Transcription elongation factor spt6

Overview
NameTranscription elongation factor spt6
Smed IDSMED30020054
Length (bp)4704
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription elongation factor spt6 (SMED30020054) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription elongation factor spt6 (SMED30020054) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription elongation factor spt6 (SMED30020054) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription elongation factor spt6 (SMED30020054) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020054

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020054SMESG000058110.1 SmedASXL_017306SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020054SMESG000058110.1 SmedASXL_017306SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30020054SMESG000058110.1 dd_Smed_v4_3968_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020054SMESG000058110.1 dd_Smed_v4_3968_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020054SMESG000058110.1 dd_Smed_v4_3968_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020054SMESG000058110.1 dd_Smed_v4_3968_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020054SMESG000058110.1 Contig54251uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020054SMESG000058110.1 Contig54251newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription elongation factor spt6 vs. Ensembl Human
Match: SUPT6H (SPT6 homolog, histone chaperone and transcription elongation factor [Source:HGNC Symbol;Acc:HGNC:11470])

HSP 1 Score: 865.144 bits (2234), Expect = 0.000e+0
Identity = 560/1468 (38.15%), Postives = 845/1468 (57.56%), Query Frame = 1
Query:  343 LEQPKKRSRLQRESDDEDDISEKRFKMTNVDEDIVDEVEGPNLGSDEEDEDDLRNFIVDANDSRSARKSS--------------------KKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV------DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFA--------------------SKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY------------------KNINEVNLEEPEVIEPNNLNKR----LKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPER---AYSN---ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFI--QSTEKDDNY-DEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKK---DVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDR---DNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRT---PMIGSTPT 4485
            +++ +K  R+++ SDDEDD  E+  K  +  E I +E+     G  EE ++ +   +    +     + S                    KK   + D   QEAQE+FGVD +  E    N  DEE   E E + +     IR R +K          + ++++P+EL+    T +D +I+  D+PERFQLRS+P +           +  E+EEEA W+Y+  FA                    S S K   TI  IKE L  ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++  R++N   +FEK+  +  + +  S D +  L++ ++A L+ +++       E +K  +SM+ LKD   +F +YY                  K + E   EE E  E  +  +R     + S+ + +T+ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A++++CS F T + VL+G R M+A QI+ EP VR+ LR  F     + +TPTKKG+ ++DE H  Y  KYL +KP+    DD  FL I     + L+T  I +  +    Y N     ++ K F++RDE++   Q+WN QR + I++AL  FL   + KE++++LL +A+E +      K++  + V P+   Q  E+DD++ DE    G R+LGI ++ A +       F A+++G G+V D  +L    +  RR  +  + ++K   D+E L   +L  +P+ V +A ++  A  L  ++ +++  L++   L+   VELVDNE+AI+Y NSK S+++F +YP +LRQA+S+ARR+QDPL EFAQ+ + D+D++ L+ HPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    AL+Q+VCGLGPRK  +L+K +K++   L SR  ++  C +GPKV MNC GF+KI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G KHITL DIR EL+ R++D R  +RS + +E F +LTKET ET  +G L+   V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK +SD  V    +R+++ M V  R++K+D E+   +++ +++DL D N  W+  KD YYD  AE  D +  E+   KQ++   Y+ RVI HP F NI +   EKM   ++ G+ IIRPSSKG NHLTV+WKV + + +H+DV EE K+N FSLG TL I  E+FEDLDEI+A YVQPMA+FAR++ ++KYY+   G ++  L +++   K   P  IPYFI   ++ PG+F++ Y P  K R +   +TP+GF +R   F  +  L  +FK H+ D P    TP + SRT     I +TP 
Sbjct:  112 VKRGQKYRRVKKMSDDEDDDEEEYGKEEHEKEAIAEEIF--QDGEGEEGQEAMEAPMAPPEEEEEDDEESDIDDFIVDDDGQPLKKPKWRKKLPGYTDAALQEAQEIFGVDFDYDEFEKYNEYDEELEEEYEYEDDEAEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQLRSIPVK---------GAEDDELEEEADWIYRNAFATPTISLQESCDYLDRGQPASSFSRKGPSTIQKIKEALGFMRNQHFEVPFIAFYRKEYVEP------ELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKMQAY--QYEQISADPDKPLADGIRA-LDTTDM-------ERLKDVQSMDELKDVYNHFLLYYGRDIPKMQNAAKASRKKLKRVREEGDEEGEGDEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKLNITPTKKGRKDVDEAHYAYSFKYLKNKPVKELRDD-QFLKICLAEDEGLLTTDISIDLKGVEGYGNDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQFLYVQMAKELKNKLLAEAKEYVIKACSRKLYNWLRVAPYRPDQQVEEDDDFMDENQGKGIRVLGIAFSSARDHP----VFCALVNGEGEVTDFLRLP--HFTKRRTAWREEEREKKAQDIETLKKFLLNKKPHVVTVAGENRDAQMLIEDVKRIVHELDQGQQLSSIGVELVDNELAILYMNSKKSEAEFRDYPPVLRQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYCEFINRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTMCHMGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTAYRSPNTEEIFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVGMTVHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQQRTT-YIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLNHKYYQDCSGGDRKKLEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVTVTPEGFRYRGQIFPTVNGLFRWFKDHYQD-PVPGITPSSSSRTRTPASINATPA 1541          
BLAST of Transcription elongation factor spt6 vs. Ensembl Human
