P28473|GBRG3_RAT (Gamma-aminobutyric acid receptor subunit gamma-3 OS=Rattus norvegicus OX=10116 GN=Gabrg3 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 6.920e-9
Identity = 62/269 (23.05%), Postives = 118/269 (43.87%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSS-----FWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITVST-EYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFF 1143
            I  V ++N  Y  +IF    W +  L   S +K ++L+S      W P    + IF  +K++ +H ++   +      +  I    R++      L+L +FP D     +T S+  YP  E+          + N+++  + + W LY+   +  +           +  +MT     SRR  YF I  ++   +  +L++ SF I    T  R  L +TT+LT  T      ++LP++ Y+T +D  +    LF+      +A+ +++
Sbjct:   82 IGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNSNMVGLIWIP----DTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDAHACPLTFSSYGYPKEEMIYRW------RKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYY 340          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P27681|GBRG3_MOUSE (Gamma-aminobutyric acid receptor subunit gamma-3 OS=Mus musculus OX=10090 GN=Gabrg3 PE=2 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 7.231e-9
Identity = 62/269 (23.05%), Postives = 118/269 (43.87%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSS-----FWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITVST-EYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFF 1143
            I  V ++N  Y  +IF    W +  L   S +K ++L+S      W P    + IF  +K++ +H ++   +      +  I    R++      L+L +FP D     +T S+  YP  E+          + N+++  + + W LY+   +  +           +  +MT     SRR  YF I  ++   +  +L++ SF I    T  R  L +TT+LT  T      ++LP++ Y+T +D  +    LF+      +A+ +++
Sbjct:   82 IGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNSNMVGLIWIP----DTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDAHACPLTFSSYGYPKEEMIYRW------RKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYY 340          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99928|GBRG3_HUMAN (Gamma-aminobutyric acid receptor subunit gamma-3 OS=Homo sapiens OX=9606 GN=GABRG3 PE=2 SV=2)