Match: SUPT6H (SPT6 homolog, histone chaperone and transcription elongation factor [Source:HGNC Symbol;Acc:HGNC:11470])

HSP 1 Score: 865.144 bits (2234), Expect = 0.000e+0
Identity = 560/1468 (38.15%), Postives = 845/1468 (57.56%), Query Frame = 1
Query:  343 LEQPKKRSRLQRESDDEDDISEKRFKMTNVDEDIVDEVEGPNLGSDEEDEDDLRNFIVDANDSRSARKSS--------------------KKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV------DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFA--------------------SKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY------------------KNINEVNLEEPEVIEPNNLNKR----LKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPER---AYSN---ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFI--QSTEKDDNY-DEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKK---DVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDR---DNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRT---PMIGSTPT 4485
            +++ +K  R+++ SDDEDD  E+  K  +  E I +E+     G  EE ++ +   +    +     + S                    KK   + D   QEAQE+FGVD +  E    N  DEE   E E + +     IR R +K          + ++++P+EL+    T +D +I+  D+PERFQLRS+P +           +  E+EEEA W+Y+  FA                    S S K   TI  IKE L  ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++  R++N   +FEK+  +  + +  S D +  L++ ++A L+ +++       E +K  +SM+ LKD   +F +YY                  K + E   EE E  E  +  +R     + S+ + +T+ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A++++CS F T + VL+G R M+A QI+ EP VR+ LR  F     + +TPTKKG+ ++DE H  Y  KYL +KP+    DD  FL I     + L+T  I +  +    Y N     ++ K F++RDE++   Q+WN QR + I++AL  FL   + KE++++LL +A+E +      K++  + V P+   Q  E+DD++ DE    G R+LGI ++ A +       F A+++G G+V D  +L    +  RR  +  + ++K   D+E L   +L  +P+ V +A ++  A  L  ++ +++  L++   L+   VELVDNE+AI+Y NSK S+++F +YP +LRQA+S+ARR+QDPL EFAQ+ + D+D++ L+ HPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    AL+Q+VCGLGPRK  +L+K +K++   L SR  ++  C +GPKV MNC GF+KI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G KHITL DIR EL+ R++D R  +RS + +E F +LTKET ET  +G L+   V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK +SD  V    +R+++ M V  R++K+D E+   +++ +++DL D N  W+  KD YYD  AE  D +  E+   KQ++   Y+ RVI HP F NI +   EKM   ++ G+ IIRPSSKG NHLTV+WKV + + +H+DV EE K+N FSLG TL I  E+FEDLDEI+A YVQPMA+FAR++ ++KYY+   G ++  L +++   K   P  IPYFI   ++ PG+F++ Y P  K R +   +TP+GF +R   F  +  L  +FK H+ D P    TP + SRT     I +TP 
Sbjct:  112 VKRGQKYRRVKKMSDDEDDDEEEYGKEEHEKEAIAEEIF--QDGEGEEGQEAMEAPMAPPEEEEEDDEESDIDDFIVDDDGQPLKKPKWRKKLPGYTDAALQEAQEIFGVDFDYDEFEKYNEYDEELEEEYEYEDDEAEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQLRSIPVK---------GAEDDELEEEADWIYRNAFATPTISLQESCDYLDRGQPASSFSRKGPSTIQKIKEALGFMRNQHFEVPFIAFYRKEYVEP------ELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKMQAY--QYEQISADPDKPLADGIRA-LDTTDM-------ERLKDVQSMDELKDVYNHFLLYYGRDIPKMQNAAKASRKKLKRVREEGDEEGEGDEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKLNITPTKKGRKDVDEAHYAYSFKYLKNKPVKELRDD-QFLKICLAEDEGLLTTDISIDLKGVEGYGNDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQFLYVQMAKELKNKLLAEAKEYVIKACSRKLYNWLRVAPYRPDQQVEEDDDFMDENQGKGIRVLGIAFSSARDHP----VFCALVNGEGEVTDFLRLP--HFTKRRTAWREEEREKKAQDIETLKKFLLNKKPHVVTVAGENRDAQMLIEDVKRIVHELDQGQQLSSIGVELVDNELAILYMNSKKSEAEFRDYPPVLRQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYCEFINRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTMCHMGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTAYRSPNTEEIFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVGMTVHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQQRTT-YIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLNHKYYQDCSGGDRKKLEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVTVTPEGFRYRGQIFPTVNGLFRWFKDHYQD-PVPGITPSSSSRTRTPASINATPA 1541          
BLAST of Transcription elongation factor spt6 vs. Ensembl Celegans
Match: emb-5 (Suppressor of Ty 6 homolog [Source:UniProtKB/Swiss-Prot;Acc:P34703])

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 435/1289 (33.75%), Postives = 693/1289 (53.76%), Query Frame = 1
Query:  739 VMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSM-------------------------KKDETIDIIKEVLNLIKVQL--FEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKT--AESMEALKDCSEYFTMYYKNI--NEVNLEEPEVI---EPNNLNKRLKPS-KSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLI----ENGSQDHLITYKIYLPERAYSNILDKY--KSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQS----INVQPFIQSTEKDDNYDEKNFYGRILGITYTIATNRNEESYAFAAIIDGSGDVID--------KAKLTGIMYGLRRKNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDL-NPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRDNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHF--DTQE--CPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERF--DQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRP 4425