HSP 1 Score: 60.4622 bits (145), Expect = 1.916e-8
Identity = 62/269 (23.05%), Postives = 118/269 (43.87%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSS-----FWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITVST-EYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFF 1143
            I  V ++N  Y  +IF    W +  L   S +K ++L+S      W P    + IF  +K++ +H ++   +      +  I    R++      L+L +FP D     +  S+  YP  E+          + N+++  + + W LY+   +  +           +  +MT     SRR  YF I  ++   +  +L++ SF I    T  R AL +TT+LT  T      ++LP++ Y+T +D  +    LF+      +A+ +++
Sbjct:   82 IGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNSNMVGLIWIP----DTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDEHSCPLIFSSYGYPKEEMIYRW------RKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYY 340          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P19019|GBRB3_CHICK (Gamma-aminobutyric acid receptor subunit beta-3 OS=Gallus gallus OX=9031 GN=GABRB3 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 2.538e-8
Identity = 68/283 (24.03%), Postives = 129/283 (45.58%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVE--AKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++      D    N + G+E  E   +  VE    +K ++      P+    ++ + R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   67 IDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYAGIPLNLTLDNR--VAD----QLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGD----NAVTGVERIELPQFSIVEYRLVSKNVVFATGAYPR----LSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIF 331          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P24045|GBRB4_CHICK (Gamma-aminobutyric acid receptor subunit beta-4 OS=Gallus gallus OX=9031 GN=GABRB4 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 3.882e-8
Identity = 64/276 (23.19%), Postives = 126/276 (45.65%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I ++  VN  Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y ++++      +D    + + GME  E  L +   +E + +  +          ++ + R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   71 IDQISEVNMDYTITMYFQQSWRDKRLAYNDLPLNLTLDNR--VAD----QLWLP----DTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDQQNCTLEIESYGYTVDDIVFFWQGND----SAVTGMEVLE--LPQFTIIEQRLVSREVVFTTGSYLRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYIF 330          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A3R7CFX9 (Neuronal acetylcholine receptor subunit alpha-7 OS=Clonorchis sinensis OX=79923 GN=CHRNA7 PE=4 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 3.965e-70
Identity = 148/369 (40.11%), Postives = 215/369 (58.27%), Query Frame = 1
Query:  340 VYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDN-------RSDIKDISL---------------------SSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQI--MTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHA-STSFFFNDPTVSSATATANVKQVETYIISCLLGVYGLVILIFGLVIYFDAGSRRREMSEKDREFKRLLEKIENEK 1353
            V L  +F+KI +VDTVNE Y A+IFLQ++WREPLLD        R++ +   +                       FWNP++ ++N   E    +SHEV +     EAY+ EKRR+ G F E LEL+HFPFDCQDLS+TV+ +  + EV+++  P ++S+++     +SQEW ++ HV++ +  +    + G  +R+   + FT R++RR  YF++N  LIS +  LL+F+ FS+P      RL L +  LLT+VTFK A SQNLPKI YLTYLDK +L N   +++L  WH  + S F   P          +K  E Y++  LL  Y L  ++FGL +Y DAGSRRR M  KD +F +  ++IE EK
Sbjct:   39 VELMLIFVKIGQVDTVNERYQADIFLQARWREPLLDATWNTSRPRNNFRTFKMVENPVMELAPKRHLHTLKLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPDFEAYLVEKRRIKGVFHETLELKHFPFDCQDLSVTVTCDRTVEEVELVPSPTEVSQVDRRCAADSQEWKIFHHVDIASMEIQTAYSPGTCKRRHPGLVFTSRSARRAGYFMVNMALISCVLSLLSFSVFSVPVDG--NRLQLSLLLLLTTVTFKFAASQNLPKISYLTYLDKMVLANFFMLVILTVWHTIARSVFAKYP---------GLKDKEQYVVYTLLSAYCLGAVVFGLTVYLDAGSRRRLMKSKDMDFTQHKQRIELEK 396          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A4E0RSR9 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_005714 PE=4 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 1.398e-69
Identity = 147/365 (40.27%), Postives = 213/365 (58.36%), Query Frame = 1
Query:  355 VFIKIFKVDTVNEFYSAEIFLQSKWREPLLD-------------NRSDIKD---------------ISLSSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQ--IMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDPTVSSATATANVKQV--ETYIISCLLGVYGLVILIFGLVIYFDAGSRRREMSEKDREFKRLLEKIENEK 1353
            +F+KI +VDTVNE Y A+IFLQ++WREPLLD              +S +++               +    FWNP++ ++N   E    +SHEV +     EAY+ EKRR+ G F E LEL+HFPFD QDLS+TV+ +  ++EV ++  P ++S+++     +SQEW ++ HV+VE   +    + G  +R+   + FT R++RR  YF++N  LIS +  LL+F  FS+P      RL   +  LLT+VTFK A SQNLPKI YLTYLDK +L N   +++L  WH          T++ + + +  K +  E Y++  LL  Y L  +IFGL +Y DAGSRRR M  KD EF +L  +IE EK
Sbjct:    3 IFVKIGQVDTVNERYQADIFLQARWREPLLDATWKSERAQKNWRGKSGVENPIQDLVPKRHLHTLGLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPTFEAYLVEKRRIKGVFHETLELKHFPFDVQDLSVTVTCDRSVDEVLLVPSPTEVSQVDRRGAADSQEWKIFHHVDVERMEIQTAYSPGTSKRRHPGLVFTSRSARRSGYFMVNMVLISCVLCLLSFCIFSVPVDG--NRLQQALLLLLTTVTFKFAASQNLPKISYLTYLDKVVLANFFMLVILTVWH----------TIARSLSASYPKLLDNEKYVVYTLLSSYCLGAVIFGLTVYLDAGSRRRLMQRKDVEFGQLKTRIEREK 355          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A075A8W6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_08254 PE=3 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 6.020e-68
Identity = 150/374 (40.11%), Postives = 218/374 (58.29%), Query Frame = 1
Query:  316 VNKPVARLVYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDN-------RSDIKDISL---------------------SSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQI--MTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHA-STSFFFNDPTVSSATATANVKQVETYIISCLLGVYGLVILIFGLVIYFDAGSRRREMSEKDREFKRLLEKIE 1344
            V  P AR V L  +F+KI +VDTVNE Y A+IFLQ++WREPLLD        R++ +  ++                       FWNP++ ++N   E    +SHEV +     EAY+ EKRR+ G F E LEL+HFPFDCQDLS+TV+ +  + EV+++  P ++S+++     +SQEW ++ HV++ +  +    + G  +R+   + FT R++RR  YF++N  LIS +  LL+F+ FS+P      RL L +  LLT+VTFK A SQNLPKI YLTYLDK +L N   +++L  WH  + S F   P          +K  E Y++  LL  Y L  ++FGL +Y DAGSRRR M  KD +F +  ++IE
Sbjct:  232 VRHPPAR-VELMLIFVKIGQVDTVNERYQADIFLQARWREPLLDATWNTSRPRNNFRTFNMVENPVMELAPKRHLHTLKLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPDFEAYLVEKRRIKGIFHETLELKHFPFDCQDLSVTVTCDRTVEEVELVPSPTEVSQVDRRCAADSQEWKIFHHVDIASMEIQTAYSPGTCKRRHPGLVFTSRSARRAGYFMVNMALISCVLSLLSFSVFSVPVD--GNRLQLSLLLLLTTVTFKFAASQNLPKISYLTYLDKMVLANFFMLVILTVWHTIARSVFAKYP---------GLKDKEQYVVYTLLSAYCLGAVVFGLTVYLDAGSRRRLMKSKDMDFTQHKQRIE 593          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: R7VF52 (Neur_chan_LBD domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_228357 PE=3 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 3.199e-67
Identity = 134/336 (39.88%), Postives = 202/336 (60.12%), Query Frame = 1
Query:  337 LVYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDNRS--DIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDPTVSSATATANVKQVETYIISCLLGVYGLVILIFGLVIYFDAGSRRREMSEKDREFKRLLEK 1338
             V LR VF+KI ++DT+ E YSA+ F+Q+KWREP LD ++  ++K I L  FWNP + IEN+  ETK +     S + +A EA++ E+RRV G F E LEL  FP D QDL++T+++E P  E+ ++   +++S +N    ++ QEW L+EH+EV  K M  + +   +    ++ TCRA+RR  YF  N FL+      L+F +F++ P     RL L  T LLTS+TFK  ++Q+LPKI YLTY+DK +L +++ + ++C WHA  + F +       T   +V     +I   ++ +   V+ IF L  YFDA  RRR M  KD+E+   L K
Sbjct:   33 FVELRVVFLKIGEIDTLKEQYSADTFIQAKWREPALDGKTTEELKRIDLDRFWNPLLFIENVLSETKEATWLTASTNSRA-EAFVLERRRVRGVFMENLELNDFPLDVQDLTVTITSERPDTEIDIIPDENEMSGINVQTFVDQQEWRLHEHIEVSKKVMTQEYSSSNRCHPALSVTCRAARRPGYFYWNVFLVMFFISALSFATFAVSPELPQNRLQLSFTLLLTSITFKFVINQSLPKISYLTYMDKYVLLSLVILCMVCVWHAVVTVFVHHGINFLMTLERDV-----FIAFSVIYIGFHVVFIFWL--YFDACKRRRLMKHKDKEYLDFLAK 360          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A5K4FCR6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 3.068e-66
Identity = 152/385 (39.48%), Postives = 224/385 (58.18%), Query Frame = 1
Query:  301 NNSKSVNKPVARLVYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLD----------------------------NRSDIKDISLSS--FWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQI--MTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDPTVSSATATANVK--QVETYIISCLLGVYGLVILIFGLVIYFDAGSRRREMSEKDREFKRLLEKIENEK 1353
            N  K +N   AR V L  +F+K+ +VDTVNE Y A+IFLQ++WREPLLD                            ++  +  + L    FWNP++ I+N   E    ISHEV +     EAY+ EKRR+ G F E LEL+HFPFDCQDLS+T++ +   +EV+++  P ++S+++     +SQEW ++ HV++++  +    +    +R    + FT R++RR  YFL+N  LIS +  LL+F++FS+P +    RL L +  LLT+VTFK A SQNLPKI YLTYLDK +L N   +++L  WHA          ++ A + +  K  + E Y++  LL  Y +  ++FGL +Y DAGSRRR M  KD EF +  ++IE EK
Sbjct:  264 NIGKPMNMSKAR-VELVLIFVKVGQVDTVNERYQADIFLQARWREPLLDAMWNKSSLKSKSSWQTNPSIENPFTDLTSKRQLNTLKLQDDEFWNPRLLIDNAEGEPIEIISHEVEFIEPDFEAYLVEKRRIKGIFHETLELRHFPFDCQDLSVTITCDRTTDEVELVASPTEVSQVDVRCAADSQEWKIFHHVDIKSIEIQTGYSPSTSKRHHPGLVFTSRSARRSGYFLVNMILISCVLCLLSFSAFSVPANE--NRLQLSLLLLLTTVTFKFAASQNLPKISYLTYLDKVVLVNFFMLVILTVWHA----------IARAVSASKPKFLEYEHYVMYSLLSCYCIGSVLFGLTVYLDAGSRRRLMKRKDIEFNQYKQQIEAEK 635          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: GABRG3 (gamma-aminobutyric acid type A receptor gamma3 subunit [Source:NCBI gene;Acc:103040847])