            +++  +P+E+DRGF    D+KI K D+PERFQLR  P    D +         E+E EA W+ +  F   ++                         +K   I  IK+VL  I+V+   FEP FI  YRKE I+++      LT+ +LW +Y  DEKW  ++ ++     +  ++ ++ E            LS+ L AK      + P    + + T  AE++E L D    F + Y  +  + +  E+  +    E      + K S +++ + +  +  + +    FGL A+QF E++   +  H+++  PM P +AAEE++C  F+  D+VL G + MLA +IS +P+VR ++R  F       + PTKKG+D ID+ HPLY  +Y+  KP+ S T +  FL      E+G  D LI Y+    + + + +++KY   S F +DEY    +QWN  R   +  A+ + L+P +  E+ + +L++A+ ++  + C K F S        P   + + DD+  +++   RI+ + Y   T R+E S  F  ++D +G ++D        K    G   GLR+   + D  KK V+R        +P+A+ +  + +    L+ ++ + ++ L   + +  P PV L+DNE A +Y  S  S ++ P++P  LRQA+S+AR L DP+ E+A L N+D+D+  L LHPLQ  ++++ L   +  + VN VN+ GVDIN C    +   +LQF CGLGPRKA  L+K+IK +  L+ SR+ ++  C +GPKV MNC GFIKI+ +   +  D   E+LD +R+HPE+YE A+KMA+DALE DD  +  AAL+EIMESP++LRDLDL+AFA+EL R   G K  TL DI  EL+ R++D R  F+    +  ++LL +   E  + G  V   V S+ ++K  +D  D   P   E+ G + CP C   T      + +H   D+++  CPG  +G+     N +  F   KNIS +HV N L R++++     +VLK+D ER  L +S KS+DL++ + +   Q+D Y+DE     D +L++ + +K+ +    V RVI HP F N++Y    KM   ++  E IIRPS+   + L+V+WK+ + V  +  V E  KD  FS+G  L + GE FEDLDE+IA +VQPM   + E+ ++KY+       +   V+    EK     + PY  +   + P +F I YM D+ ER   + FKI P G  FR+  F  L  ++ +FK HF++ P
Sbjct:  255 LLESIEPSEIDRGFLLPGDKKIAKEDLPERFQLRRTPVTEADDD---------ELESEALWIIKYAFEEGTVTNQADLDQDDKLDCIMNLDPSVYEDRKKAVIKSIKKVLQFIRVRSNSFEPTFIGFYRKEDIDNL------LTMNNLWRVYDFDEKWCHLSEKKNKIYDLMRRMREYQE------------LSDDLTAK------RRPISDADLMDTKYAETLEQLTDIHANFQLLYGALLDDMIRWEKGRLTGEEEEQEYRVKFKSSIRNDKYQMCVENGIGELAGRFGLTAKQFSENL--NWKKHDIEQDPMLPLEAAEEYVCPAFSDSDMVLNGAKFMLAKEISRQPQVRHSVRQEFRQSAHFWIKPTKKGRDTIDQTHPLYDKRYIKSKPVRSLTAE-EFLFYHKAKEDGLVDVLIMYESEEDQDSNNYLVNKYLSDSIFQKDEYTENVEQWNSVRDECVNMAITEMLVPYMRDELYNTILEEAKTAVAKK-CRKEFASRISRSGYLPDFDNNDDDDDGMDQHGARRIMAVCY--PTERDEAS--FGVMVDENGAIVDYLRMVHFTKRTFGGGNNGLRKAESM-DLFKKFVQR-------RKPHAIGLNIEDMECTRLKRDLEEAVADLFSQNLIYKPIPVFLMDNEAAKVYMRSNVSLAENPDHPPTLRQALSLARLLLDPIPEYAHLWNIDEDIFCLSLHPLQRDIDQEQLALVLSHELVNKVNEEGVDINKCAEFPHYTNMLQFTCGLGPRKATDLLKSIKANDNLIESRSKLVVGCKLGPKVFMNCAGFIKIDTIKVSEKTDAYVEVLDGSRVHPETYEWARKMAVDALEVDDSADPTAALQEIMESPDRLRDLDLDAFADELSRQGFGEKKSTLYDISSELSARYKDLRQPFQEPTGELLYDLLARSGKEIRE-GAKVLGTVQSVQYRKVDKDAADSMLPDVGED-GLFTCPCCKSFTSSAPGGIQEHMLGDSRQGGCPGTPVGIRVRFDNGMTGFCPNKNISSSHVDNPLTRVKINQPYYFKVLKLDKERFSLFLSCKSSDLKEDDLS---QRDQYWDEHQYQADLELMKSESKKKTEANTRVKRVIAHPNFHNVSYEAATKMLDEMDWSECIIRPSANKDSGLSVTWKICDRVYHNFFVKESAKDQVFSIGRQLSVGGEDFEDLDELIARFVQPMIQISHEITTHKYFFPNGTCEETEAVEQFVREKKRELGRSPYVFSASYRQPCQFCISYMFDNTERIRHEYFKIVPHGVRFRHQNFDTLDRMMAWFKRHFHEPP 1489          
BLAST of Transcription elongation factor spt6 vs. Ensembl Fly
Match: Spt6 (gene:FBgn0028982 transcript:FBtr0070896)

HSP 1 Score: 815.068 bits (2104), Expect = 0.000e+0
Identity = 509/1434 (35.50%), Postives = 794/1434 (55.37%), Query Frame = 1
Query:  478 DEEDEDDLRNFIVDANDSRSARKSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAVD--------VMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSMKKDE-------------TIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-------------KNINEV----------------NLEEPEVIEPNN-------LNKRLK-PSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINS-FTDDYSFLLIENGSQDHLITYKIYLPERAYSN-----ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDE-KNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKK-KDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD-NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKK--IDGD--NKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTP--MIGSTPTFGT----------PASRTPKASGG 4527
            D + E D  +FIVD N    A K  K+  I  D   QE Q++FGVD +  +       D ED SE +       +   TR +K+           + D+++P+EL RG +T  D +I+K DIPER QLR VP  P+   S        E++ EA+W+Y+  F   ++ + E             T++ IK+ L  I+ Q  E PFIA YRKEY++        L ++DLW +Y+ D  W ++N R++    +FEK+ +F  ++     D +  + + ++  L+           E +   +SME LKD   YF + Y             K I E                 +  E  V+           ++ +LK  S S+P+ V RKA +  F ++FGL  +Q+ E++RD Y  +E+    + P + A++++   F T D V+   + ++A Q++ EP +RK +R  ++    I + PTK G   IDE  P+Y MKY+  KP++  F D +  L++    +   IT+       A +N      +++ K+ +  D++    Q+WN+ RA  ++ AL  ++IP + KE+R  L ++AQ+ +      K+++ + V P+      D  Y+E     G R+LG+ Y    + +    AF A+    GD+ D  +L  I+      N    A+K  D+ +L+D I   +P+ V I  +S  A ++Q +I +++  LE      P  VE++DNE+A IY NSK  +SDF  YP LL+QA S+AR++QDPL E++QL + D +++ LR HPLQE + ++ LL ++ +QF+N  ++VG+DIN  + +   + LLQ++CGLGPRK   L+K +K+S + L +R  ++  C +GP+V +NC GFIKI+     D  +   E+LD +R+HPE+YE A+KMAIDA+E+DD + N A ALEEI+ESPE+L+DLDL+AFA EL+R   GSK ITL DIR EL+  ++D R  +     +E F++LTKET ++  VG  V A V    +++PQ DQLD A+P R ++   W CPFC +D FPEL+ VW HFD   CPG+  GV   L N +  F+  KN+SD  V N  +R+ +  M+  R++K+D +R  +E S+++ DL+D+N  WR ++D YYD   E QD + + +   +  K   Y  RVI HP F N +Y +   M    + GE  +RPSSK  +HLT +WKV +++ +HIDV EE K+NDFSLG +L I  E+FEDLDEIIA ++ PMA  ARE+  YKYYK   + GD   ++++  ++R EK  +P KI YF    R  PG+F++ Y+P +K R +   + P+G+ FR   F  + +L+ +FK H+ D  +T  +    + TP  ++   PT  +          P S T   +GG
Sbjct:  168 DVDTESDADDFIVDDNGRPIAEKKKKRRPIFTDASLQEGQDIFGVDFDYDDFSKYEEDDYEDDSEGDEYDEDLGVGDDTRVKKKKALKKKVVKKTIFDIYEPSELKRGHFTDMDNEIRKTDIPERMQLREVPVTPVPEGS-------DELDLEAEWIYKYAFCKHTVSEQEKPESREKMRKPPTTVNKIKQTLEFIRNQQLEVPFIAFYRKEYVKP------ELNIDDLWKVYYYDGIWCQLNERKRKLKVLFEKMRQF--QLDTLCADTDQPVPDDVRLILDSD--------FERLADVQSMEELKDVHMYFLLNYSHELPRMQAEQRRKAIQERREAKARRQAAAAENGDDAAEAIVVPEPEDDDDPELIDYQLKQASNSSPYAVFRKAGICGFAKHFGLTPEQYAENLRDNYQRNEITQESIGPTELAKQYLSPRFMTTDEVIHAAKYVVARQLAQEPLLRKTMREVYFDRARINIRPTKNGMVLIDENSPVYSMKYVAKKPVSDLFGDQFIKLMMAEEEKLLEITFLEEFEGNACANGTPGDYVEESKALYQLDQFAKHVQEWNKLRAECVQLALQKWVIPDLIKELRSTLHEEAQQFVLRSCTGKLYKWLKVAPYKPQLPPDFGYEEWSTLRGIRVLGLAY----DPDHSVAAFCAVTTVEGDISDYLRLPNILKRKNSYNLEEKAQKLADLRKLSDFIKMKKPHIVVIGAESRDAQNIQADIKEILHELETSEQFPPIEVEIIDNELAKIYANSKKGESDFKEYPPLLKQAASLARKMQDPLVEYSQLCDADDEILCLRYHPLQERVPREQLLEQLSLQFINRTSEVGLDINLMVQNSRTINLLQYICGLGPRKGQALLKLLKQSNQRLENRTQLVTVCHLGPRVFINCSGFIKIDTSSLGDSTEAYVEVLDGSRVHPETYEWARKMAIDAMEYDDEETNPAGALEEILESPERLKDLDLDAFAVELERQGFGSKSITLYDIRNELSCLYKDYRTPYTKPSAEELFDMLTKETPDSFYVGKCVTAMVTGFTYRRPQGDQLDSANPVRLDSNESWQCPFCHKDDFPELSEVWNHFDANACPGQPSGVRVRLENGLPGFIHIKNLSDRQVRNPEERVRVSQMIHVRIIKIDIDRFSVECSSRTADLKDVNNEWRPRRDNYYDYVTEEQDNRKVSDAKARALKRKIYARRVIAHPSFFNKSYAEVVAMLAEADQGEVALRPSSKSKDHLTATWKVADDIFQHIDVREEGKENDFSLGRSLWIGTEEFEDLDEIIARHIMPMALAARELIQYKYYKPNMVTGDENERDVMEKLLREEKANDPKKIHYFFTASRAMPGKFLLSYLPKTKVRHEYVTVMPEGYRFRGQIFDTVNSLLRWFKEHWLDPTATPASASASNLTPLHLMRPPPTISSSSQTSLGPQAPYSVTGSVTGG 1574          
BLAST of Transcription elongation factor spt6 vs. Ensembl Fly
Match: Spt6 (gene:FBgn0028982 transcript:FBtr0340027)

HSP 1 Score: 815.068 bits (2104), Expect = 0.000e+0
Identity = 509/1434 (35.50%), Postives = 794/1434 (55.37%), Query Frame = 1
Query:  478 DEEDEDDLRNFIVDANDSRSARKSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAVD--------VMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSMKKDE-------------TIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-------------KNINEV----------------NLEEPEVIEPNN-------LNKRLK-PSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINS-FTDDYSFLLIENGSQDHLITYKIYLPERAYSN-----ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDE-KNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKK-KDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD-NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKK--IDGD--NKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTP--MIGSTPTFGT----------PASRTPKASGG 4527
            D + E D  +FIVD N    A K  K+  I  D   QE Q++FGVD +  +       D ED SE +       +   TR +K+           + D+++P+EL RG +T  D +I+K DIPER QLR VP  P+   S        E++ EA+W+Y+  F   ++ + E             T++ IK+ L  I+ Q  E PFIA YRKEY++        L ++DLW +Y+ D  W ++N R++    +FEK+ +F  ++     D +  + + ++  L+           E +   +SME LKD   YF + Y             K I E                 +  E  V+           ++ +LK  S S+P+ V RKA +  F ++FGL  +Q+ E++RD Y  +E+    + P + A++++   F T D V+   + ++A Q++ EP +RK +R  ++    I + PTK G   IDE  P+Y MKY+  KP++  F D +  L++    +   IT+       A +N      +++ K+ +  D++    Q+WN+ RA  ++ AL  ++IP + KE+R  L ++AQ+ +      K+++ + V P+      D  Y+E     G R+LG+ Y    + +    AF A+    GD+ D  +L  I+      N    A+K  D+ +L+D I   +P+ V I  +S  A ++Q +I +++  LE      P  VE++DNE+A IY NSK  +SDF  YP LL+QA S+AR++QDPL E++QL + D +++ LR HPLQE + ++ LL ++ +QF+N  ++VG+DIN  + +   + LLQ++CGLGPRK   L+K +K+S + L +R  ++  C +GP+V +NC GFIKI+     D  +   E+LD +R+HPE+YE A+KMAIDA+E+DD + N A ALEEI+ESPE+L+DLDL+AFA EL+R   GSK ITL DIR EL+  ++D R  +     +E F++LTKET ++  VG  V A V    +++PQ DQLD A+P R ++   W CPFC +D FPEL+ VW HFD   CPG+  GV   L N +  F+  KN+SD  V N  +R+ +  M+  R++K+D +R  +E S+++ DL+D+N  WR ++D YYD   E QD + + +   +  K   Y  RVI HP F N +Y +   M    + GE  +RPSSK  +HLT +WKV +++ +HIDV EE K+NDFSLG +L I  E+FEDLDEIIA ++ PMA  ARE+  YKYYK   + GD   ++++  ++R EK  +P KI YF    R  PG+F++ Y+P +K R +   + P+G+ FR   F  + +L+ +FK H+ D  +T  +    + TP  ++   PT  +          P S T   +GG
Sbjct:  168 DVDTESDADDFIVDDNGRPIAEKKKKRRPIFTDASLQEGQDIFGVDFDYDDFSKYEEDDYEDDSEGDEYDEDLGVGDDTRVKKKKALKKKVVKKTIFDIYEPSELKRGHFTDMDNEIRKTDIPERMQLREVPVTPVPEGS-------DELDLEAEWIYKYAFCKHTVSEQEKPESREKMRKPPTTVNKIKQTLEFIRNQQLEVPFIAFYRKEYVKP------ELNIDDLWKVYYYDGIWCQLNERKRKLKVLFEKMRQF--QLDTLCADTDQPVPDDVRLILDSD--------FERLADVQSMEELKDVHMYFLLNYSHELPRMQAEQRRKAIQERREAKARRQAAAAENGDDAAEAIVVPEPEDDDDPELIDYQLKQASNSSPYAVFRKAGICGFAKHFGLTPEQYAENLRDNYQRNEITQESIGPTELAKQYLSPRFMTTDEVIHAAKYVVARQLAQEPLLRKTMREVYFDRARINIRPTKNGMVLIDENSPVYSMKYVAKKPVSDLFGDQFIKLMMAEEEKLLEITFLEEFEGNACANGTPGDYVEESKALYQLDQFAKHVQEWNKLRAECVQLALQKWVIPDLIKELRSTLHEEAQQFVLRSCTGKLYKWLKVAPYKPQLPPDFGYEEWSTLRGIRVLGLAY----DPDHSVAAFCAVTTVEGDISDYLRLPNILKRKNSYNLEEKAQKLADLRKLSDFIKMKKPHIVVIGAESRDAQNIQADIKEILHELETSEQFPPIEVEIIDNELAKIYANSKKGESDFKEYPPLLKQAASLARKMQDPLVEYSQLCDADDEILCLRYHPLQERVPREQLLEQLSLQFINRTSEVGLDINLMVQNSRTINLLQYICGLGPRKGQALLKLLKQSNQRLENRTQLVTVCHLGPRVFINCSGFIKIDTSSLGDSTEAYVEVLDGSRVHPETYEWARKMAIDAMEYDDEETNPAGALEEILESPERLKDLDLDAFAVELERQGFGSKSITLYDIRNELSCLYKDYRTPYTKPSAEELFDMLTKETPDSFYVGKCVTAMVTGFTYRRPQGDQLDSANPVRLDSNESWQCPFCHKDDFPELSEVWNHFDANACPGQPSGVRVRLENGLPGFIHIKNLSDRQVRNPEERVRVSQMIHVRIIKIDIDRFSVECSSRTADLKDVNNEWRPRRDNYYDYVTEEQDNRKVSDAKARALKRKIYARRVIAHPSFFNKSYAEVVAMLAEADQGEVALRPSSKSKDHLTATWKVADDIFQHIDVREEGKENDFSLGRSLWIGTEEFEDLDEIIARHIMPMALAARELIQYKYYKPNMVTGDENERDVMEKLLREEKANDPKKIHYFFTASRAMPGKFLLSYLPKTKVRHEYVTVMPEGYRFRGQIFDTVNSLLRWFKEHWLDPTATPASASASNLTPLHLMRPPPTISSSSQTSLGPQAPYSVTGSVTGG 1574          
BLAST of Transcription elongation factor spt6 vs. Ensembl Zebrafish
Match: supt6h (SPT6 homolog, histone chaperone and transcription elongation factor [Source:NCBI gene;Acc:337866])

HSP 1 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 518/1369 (37.84%), Postives = 812/1369 (59.31%), Query Frame = 1