HSP 1 Score: 59.6918 bits (143), Expect = 4.653e-9
Identity = 62/269 (23.05%), Postives = 118/269 (43.87%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSS-----FWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITVST-EYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFF 1143
            I  V ++N  Y  +I     W +  L   S +K ++L+S      W P    + IF  +K++ SH ++   +      +  I    R++      L+L +FP D     +  S+  YP +E+          + N+++  + + W LY+   +  +   +       +  +MT     SRR  YF I  ++   +  +L++ SF I    T  R AL +TT+LT  T       +LP++ Y+T +D  +    LF+      +A+ +++
Sbjct:  147 IGPVSSINMEYQIDIIFAQTWTDSRLRYNSTMKILTLNSNMVGLIWVP----DTIFRNSKNADSHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDEHSCPLIFSSYGYPRDEMIYKW------RKNSVEAADQKSWRLYQFDFMGLRNTTDVIKTTAGDYVVMTVYFDLSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTVARTSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYY 405          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrb1 (gamma-aminobutyric acid type A receptor beta1 subunit [Source:ZFIN;Acc:ZDB-GENE-090313-230])

HSP 1 Score: 57.7658 bits (138), Expect = 1.482e-8
Identity = 65/281 (23.13%), Postives = 132/281 (46.98%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++      + S +  +D +E  ++++ ++  +  K +      G   R  ++F  +  R   YF++  ++ S++  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   53 IDISSIDMVSEVNMDYTITMYFQQSWRDKRLSYTGIPLNLTLDNR--VAD----QLWVP----DTYFINDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW--QEGSSVTGVDNIELPQFSIIDYKTLSKKVVFA---TGSYPRLSLSFKLK--RNIGYFILQTYMPSNLITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIF 316          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4-like [Source:NCBI gene;Acc:103032374])

HSP 1 Score: 57.3806 bits (137), Expect = 2.173e-8
Identity = 66/281 (23.49%), Postives = 126/281 (44.84%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D+++E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  +++            N + G++  E   +  VE+   +       G   R  ++F  R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   67 INIASIDSISEVNMDYTITMYFQQSWRDKRLAYVEMPLNLTLDNR--VAD----QLWLP----DTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQ----GGKNAVTGVDKLELPQFSIVELHLVSREVRFTTGSYPRLSLSF--RIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVF 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: GABRG3 (gamma-aminobutyric acid type A receptor gamma3 subunit [Source:NCBI gene;Acc:103040847])

HSP 1 Score: 56.9954 bits (136), Expect = 2.879e-8
Identity = 59/259 (22.78%), Postives = 113/259 (43.63%), Query Frame = 1
Query:  397 YSAEIFLQSKWREPLLDNRSDIKDISLSS-----FWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITVST-EYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFF 1143
            Y  +I     W +  L   S +K ++L+S      W P    + IF  +K++ SH ++   +      +  I    R++      L+L +FP D     +  S+  YP +E+          + N+++  + + W LY+   +  +   +       +  +MT     SRR  YF I  ++   +  +L++ SF I    T  R AL +TT+LT  T       +LP++ Y+T +D  +    LF+      +A+ +++
Sbjct:   85 YQIDIIFAQTWTDSRLRYNSTMKILTLNSNMVGLIWVP----DTIFRNSKNADSHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDEHSCPLIFSSYGYPRDEMIYKW------RKNSVEAADQKSWRLYQFDFMGLRNTTDVIKTTAGDYVVMTVYFDLSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTVARTSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYY 333          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4-like [Source:NCBI gene;Acc:103032374])