Query:  538 ARKSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAVDVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSAN----------FKNDLKEIEEEAKWMYQELFASKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-----KNINEVNLEEPEVIEPNNLNKRL---------------------KPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYL---PERAYSN--ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPF---IQSTEKDDNYDEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSD----AKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPM-IGSTPT 4485
             +K  KK   + D   QEAQE+FG D +  E  T      E+  ED+ D + D    +T++      + ++++P+EL+    T +D +I+  D+PERFQLR++P +P + +             F      ++E   ++ +    + S K   TI  IKE LN ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++ +R++N   +F+++  +  + +  S D +  L++  +  L+ +++       E +K  +S++ L D   +F +YY     K  N     + ++ +   +++                       + S+ + +++ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A++++CS F T + VL+G R M+A QI+ EP VR  LR  F     I + PTKKGK ++DE H  Y  KYL +KP+   + D  FL +    ++ L+   I +     + Y +    D+ K F++RDE++   Q+WN+QR L I+++L  FL P + KE++++L+ +A++++    C K++  + V P+    Q  E DD  DE    G R+LG+ +  A+ R+  +  F ++I+G G+V+D  +L    Y L+R+N   +     K++DVE L   +L  +P+ VA++ ++  A  +  +I + IS LE+   L    VELVDNE+A++Y NSK S++DF +YP LLRQA+S+AR++QDPL EFAQ+ + D D++ L+LHPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    +L+Q++CGLGPRK  +L+K +K++   L +R  ++  C +GPKV +NC GFIKI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G+K ITL DIR EL+ R++D R  +R  + +E F +LTKET ET  +G L+   V ++AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK +SD  V +  +R++  M V  R++K+D E+  ++++ +++DL D N  W+  KD YYD  AE  D +  EE+ +KQ++   Y+ RVI HP F NI +   EKM   ++ G+ +IRPSSKG NHLTV+WKV + + +H+DV EE K+N FSLG+TL I  E+FEDLDEI A YVQPMA FAR++  +KY+ + +G ++  + +++   K   P  IPY+I+  R  PG+F++ Y P  K R +   ITP GF +R+  F  +  L  +FK H+ D     T   + +RTP  + +TP 
Sbjct:  190 TKKKGKKFSGYTDAALQEAQEIFGGDFDFAEFDTEAYDHAEEEEEDQDDESWDRPKKQTKRRVSRRSIFEIYEPSELESSHMTDQDNEIRSTDMPERFQLRAIPVKPAEDDELEEEAEWIYRNAFSTPTISMQESTDYLDRGTTTNFSRKGPSTIAKIKEALNFMRNQHFEVPFIAFYRKEYVEP------ELNINDLWKVWQWDEKWTQLKTRKQNLTRLFQRMQSY--QFEQISADPDKPLADSTRP-LDTADM-------ERLKDVQSIDELGDVYNHFLLYYGRDIPKMQNAAKGGKKKLKKIKEVSEEDGEEAEVEEEEEEEEQKGPDLKQASRRDMYSICQSAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFNTPEAVLEGARYMVAMQIAREPLVRHVLRQTFQERAKINIKPTKKGKKDVDEAHFAYSFKYLKNKPVKELSGD-QFLKMCLAEEEGLLAIDICIDLVGVKGYGDQTYFDEIKQFYYRDEFSHQVQEWNKQRTLAIERSLQQFLYPQMAKELKNKLIAEAKDNIVKSCCKKLYNWLKVAPYRPDQQVEEDDDLMDESQGKGIRVLGVAF--ASGRD--TPVFCSLINGEGEVVDFLRLP---YFLKRRNAWREDEREKKQQDVENLKKFLLSKKPHVVAVSGENRDAHMVMEDIKRTISELEQNSSLPVVGVELVDNELAVLYMNSKKSEADFRDYPPLLRQAVSVARKIQDPLVEFAQVCSTDDDILCLKLHPLQEHVVKEELLSALYCEFINRVNEVGVDVNRAIAHPYTQSLVQYICGLGPRKGSHLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAGFIKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGNKGITLYDIRAELSCRYKDLRAPYRPPNTEEVFNMLTKETPETFYIGKLITCVVTNIAHRRPQGESYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVRTRLDNAVMGFIPTKFLSDKVVKHPEERVKPGMTVHCRIMKIDIEKFNVDLTCRTSDLSDKNNEWKLPKDTYYDFDAETDDVKQEEEQKKKQQRTT-YIKRVIAHPSFHNINFKQAEKMMESMDQGDVVIRPSSKGENHLTVTWKVADGIYQHVDVREEGKENAFSLGHTLWINTEEFEDLDEITARYVQPMAAFARDLLGHKYFHECNGGDRKKMEELLVRTKKEKPTFIPYYISACRDLPGKFLLGYQPRGKPRIEYVTITPDGFRYRSQIFPTVNGLFRWFKDHYQDPVPGVTPASSRTRTPASVNATPA 1531          
BLAST of Transcription elongation factor spt6 vs. Ensembl Xenopus
Match: SUPT6H (SPT6 homolog, histone chaperone [Source:NCBI gene;Acc:780122])

HSP 1 Score: 881.708 bits (2277), Expect = 0.000e+0
Identity = 542/1383 (39.19%), Postives = 817/1383 (59.07%), Query Frame = 1
Query:  544 KSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV------DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSM--------------------KKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY------------------KNI---NEVNLEEPEVIEPNNLNKRLK-PSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPERAYSNILDKY----KSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINV---QPFIQSTEKDDNYDEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSD----AKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPMIGSTPTFGTPAS 4503
            K  KK   + D   QEAQE+FGVD +  E    +  DEE    D  D   D+ T R R +K A        + ++++P+EL+    T +D +I+  D+PERFQLR++  +           +  E+EEEA+W+Y+  FA+ ++                    K   TI  I+E LN ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++  R++N + +FEK+  +  + +  S D +  L++ ++A   +         +E +K  +SM+ LKD   +F +YY                  K I    E   +  E  E ++    LK  S+ + +++ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A+++ CS F T + VL+G R M+A QI+ EP VR+ LR  F     + + PTKKGK EIDE H  Y  KYL +KP+    DD  FL +    ++ L+T +I       S IL+ Y    K F++RDE++   Q+WN QR L I++AL  FL P + KE++++L+ +A++ +      K++  + V   +P  Q  E DD  +E    G R+LG+ Y+ A +       F ++I+G G+V D  +L    Y  +RKN   +     K +D+E L   ++  +P+ VAIA+++  A  +  ++ +++  LE+   ++   VE+VDNE+A++Y NSK S++DF +YP +LRQA+SIARR+QDPL EFAQ+ + D D++ L+LHPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    AL+Q+VCGLGPRK  +L+K +K++   L +R  ++  C +GPKV +NC GF+KI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G KHITL DIR EL+ R++D R  +RS +P+E F +LT+ET ET  +G L+   V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK ISD  V    +R+++ M V  R++K++ E+  ++++ +++DL D N  W+  KD YYD   E+ D +  EE  +KQ++   Y+ RVI HP F NI +   EKM   ++ G+ IIRPSSKG NHLTV+WKV E + +H+DV EE K+N FSLG+TL I  E+FEDLDEIIA +VQPMA+FAR++ ++KY++  +   K  L +++   K   P  IPY+I+  ++ PG+F++ Y P +K R +   +TP+GF +R   F  +  L  +FK H+ D P    TP + SRT    S     TPA+