HSP 1 Score: 56.9954 bits (136), Expect = 3.313e-8
Identity = 66/281 (23.49%), Postives = 126/281 (44.84%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D+++E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  +++            N + G++  E   +  VE+   +       G   R  ++F  R  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   67 INIASIDSISEVNMDYTITMYFQQSWRDKRLAYVEMPLNLTLDNR--VAD----QLWLP----DTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQ----GGKNAVTGVDKLELPQFSIVELHLVSREVRFTTGSYPRLSLSF--RIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVF 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 51.2174 bits (121), Expect = 3.178e-7
Identity = 62/264 (23.48%), Postives = 116/264 (43.94%), Query Frame = 1
Query:  397 YSAEIFLQSKWREPLL------DNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTC-----RASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSF 1140
            Y   IFL+ +W +P L      D+  D+    L S W P +     F   K +  HEV+   K     ++  +    R++      ++L++FP D Q  ++ + S  Y +N++ + E   +   +   +G+   ++ L +  ++   T         K      FTC        R+  Y+LI  ++ S +  +L++ SF I       R+AL +TT+LT  T       +LPK+ Y+  +D  +   +LF+      +A+ +F
Sbjct:   27 YRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDL----FFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDL-IFEWKQE-GAVQVAEGLTLPQFVLKDEKDLVYCT---------KHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNF 275          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO32790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU26])

HSP 1 Score: 110.153 bits (274), Expect = 2.584e-26
Identity = 84/309 (27.18%), Postives = 149/309 (48.22%), Query Frame = 1
Query:  340 VYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGM---ESQEWNLYEHVEVEAKTMINDCNIGPKERQ--IMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDPTVSSATATANVKQVETYIISCLLGVYGLVILI 1251
            V +RC    +  +D + + ++ E+++ + WREP L  + + +++   + W+PKIS  N  +  +      + Y   +      E  ++ G F+E   L+ FP D Q+LSI +S+++    V   +   D++K + +        ++W LY HV  +  T   +  +GP +R   +   T    RR  ++  N  ++ S+   L+F SF+IPP  T  RL + +  LL SV +K   S +LP+  YLT+LDK  LGN+LFI  +   +               T    V+  +TY + CL     L +++
Sbjct:   18 VLIRCGISFLGDIDVIRQQFTCELWMTASWREPKLAGKKN-EEVKWDNEWSPKISFSNSLLLDRVYKGRRLYYEENSTVPLAQEVYKIRGTFKEQFSLEQFPVDLQELSIIISSDWSDRTVTFEK---DMAKPDYLRQQTFSSPRDWVLYPHVHTDTATQEGE-GLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAVLN---------------TIAVAVESRDTYDMVCLYAGLALYVIL 306          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO35410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK4])

HSP 1 Score: 64.6994 bits (156), Expect = 1.943e-11
Identity = 71/277 (25.63%), Postives = 135/277 (48.74%), Query Frame = 1
Query:  313 SVNKPVARLVYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLL--DNRSDIKDISLSSFWNPKISIENI-FMETKSSISHEVSYSGKAREAYITEKRRVSGGFREV---------LELQHFPFDCQDLSITVSTEYPINEVKMLECPHD-LSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFI 1104
            S  +PV  +VY+      I+ +  +N  ++ +I+L+  WR+  L  + ++    ++LSS  N +I + +  F+ TK +  H+V+      + Y+ + +     F  +         L+L+ FP D Q  S+++ + Y      +L   ++ L   + I   +  E   +E + V     +N  NIG     +  F  R  RR  YFLI+ ++ S++  ++++ SF I P     R+AL +TT+LT  T   +   NLPK+ Y+  +D  +L  ++F+
Sbjct:   41 SKGEPV--VVYVDMYVSNIWAMQEMNMDFTIDIYLRQYWRDERLQFETQTPGAMLTLSSDINKQIWVPSTYFLATKKAYFHDVT-----TDNYLLQVKPDGSLFYSIRLTITTSCRLDLRDFPHDTQSCSLSLES-YGYQSTDVLYVWNERLDNTSAIYIHDDLELPQFEVLGVSRSAKMNKYNIGNHSSLVANF--RMKRRIGYFLIDTYIPSTIIVIISWISFWIDPETAPARVALGITTVLTMTTLISSARANLPKVSYVKAIDWYLLLCLIFV 307          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO26859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAV8])

HSP 1 Score: 59.6918 bits (143), Expect = 1.823e-10
Identity = 51/165 (30.91%), Postives = 80/165 (48.48%), Query Frame = 1
Query:  763 QEWNLYEHVEVEAKTMINDCNIGPKERQ--IMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDPTVSSATATANVKQVETYIISCLLGVYGLVILI 1251
            ++W LY HV  +  T   +  +GP +R   +   T    RR  ++  N  ++ S+   L+F SF+IPP  T  RL + +  LL SV +K   S +LP+  YLT+LDK  LGN+LFI  +   +               T    V+  +TY + CL     L +++
Sbjct:   16 RDWVLYPHVHTDTATQEGE-GLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAVLN---------------TIAVAVESRDTYDMVCLYAGLALYVIL 164          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO37555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG6])

HSP 1 Score: 60.077 bits (144), Expect = 1.036e-9
Identity = 66/258 (25.58%), Postives = 119/258 (46.12%), Query Frame = 1
Query:  361 IKIFKVDTVNEFYSAEIFLQSKWREPLLDNRSD----IKDISLSSFWNPKISIENIFMETKSSISHEVSYSGK----AREAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVK-MLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFI 1104
            + I  ++ ++  Y  + FL+  WR+P L +R D    + +  L   W P    +  F+ +K S  H V+   K    + +  +    RV+      + L+ FP D Q+ +I + S  Y  + V+   E   D          +  ++NL +       TM    N        +T T R  RR  YF+I+ +   ++  +L++ SF IPP  T  R+AL +T++LT  T    ++ ++PK+ Y+  +D  ++G  LF+
Sbjct:   39 LSIDAINVIDMDYRMDFFLRQLWRDPRLKHRFDDTLALSNTMLDKIWVP----DTYFVNSKMSKFHSVTTINKMLSISPDGLVHYNSRVTVKASCAMNLRMFPKDVQNCNIDIESYGYSADNVQYQWENRSDNGIAVNKKIRDMPQYNLSDINVSRHFTMYVAGNWSG-----LTATFRFRRRSGYFIIHIYAPCALIVILSWISFCIPPESTAARIALGITSVLTITTILNMLNNSMPKVSYVKAVDWYLIGCFLFV 287          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO43147 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZH2])