Sbjct:  192 KWRKKLPGYTDAALQEAQEIFGVDFDYNEFEKYDEDDEEMEEYDYEDDEGDAAT-RVRPKKTAKKRVSRRSIFEIYEPSELESSHLTDQDNEIRTTDMPERFQLRTISVK---------SAEDDELEEEAEWIYRNAFATPTISLQETNDYLERGQVGSNFNRKGPSTIQKIREALNFMRNQHFEVPFIAFYRKEYVEP------ELNINDLWRVWQWDEKWTQLKLRKQNLIRLFEKMQAY--QYEQISSDPDKPLADGIRALDTVD--------MERLKDVKSMDELKDVYNHFLLYYGRDIPKMQNAAKSSQKKMKRIPEEGEEGADAGEQEEESSKGPELKQASRRDMYSICQIAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYTCSQFTTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKVNIIPTKKGKKEIDEAHFAYAFKYLKNKPVKELRDDL-FLKMCIAEEEQLLTIEIS------SIILETYFEEIKQFYYRDEFSHQVQEWNRQRTLAIERALKQFLYPQMAKELKNKLVLEAKDFVIKSCSRKLYNWLKVASYRPDTQVEEDDDFMEENQGKGIRVLGMAYSSARDHP----VFCSLINGEGEVTDFLRLP---YFTKRKNAWREDERERKARDMETLKKFLISKKPHVVAIASENRDAQMMVEDVKRVVQELEQGQQMSAIGVEMVDNELAVLYMNSKKSETDFRDYPPVLRQAVSIARRIQDPLIEFAQVCSTDDDILCLKLHPLQEHVVKEELLNSLYCEFINRVNEVGVDVNRAIAHPYTQALIQYVCGLGPRKGAHLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAGFVKIDTNSLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTTYRSPNPEEVFNMLTRETPETFYIGKLITCNVTGIAHRRPQGETYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNSVTGFIPTKFISDKAVKRPEERVKVGMTVHCRIMKINIEKFSVDLTCRTSDLMDKNNEWKLPKDTYYDFDTESADHKQEEEFKKKQQRTT-YIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVCEGIYQHVDVREEGKENAFSLGSTLWINNEEFEDLDEIIARFVQPMASFARDLINHKYFQDCNNGEKKKLEELLIKTKKEKPTFIPYYISACKELPGKFLLGYQPRAKPRVEYVTVTPEGFRYRGQIFPTVNGLFRWFKDHYQD-PVPGITPSSSSRTRTPASVN--ATPAN 1528          
BLAST of Transcription elongation factor spt6 vs. Ensembl Xenopus
Match: SUPT6H (SPT6 homolog, histone chaperone [Source:NCBI gene;Acc:780122])

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 539/1384 (38.95%), Postives = 818/1384 (59.10%), Query Frame = 1
Query:  544 KSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV------DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSM--------------------KKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY------------------KNI---NEVNLEEPEVIEPNNLNKRLK-PSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPER---AYSN--ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINV---QPFIQSTEKDDNYDEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSD----AKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPMIGSTPTFGTPAS 4503
            K  KK   + D   QEAQE+FGVD +  E    +  DEE    D  D   D+ T R R +K A        + ++++P+EL+    T +D +I+  D+PERFQLR++  +           +  E+EEEA+W+Y+  FA+ ++                    K   TI  I+E LN ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++  R++N + +FEK+  +  + +  S D +  L++ ++A   +         +E +K  +SM+ LKD   +F +YY                  K I    E   +  E  E ++    LK  S+ + +++ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A+++ CS F T + VL+G R M+A QI+ EP VR+ LR  F     + + PTKKGK EIDE H  Y  KYL +KP+    DD  FL +    ++ L+T +I +  +    Y +    ++ K F++RDE++   Q+WN QR L I++AL  FL P + KE++++L+ +A++ +      K++  + V   +P  Q  E DD  +E    G R+LG+ Y+ A +       F ++I+G G+V D  +L    Y  +RKN   +     K +D+E L   ++  +P+ VAIA+++  A  +  ++ +++  LE+   ++   VE+VDNE+A++Y NSK S++DF +YP +LRQA+SIARR+QDPL EFAQ+ + D D++ L+LHPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    AL+Q+VCGLGPRK  +L+K +K++   L +R  ++  C +GPKV +NC GF+KI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G KHITL DIR EL+ R++D R  +RS +P+E F +LT+ET ET  +G L+   V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK ISD  V    +R+++ M V  R++K++ E+  ++++ +++DL D N  W+  KD YYD   E+ D +  EE  +KQ++   Y+ RVI HP F NI +   EKM   ++ G+ IIRPSSKG NHLTV+WKV E + +H+DV EE K+N FSLG+TL I  E+FEDLDEIIA +VQPMA+FAR++ ++KY++  +   K  L +++   K   P  IPY+I+  ++ PG+F++ Y P +K R +   +TP+GF +R   F  +  L  +FK H+ D P    TP + SRT    S     TPA+
Sbjct:  192 KWRKKLPGYTDAALQEAQEIFGVDFDYNEFEKYDEDDEEMEEYDYEDDEGDAAT-RVRPKKTAKKRVSRRSIFEIYEPSELESSHLTDQDNEIRTTDMPERFQLRTISVK---------SAEDDELEEEAEWIYRNAFATPTISLQETNDYLERGQVGSNFNRKGPSTIQKIREALNFMRNQHFEVPFIAFYRKEYVEP------ELNINDLWRVWQWDEKWTQLKLRKQNLIRLFEKMQAY--QYEQISSDPDKPLADGIRALDTVD--------MERLKDVKSMDELKDVYNHFLLYYGRDIPKMQNAAKSSQKKMKRIPEEGEEGADAGEQEEESSKGPELKQASRRDMYSICQIAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYTCSQFTTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKVNIIPTKKGKKEIDEAHFAYAFKYLKNKPVKELRDDL-FLKMCIAEEEQLLTIEICIDMKDVEGYGDQTYFEEIKQFYYRDEFSHQVQEWNRQRTLAIERALKQFLYPQMAKELKNKLVLEAKDFVIKSCSRKLYNWLKVASYRPDTQVEEDDDFMEENQGKGIRVLGMAYSSARDHP----VFCSLINGEGEVTDFLRLP---YFTKRKNAWREDERERKARDMETLKKFLISKKPHVVAIASENRDAQMMVEDVKRVVQELEQGQQMSAIGVEMVDNELAVLYMNSKKSETDFRDYPPVLRQAVSIARRIQDPLIEFAQVCSTDDDILCLKLHPLQEHVVKEELLNSLYCEFINRVNEVGVDVNRAIAHPYTQALIQYVCGLGPRKGAHLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAGFVKIDTNSLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTTYRSPNPEEVFNMLTRETPETFYIGKLITCNVTGIAHRRPQGETYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNSVTGFIPTKFISDKAVKRPEERVKVGMTVHCRIMKINIEKFSVDLTCRTSDLMDKNNEWKLPKDTYYDFDTESADHKQEEEFKKKQQRTT-YIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVCEGIYQHVDVREEGKENAFSLGSTLWINNEEFEDLDEIIARFVQPMASFARDLINHKYFQDCNNGEKKKLEELLIKTKKEKPTFIPYYISACKELPGKFLLGYQPRAKPRVEYVTVTPEGFRYRGQIFPTVNGLFRWFKDHYQD-PVPGITPSSSSRTRTPASVN--ATPAN 1535          
BLAST of Transcription elongation factor spt6 vs. Ensembl Xenopus
Match: SUPT6H (SPT6 homolog, histone chaperone [Source:NCBI gene;Acc:780122])

HSP 1 Score: 880.552 bits (2274), Expect = 0.000e+0
Identity = 540/1385 (38.99%), Postives = 820/1385 (59.21%), Query Frame = 1
Query:  544 KSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV------DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSM--------------------KKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY------------------KNINEVNLEEPEVI----EPNNLNKRLK-PSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPER---AYSN--ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINV---QPFIQSTEKDDNYDEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSD----AKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPMIGSTPTFGTPAS 4503
            K  KK   + D   QEAQE+FGVD +  E    +  DEE    D  D   D+ T R R +K A        + ++++P+EL+    T +D +I+  D+PERFQLR++  +           +  E+EEEA+W+Y+  FA+ ++                    K   TI  I+E LN ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++  R++N + +FEK+  +  + +  S D +  L++ ++A   +         +E +K  +SM+ LKD   +F +YY                  K I E   E+ +V     E ++    LK  S+ + +++ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A+++ CS F T + VL+G R M+A QI+ EP VR+ LR  F     + + PTKKGK EIDE H  Y  KYL +KP+    DD  FL +    ++ L+T +I +  +    Y +    ++ K F++RDE++   Q+WN QR L I++AL  FL P + KE++++L+ +A++ +      K++  + V   +P  Q  E DD  +E    G R+LG+ Y+ A +       F ++I+G G+V D  +L    Y  +RKN   +     K +D+E L   ++  +P+ VAIA+++  A  +  ++ +++  LE+   ++   VE+VDNE+A++Y NSK S++DF +YP +LRQA+SIARR+QDPL EFAQ+ + D D++ L+LHPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    AL+Q+VCGLGPRK  +L+K +K++   L +R  ++  C +GPKV +NC GF+KI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G KHITL DIR EL+ R++D R  +RS +P+E F +LT+ET ET  +G L+   V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK ISD  V    +R+++ M V  R++K++ E+  ++++ +++DL D N  W+  KD YYD   E+ D +  EE  +KQ++   Y+ RVI HP F NI +   EKM   ++ G+ IIRPSSKG NHLTV+WKV E + +H+DV EE K+N FSLG+TL I  E+FEDLDEIIA +VQPMA+FAR++ ++KY++  +   K  L +++   K   P  IPY+I+  ++ PG+F++ Y P +K R +   +TP+GF +R   F  +  L  +FK H+ D P    TP + SRT    S     TPA+
Sbjct:   10 KWRKKLPGYTDAALQEAQEIFGVDFDYNEFEKYDEDDEEMEEYDYEDDEGDAAT-RVRPKKTAKKRVSRRSIFEIYEPSELESSHLTDQDNEIRTTDMPERFQLRTISVK---------SAEDDELEEEAEWIYRNAFATPTISLQETNDYLERGQVGSNFNRKGPSTIQKIREALNFMRNQHFEVPFIAFYRKEYVEP------ELNINDLWRVWQWDEKWTQLKLRKQNLIRLFEKMQAY--QYEQISSDPDKPLADGIRALDTVD--------MERLKDVKSMDELKDVYNHFLLYYGRDIPKMQNAAKSSQKKMKRIPEEGEEDNKVYREQEEESSKGPELKQASRRDMYSICQIAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYTCSQFTTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKVNIIPTKKGKKEIDEAHFAYAFKYLKNKPVKELRDDL-FLKMCIAEEEQLLTIEICIDMKDVEGYGDQTYFEEIKQFYYRDEFSHQVQEWNRQRTLAIERALKQFLYPQMAKELKNKLVLEAKDFVIKSCSRKLYNWLKVASYRPDTQVEEDDDFMEENQGKGIRVLGMAYSSARDHP----VFCSLINGEGEVTDFLRLP---YFTKRKNAWREDERERKARDMETLKKFLISKKPHVVAIASENRDAQMMVEDVKRVVQELEQGQQMSAIGVEMVDNELAVLYMNSKKSETDFRDYPPVLRQAVSIARRIQDPLIEFAQVCSTDDDILCLKLHPLQEHVVKEELLNSLYCEFINRVNEVGVDVNRAIAHPYTQALIQYVCGLGPRKGAHLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAGFVKIDTNSLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTTYRSPNPEEVFNMLTRETPETFYIGKLITCNVTGIAHRRPQGETYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNSVTGFIPTKFISDKAVKRPEERVKVGMTVHCRIMKINIEKFSVDLTCRTSDLMDKNNEWKLPKDTYYDFDTESADHKQEEEFKKKQQRTT-YIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVCEGIYQHVDVREEGKENAFSLGSTLWINNEEFEDLDEIIARFVQPMASFARDLINHKYFQDCNNGEKKKLEELLIKTKKEKPTFIPYYISACKELPGKFLLGYQPRAKPRVEYVTVTPEGFRYRGQIFPTVNGLFRWFKDHYQD-PVPGITPSSSSRTRTPASVN--ATPAN 1354          
BLAST of Transcription elongation factor spt6 vs. Ensembl Xenopus
Match: SUPT6H (SPT6 homolog, histone chaperone [Source:NCBI gene;Acc:780122])

HSP 1 Score: 834.328 bits (2154), Expect = 0.000e+0
Identity = 526/1380 (38.12%), Postives = 793/1380 (57.46%), Query Frame = 1
Query:  544 KSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV------DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSM--------------------KKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY------------------KNI---NEVNLEEPEVIEPNNLNKRLK-PSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPER---AYSN--ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDEKNFYGRILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSD----AKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPMIGSTPTFGTPAS 4503
            K  KK   + D   QEAQE+FGVD +  E    +  DEE    D  D   D+ T R R +K A        + ++++P+EL+    T +D +I+  D+PERFQLR++  +           +  E+EEEA+W+Y+  FA+ ++                    K   TI  I+E LN ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++  R++N + +FEK+  +  + +  S D +  L++ ++A   +         +E +K  +SM+ LKD   +F +YY                  K I    E   +  E  E ++    LK  S+ + +++ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A+++ CS F T + VL+G R M+A QI+ EP VR+ LR  F     + + PTKKGK EIDE H  Y  KYL +KP+    DD  FL +    ++ L+T +I +  +    Y +    ++ K F++RDE++   Q+WN QR L I++AL  FL P + K+ +  +      S++  + D I +    +  + S E             I+G  Y                      V D  +L    Y  +RKN   +     K +D+E L   ++  +P+ VAIA+++  A  +  ++ +++  LE+   ++   VE+VDNE+A++Y NSK S++DF +YP +LRQA+SIARR+QDPL EFAQ+ + D D++ L+LHPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    AL+Q+VCGLGPRK  +L+K +K++   L +R  ++  C +GPKV +NC GF+KI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G KHITL DIR EL+ R++D R  +RS +P+E F +LT+ET ET  +G L+   V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK ISD  V    +R+++ M V  R++K++ E+  ++++ +++DL D N  W+  KD YYD   E+ D +  EE  +KQ++   Y+ RVI HP F NI +   EKM   ++ G+ IIRPSSKG NHLTV+WKV E + +H+DV EE K+N FSLG+TL I  E+FEDLDEIIA +VQPMA+FAR++ ++KY++  +   K  L +++   K   P  IPY+I+  ++ PG+F++ Y P +K R +   +TP+GF +R   F  +  L  +FK H+ D P    TP + SRT    S     TPA+