HSP 1 Score: 58.9214 bits (141), Expect = 1.193e-9
Identity = 68/263 (25.86%), Postives = 117/263 (44.49%), Query Frame = 1
Query:  364 KIFKVDTVNEF---YSAEIFLQSKWREP-LLDNRSD---IKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKAREAY----ITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKT-MINDCNI-GPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIML 1110
            K+  +  +NE    +S +IF +  W EP    N S+   + + +   FW P    +  F+  K S  H+V+        Y    +    R++   +  + LQ FP D Q   + + S  Y   ++K    P     +  I    +Q       V VEA+T  I    I G   + + TF+ +  RR +YF I     + +  +L++  F I P     R++L +TT+L+++     V+  +PK+ Y+  +D  +LGN  FI L
Sbjct:   35 KVVSLGGINEASMEFSMDIFFRQWWHEPRFTHNYSEPFTMAEDAGKLFWIP----DTYFINAKKSNFHKVTKENARIIIYPSGNVYYSVRLTLTLQCNMNLQLFPMDVQACPLFIESYAYTSEDIKYKWTPRGTKGIEIISNETAQ------FVLVEARTEQIATAKISGHFSQLVATFSLK--RRLEYFAITVVTPAMILVVLSWCCFWIVPDAIPARISLSVTTILSTLLLSGTVNAQMPKVSYMKAIDVFVLGNFAFIFL 285          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:NCBI gene;Acc:101155813])

HSP 1 Score: 58.5362 bits (140), Expect = 7.955e-9
Identity = 63/242 (26.03%), Postives = 108/242 (44.63%), Query Frame = 1
Query:  367 IFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISI-ENIFMETKSSISHEVSYSGKAREAY----ITEKRRVSGGFREVLELQHFPFDCQDLSITVST-EYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLD 1074
            I  VD +N  Y+ +IF    W +  L   S +K + L+S    KI I +  F  ++ S +H ++   +    +    +    R++      L+L +FP D     +  S+  YP NE+          +   ++  + + W LY+   V  +   +  +    E  IMT     SRR  YF I  ++  SM  +L++ SF I       R +L +TT+LT  T      ++LPK+ Y+T +D
Sbjct:   88 IGPVDPINMEYTIDIFFAQTWYDSRLKFNSSMKLLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRLWSNGRVMYTLRLTINAECYLKLHNFPMDEHSCPLEFSSYGYPRNEIMYRW------QRRAVEVADQRYWRLYQFAFVGMRNTSDVAHTQSGEYVIMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYITAMD 323          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrb2a (gamma-aminobutyric acid type A receptor beta2 subunit [Source:NCBI gene;Acc:101165154])

HSP 1 Score: 57.7658 bits (138), Expect = 1.530e-8
Identity = 69/320 (21.56%), Postives = 148/320 (46.25%), Query Frame = 1
Query:  271 ILICDTNKMENNSKSVNKPVARL-----VYLRCVF----------IKIFKVDTVNEF---YSAEIFLQSKWREPLLDNRSDIKDISLSS-----FWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I +CD  K  +N   V + V RL     + LR  F          I I  +D V+E    Y+  ++ Q  WR+  L       +++L +      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++      +   ++ +D +E  ++++ ++ ++ +K ++      P+    ++ + +  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   18 ISLCDDIKDPSNMPLVKETVDRLMKGYDIRLRPDFGGAPVAVGMNIDISSIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIAYNLTLDNRVADQLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGE-GAVSGVDRIELPQFSIVDY-KLISKNVVFSTGSYPR----LSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIF 327          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrb1 (gamma-aminobutyric acid type A receptor beta1 subunit [Source:NCBI gene;Acc:101154825])

HSP 1 Score: 56.9954 bits (136), Expect = 2.485e-8
Identity = 65/281 (23.13%), Postives = 129/281 (45.91%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++        S   ++ G+E+ E   +  ++ +  +       G   R  ++F  +  R   YF++  ++ S++  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   64 IDIASIDMVSEVNMDYTITMYFQQSWRDKRLSYTGIPLNLTLDNR--VAD----QLWVP----DTYFINDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW--QGGSNAGSVTGVENIELPQFSIIDYQTLSTKAVFATGSYPRLSLSFKLK--RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIF 330          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: GABRB2 (gamma-aminobutyric acid receptor subunit beta-2 [Source:NCBI gene;Acc:101167169])

HSP 1 Score: 56.9954 bits (136), Expect = 2.964e-8
Identity = 62/281 (22.06%), Postives = 133/281 (47.33%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++       +  +  ++ +E  ++++ +H ++ +K ++      P+    ++ + +  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   62 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIPLNLTLDNR--VAD----QLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFY-WRGGVGAVTGVERIELPQFSIVDH-KLISKNVVFSTGAYPR----LSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYIF 326          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: GABRB2 (gamma-aminobutyric acid receptor subunit beta-2 [Source:NCBI gene;Acc:101167169])

HSP 1 Score: 56.6102 bits (135), Expect = 3.197e-8
Identity = 62/281 (22.06%), Postives = 133/281 (47.33%), Query Frame = 1
Query:  361 IKIFKVDTVNEF---YSAEIFLQSKWRE--------PL---LDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKA----REAYITEKRRVSGGFREVLELQHFPFDCQDLSITV-STEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFF 1146
            I I  +D V+E    Y+  ++ Q  WR+        PL   LDNR  + D      W P    +  F+  K S  H V+   +      +  +    R++     +++L+ +P D Q+ ++ + S  Y  ++++       +  +  ++ +E  ++++ +H ++ +K ++      P+    ++ + +  R   YF++  ++ S +  +L++ SF I    +  R+AL +TT+LT  T    + + LPKIPY+  +D  ++G  +F+ L    +A  ++ F
Sbjct:   67 IDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIPLNLTLDNR--VAD----QLWVP----DTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFY-WRGGVGAVTGVERIELPQFSIVDH-KLISKNVVFSTGAYPR----LSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYIF 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041829.1 (SMESG000041829.1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 298/362 (82.32%), Postives = 313/362 (86.46%), Query Frame = 1
Query:  295 MENNSKSVNKPVARLVYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXX-XXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDPTVS--SATATANVKQVETYIISCLLGVYGLVILIFGLVIYFDAGSRRREMSEKDREFKRLLEKIENEKLFCDVC 1371
            MENNSKSVNKPVARLVYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVE+KT+INDCNIGP+ERQ MTFTCRASRRFKYFLINH +ISSM F L   +    P + TY RL LCMTTLLTSVTFKVAVSQNLPKIPYLTYLDK ILGNI+ IM LC WHASTS FF     S  S   T  ++ +E Y+I  L+  YGL IL  GL IYFDAG RRREM  KD EF  +++KIE EKLFCDVC
Sbjct:    1 MENNSKSVNKPVARLVYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVESKTVINDCNIGPRERQTMTFTCRASRRFKYFLINHIMISSMFFLLTFTSFSIAPQTNTYYRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKAILGNIVMIMCLCIWHASTSLFFLTKIFSDNSTITTTAIEGIEKYLIPSLVVFYGLAILAVGLTIYFDAGKRRREMIAKDVEFSEMIKKIETEKLFCDVC 362          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000064433.1 (SMESG000064433.1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 298/344 (86.63%), Postives = 324/344 (94.19%), Query Frame = 1
Query:  340 VYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDPTVSSATATANVKQVETYIISCLLGVYGLVILIFGLVIYFDAGSRRREMSEKDREFKRLLEKIENEKLFCDVC 1371
            VYLRCVF+KI+KVDTVNEFYS EIFLQSKWREPLLD++ ++KD++L SFWNPK+ IENIF E KSS+S EV+++ K  EA+I EKRRV   FRE LELQHFPFDCQDLS++V+TEY I+EV ++E P+D+SKLNT+DG+ESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHFLISSMFFLLTFTSFSIPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFND T+SSATATANVKQVETYIISC LGVYGLVILIFGLVIYFDAGSRRREMS+KDREFKRLLEKIENEKLFCDVC
Sbjct:   16 VYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDHKPNLKDVNLFSFWNPKLIIENIFTENKSSVSLEVTFTEKY-EAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHFLISSMFFLLTFTSFSIPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDTTISSATATANVKQVETYIISCFLGVYGLVILIFGLVIYFDAGSRRREMSDKDREFKRLLEKIENEKLFCDVC 358          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041818.1 (SMESG000041818.1)

HSP 1 Score: 513.457 bits (1321), Expect = 0.000e+0
Identity = 266/360 (73.89%), Postives = 299/360 (83.06%), Query Frame = 1
Query:  295 MENNSKSVNKPVARLVYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSP-TYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDPTVSSATATANVKQVETYIISCLLGVYGLVILIFGLVIYFDAGSRRREMSEKDREFKRLLEKIENEKLFCDVC 1371
            ME  SKS +K   +LVYLRCVFIKI+KVDT+NEFYS +IFLQ+KWREPLLD+R+D+KDI+LS+FWNPK+ IEN+F E+KSS+ HEVS+S K  EAYITEKRR+   FRE LELQHFPFDCQDLSI V+TEY INEVK++E PHDLSKLNTIDGMESQEWNLYEHVEVE+KT+IN+CNIGP+ERQIMTFTCRASR+FKYFLINH +ISSMFFLLTFTSFSI P+  T+ RL LCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNIL IM LC WHA TS FF   T    T  + +   E  II CLLG Y + IL+ GL IYFDAG RRREM  KD EF   L KIE EKLFC+VC
Sbjct:    1 MEVESKSNHKQSKKLVYLRCVFIKIYKVDTINEFYSGDIFLQAKWREPLLDDRTDMKDINLSTFWNPKLVIENMFQESKSSVVHEVSFSEKRHEAYITEKRRIKACFRETLELQHFPFDCQDLSIPVATEYSINEVKLVELPHDLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIGPRERQIMTFTCRASRKFKYFLINHIMISSMFFLLTFTSFSITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHACTSLFFKFTTTDDTTTASVISTAEQKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKDAEFAEALAKIEAEKLFCEVC 360          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041796.1 (SMESG000041796.1)

HSP 1 Score: 509.22 bits (1310), Expect = 6.924e-179
Identity = 259/359 (72.14%), Postives = 299/359 (83.29%), Query Frame = 1
Query:  295 MENNSKSVNKPVARLVYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYS-GKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDPTVSSATATANVKQVETYIISCLLGVYGLVILIFGLVIYFDAGSRRREMSEKDREFKRLLEKIENEKLFCDV 1368
            MENNSKS      R VYLRCVFIKI+KVDTVNEFYS EIFL +KWREPLLDN+SD+KDISLS+FWNPK+SIENIF  TKS+ S EVS+  G  + A++ EK R+   FRE LELQHFPFDCQDLSI+V TEY I E++M E P+D+SKLNT+DG+ESQEWNLYEHVEVE K +INDCN GPKERQIMTFTCRA+RRFKYFLINHF+ISSMFFLLTF+SFSI  + TYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNIL IMLLC WHA TSF+F DP+ ++  A +++  +E  +I  LLG Y + IL F  +IY+DAGSRRREM+EKD EFK L  K ENE+LFC++
Sbjct:   54 MENNSKSNQIKTKRKVYLRCVFIKIYKVDTVNEFYSGEIFLHAKWREPLLDNKSDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRIKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHFMISSMFFLLTFSSFSIISTNTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMLLCIWHAVTSFWFIDPSTNTTVAMSSLTNIENILIPTLLGFYLIAILTFAFIIYYDAGSRRREMTEKDNEFKSLSIKKENERLFCEL 412          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000064435.1 (SMESG000064435.1)

HSP 1 Score: 447.203 bits (1149), Expect = 2.274e-155
Identity = 227/359 (63.23%), Postives = 281/359 (78.27%), Query Frame = 1
Query:  295 MENNSKSVNKPVARLVYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHXXXXXXXXXXXXXXXXXPPSPTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDPTVSSATATANVKQVETYIISCLLGVYGLVILIFGLVIYFDAGSRRREMSEKDREFKRLLEKIENEKLFCDVC 1371
            ME +S+S  +PV + +YLRCVFIKIFKVDTVNE Y AEIFLQ+KWREPLLDN  D K+I L +FWNPK+ IENIF E K S+S EVSYS K   AY+ EKRRV   F E+LEL+HFPFDCQDLSI V+TEY  + V ++E PHD SKLN  DG+ESQEW+LY HVEV    + NDCNIGP+ER I+ FTCRASRRF+YFLINHFLISS+FFLLTFTSFSI  +  +GRL LCMTTLLTSVTFKVAVSQ+LPKIPYLTYLDKTILGNI  IM +C WHA T+ F+ + ++S+      ++ VE  +I  +L  YGL ++++ ++IY+DAG+RRREM+ KD EF++  +K+ + ++ CDVC
Sbjct:    1 MEEDSESNQEPVQKKIYLRCVFIKIFKVDTVNENYYAEIFLQAKWREPLLDNECDYKNIDLKNFWNPKLRIENIFTENKVSVSLEVSYSEKEGVAYLMEKRRVKASFHEILELKHFPFDCQDLSIIVTTEYSSDYVDLMESPHDPSKLNVSDGIESQEWSLYSHVEVLKDRLKNDCNIGPEERSILIFTCRASRRFRYFLINHFLISSIFFLLTFTSFSIISTNAFGRLQLCMTTLLTSVTFKVAVSQSLPKIPYLTYLDKTILGNIFMIMCVCMWHAGTAIFYFNTSISTDATVERIRNVELILIPSILSFYGLAVMVYSIIIYYDAGTRRREMAVKDAEFEKAWKKVRSVEIPCDVC 359          
The following BLAST results are available for this feature:
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRG33.990e-923.05gamma-aminobutyric acid type A receptor gamma3 sub... [more]
GABRB38.660e-922.78gamma-aminobutyric acid type A receptor beta3 subu... [more]
GABRB31.221e-823.13gamma-aminobutyric acid type A receptor beta3 subu... [more]
GABRB31.287e-823.13gamma-aminobutyric acid type A receptor beta3 subu... [more]
GABRB31.571e-823.13gamma-aminobutyric acid type A receptor beta3 subu... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG89167.475e-823.64gene:FBgn0030707 transcript:FBtr0301233[more]
CG89161.035e-723.64gene:FBgn0030707 transcript:FBtr0301232[more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrg12.631e-926.03gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrg13.906e-926.03gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrb46.008e-922.55gamma-aminobutyric acid type A receptor beta4 subu... [more]
gabrb47.855e-922.55gamma-aminobutyric acid type A receptor beta4 subu... [more]
gabrb12.035e-823.13gamma-aminobutyric acid type A receptor beta1 subu... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000020814.16.027e-1022.83gamma-aminobutyric acid type A receptor theta subu... [more]
ENSXETT00000020832.16.183e-1022.83gamma-aminobutyric acid type A receptor theta subu... [more]
ENSXETT00000004017.14.800e-923.16gamma-aminobutyric acid (GABA) A receptor, beta 1 ... [more]
ccdc1341.323e-823.05coiled-coil domain containing 134 [Source:Xenbase;... [more]
dusp51.876e-822.42dual specificity phosphatase 5 [Source:Xenbase;Acc... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gabrg31.034e-923.05gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb37.273e-922.78gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb39.215e-923.13gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb31.036e-823.13gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb22.782e-823.49gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P28473|GBRG3_RAT6.920e-923.05Gamma-aminobutyric acid receptor subunit gamma-3 O... [more]
sp|P27681|GBRG3_MOUSE7.231e-923.05Gamma-aminobutyric acid receptor subunit gamma-3 O... [more]
sp|Q99928|GBRG3_HUMAN1.916e-823.05Gamma-aminobutyric acid receptor subunit gamma-3 O... [more]
sp|P19019|GBRB3_CHICK2.538e-824.03Gamma-aminobutyric acid receptor subunit beta-3 OS... [more]
sp|P24045|GBRB4_CHICK3.882e-823.19Gamma-aminobutyric acid receptor subunit beta-4 OS... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7CFX93.965e-7040.11Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
A0A4E0RSR91.398e-6940.27Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A075A8W66.020e-6840.11Uncharacterized protein OS=Opisthorchis viverrini ... [more]
R7VF523.199e-6739.88Neur_chan_LBD domain-containing protein OS=Capitel... [more]
A0A5K4FCR63.068e-6639.48Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRG34.653e-923.05gamma-aminobutyric acid type A receptor gamma3 sub... [more]
gabrb11.482e-823.13gamma-aminobutyric acid type A receptor beta1 subu... [more]
gabrb42.173e-823.49gamma-aminobutyric acid receptor subunit beta-4-li... [more]
GABRG32.879e-822.78gamma-aminobutyric acid type A receptor gamma3 sub... [more]
gabrb43.313e-823.49gamma-aminobutyric acid receptor subunit beta-4-li... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
glra23.178e-723.48glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327902.584e-2627.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354101.943e-1125.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268591.823e-1030.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375551.036e-925.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431471.193e-925.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrg17.955e-926.03gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrb2a1.530e-821.56gamma-aminobutyric acid type A receptor beta2 subu... [more]
gabrb12.485e-823.13gamma-aminobutyric acid type A receptor beta1 subu... [more]
GABRB22.964e-822.06gamma-aminobutyric acid receptor subunit beta-2 [S... [more]
GABRB23.197e-822.06gamma-aminobutyric acid receptor subunit beta-2 [S... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041829.10.000e+082.32SMESG000041829.1[more]
SMESG000064433.10.000e+086.63SMESG000064433.1[more]
SMESG000041818.10.000e+073.89SMESG000041818.1[more]
SMESG000041796.16.924e-17972.14SMESG000041796.1[more]
SMESG000064435.12.274e-15563.23SMESG000064435.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020055 ID=SMED30020055|Name=Neur_chan_LBD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1542bp
AAAATATGTGATTCTAAAAATTAATTTATTTCTTATTTAAATCATTTTTT
CTGACAAAAAACTAAAGGAAATAATAATTATAATGTCAAAATAATGGCAT
ATTTGTTTTTTTCTATCCCACGGAGAAGGGTGAATATTAATAAAAAAATA
AAAACTACATTGTGTCAGTTATTGGCGTTGGAAATAATACAATAGACATG
ACAACCAATAATATACCAATGAATTTTATTGGATAAAATGTTTTCTGTAG
AAATAATAAATAAATTTTAAATACTAATCTGTGATACCAATAAAATGGAA
AACAATTCAAAGTCAGTCAACAAACCCGTTGCAAGACTTGTATATCTTCG
ATGCGTCTTTATCAAAATATTCAAAGTTGATACAGTCAATGAATTTTATT
CTGCGGAAATATTTCTTCAATCTAAATGGCGAGAACCGCTATTGGATAAC
AGATCAGACATTAAAGACATCAGTTTGTCTAGCTTTTGGAATCCAAAAAT
TTCAATAGAAAACATTTTTATGGAAACGAAATCTTCAATTTCTCACGAAG
TCTCCTATTCTGGCAAGGCGCGTGAAGCTTACATTACAGAAAAAAGGCGT
GTGTCTGGCGGCTTTCGTGAAGTTTTAGAATTGCAACACTTTCCGTTTGA
TTGCCAAGATTTATCAATAACAGTCTCCACAGAATATCCCATAAATGAAG
TAAAAATGCTTGAATGTCCGCACGATCTTAGCAAATTGAACACAATTGAT
GGAATGGAATCACAAGAATGGAATTTATATGAGCATGTTGAGGTAGAAGC
TAAAACAATGATAAATGATTGTAATATTGGACCAAAAGAACGTCAAATTA
TGACTTTCACTTGCCGAGCTAGTCGAAGGTTCAAATATTTTCTTATTAAT
CATTTTCTGATAAGCTCAATGTTCTTTTTATTGACATTTACAAGTTTTTC
AATACCACCAAGTCCAACTTATGGACGGTTGGCGTTATGTATGACTACTT
TATTGACAAGTGTCACTTTCAAGGTGGCCGTAAGTCAAAATTTGCCGAAA
ATACCTTACCTTACTTATTTGGATAAAACTATTCTCGGAAACATTTTATT
TATTATGCTACTTTGTTTCTGGCATGCGTCCACGTCCTTCTTTTTCAATG
ATCCAACCGTAAGTTCAGCCACGGCTACTGCTAATGTAAAACAAGTGGAA
ACATACATAATTTCTTGTTTGTTAGGGGTTTATGGACTGGTAATACTAAT
TTTTGGTCTGGTCATTTATTTTGATGCTGGATCACGAAGACGAGAAATGT
CAGAAAAAGACAGAGAGTTTAAAAGATTGTTAGAGAAAATAGAAAATGAG
AAATTATTTTGTGACGTTTGTTGAGATTAATGTTTTCGAATATTTTATTT
TGCCTTATAATATGATTCACTTATTTTCTCTGATTTTCATTTAAAAACTT
CCATCTATATCTTTTTTTTCATTCGATTGTATATTTTAATTCTTTTCTAG
TTACTTAATTTGAATTTTGCAAGTTATACGAGTTAGATCGGA
back to top

protein sequence of SMED30020055-orf-1

>SMED30020055-orf-1 ID=SMED30020055-orf-1|Name=SMED30020055-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=360bp
MENNSKSVNKPVARLVYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLL
DNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEK
RRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNT
IDGMESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFL
INHFLISSMFFLLTFTSFSIPPSPTYGRLALCMTTLLTSVTFKVAVSQNL
PKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDPTVSSATATANVKQ
VETYIISCLLGVYGLVILIFGLVIYFDAGSRRREMSEKDREFKRLLEKIE
NEKLFCDVC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR006201Neur_channel
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 193..256
e-value: 2.1E-6
score: 29.5
NoneNo IPR availablePANTHERPTHR18945:SF768coord: 16..250
NoneNo IPR availableCDDcd18988LGIC_ECD_bactcoord: 22..161
e-value: 7.47718E-15
score: 68.4734
NoneNo IPR availableCDDcd19062LGIC_TM_GluClcoord: 198..250
e-value: 0.00380054
score: 34.249
NoneNo IPR availableTMHMMTMhelixcoord: 231..253
NoneNo IPR availableTMHMMTMhelixcoord: 199..221
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 7..191
e-value: 2.1E-15
score: 58.7
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 13..183
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 16..190
e-value: 1.4E-7
score: 31.2
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 16..250