Sbjct:  193 KWRKKLPGYTDAALQEAQEIFGVDFDYNEFEKYDEDDEEMEEYDYEDDEGDAAT-RVRPKKTAKKRVSRRSIFEIYEPSELESSHLTDQDNEIRTTDMPERFQLRTISVK---------SAEDDELEEEAEWIYRNAFATPTISLQETNDYLERGQVGSNFNRKGPSTIQKIREALNFMRNQHFEVPFIAFYRKEYVEP------ELNINDLWRVWQWDEKWTQLKLRKQNLIRLFEKMQAY--QYEQISSDPDKPLADGIRALDTVD--------MERLKDVKSMDELKDVYNHFLLYYGRDIPKMQNAAKSSQKKMKRIPEEGEEGADAGEQEEESSKGPELKQASRRDMYSICQIAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYTCSQFTTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKVNIIPTKKGKKEIDEAHFAYAFKYLKNKPVKELRDDL-FLKMCIAEEEQLLTIEICIDMKDVEGYGDQTYFEEIKQFYYRDEFSHQVQEWNRQRTLAIERALKQFLYPQMAKDSKLCICL----SISYHLVDIIIRIAGPEIILYSIES------------IVGKLYK------------------DFGVTDFLRLP---YFTKRKNAWREDERERKARDMETLKKFLISKKPHVVAIASENRDAQMMVEDVKRVVQELEQGQQMSAIGVEMVDNELAVLYMNSKKSETDFRDYPPVLRQAVSIARRIQDPLIEFAQVCSTDDDILCLKLHPLQEHVVKEELLNSLYCEFINRVNEVGVDVNRAIAHPYTQALIQYVCGLGPRKGAHLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAGFVKIDTNSLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTTYRSPNPEEVFNMLTRETPETFYIGKLITCNVTGIAHRRPQGETYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNSVTGFIPTKFISDKAVKRPEERVKVGMTVHCRIMKINIEKFSVDLTCRTSDLMDKNNEWKLPKDTYYDFDTESADHKQEEEFKKKQQRTT-YIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVCEGIYQHVDVREEGKENAFSLGSTLWINNEEFEDLDEIIARFVQPMASFARDLINHKYFQDCNNGEKKKLEELLIKTKKEKPTFIPYYISACKELPGKFLLGYQPRAKPRVEYVTVTPEGFRYRGQIFPTVNGLFRWFKDHYQD-PVPGITPSSSSRTRTPASVN--ATPAN 1502          
BLAST of Transcription elongation factor spt6 vs. Ensembl Xenopus
Match: SUPT6H (SPT6 homolog, histone chaperone [Source:NCBI gene;Acc:780122])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 318/686 (46.36%), Postives = 460/686 (67.06%), Query Frame = 1
Query: 2455 EITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPMIGSTPTFGTPAS 4503
            ++ +++  LE+   ++   VE+VDNE+A++Y NSK S++DF +YP +LRQA+SIARR+QDPL EFAQ+ + D D++ L+LHPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    AL+Q+VCGLGPRK  +L+K +K++   L +R  ++  C +GPKV +NC GF+KI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G KHITL DIR EL+ R++D R  +RS +P+E F +LT+ET ET  +G L+   V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK ISD  V    +R+++ M V  R++K++ E+  ++++ +++DL D N  W+  KD YYD   E+ D +  EE  +KQ++   Y+ RVI HP F NI +   EKM   ++ G+ IIRPSSKG NHLTV+WKV E + +H+DV EE K+N FSLG+TL I  E+FEDLDEIIA +VQPMA+FAR++ ++KY++  +   K  L +++   K   P  IPY+I+  ++ PG+F++ Y P +K R +   +TP+GF +R   F  +  L  +FK H+ D P    TP + SRT    S     TPA+
Sbjct:  808 DVKRVVQELEQGQQMSAIGVEMVDNELAVLYMNSKKSETDFRDYPPVLRQAVSIARRIQDPLIEFAQVCSTDDDILCLKLHPLQEHVVKEELLNSLYCEFINRVNEVGVDVNRAIAHPYTQALIQYVCGLGPRKGAHLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAGFVKIDTNSLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTTYRSPNPEEVFNMLTRETPETFYIGKLITCNVTGIAHRRPQGETYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNSVTGFIPTKFISDKAVKRPEERVKVGMTVHCRIMKINIEKFSVDLTCRTSDLMDKNNEWKLPKDTYYDFDTESADHKQEEEFKKKQQRTT-YIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVCEGIYQHVDVREEGKENAFSLGSTLWINNEEFEDLDEIIARFVQPMASFARDLINHKYFQDCNNGEKKKLEELLIKTKKEKPTFIPYYISACKELPGKFLLGYQPRAKPRVEYVTVTPEGFRYRGQIFPTVNGLFRWFKDHYQD-PVPGITPSSSSRTRTPASVN--ATPAN 1487          

HSP 2 Score: 252.292 bits (643), Expect = 5.779e-67
Identity = 200/618 (32.36%), Postives = 319/618 (51.62%), Query Frame = 1
Query:  544 KSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV------DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSM--------------------KKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY------------------KNI---NEVNLEEPEVIEPNNLNKRLK-PSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPER---AYSN--ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINV---QPFIQSTEKDDNYDEKNFYG-RILGITYTIA 2226
            K  KK   + D   QEAQE+FGVD +  E    +  DEE    D  D   D+ T R R +K A        + ++++P+EL+    T +D +I+  D+PERFQLR++  +           +  E+EEEA+W+Y+  FA+ ++                    K   TI  I+E LN ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++  R++N + +FEK+  +  + +  S D +  L++ ++A   +         +E +K  +SM+ LKD   +F +YY                  K I    E   +  E  E ++    LK  S+ + +++ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A+++ CS F T + VL+G R M+A QI+ EP VR+ LR  F     + + PTKKGK EIDE H  Y  KYL +KP+    DD  FL +    ++ L+T +I +  +    Y +    ++ K F++RDE++   Q+WN QR L I++AL  FL P + KE++++L+ +A++ +      K++  + V   +P  Q  E DD  +E    G R+LG+ Y+ A
Sbjct:  209 KWRKKLPGYTDAALQEAQEIFGVDFDYNEFEKYDEDDEEMEEYDYEDDEGDAAT-RVRPKKTAKKRVSRRSIFEIYEPSELESSHLTDQDNEIRTTDMPERFQLRTISVK---------SAEDDELEEEAEWIYRNAFATPTISLQETNDYLERGQVGSNFNRKGPSTIQKIREALNFMRNQHFEVPFIAFYRKEYVEP------ELNINDLWRVWQWDEKWTQLKLRKQNLIRLFEKMQAY--QYEQISSDPDKPLADGIRALDTVD--------MERLKDVKSMDELKDVYNHFLLYYGRDIPKMQNAAKSSQKKMKRIPEEGEEGADAGEQEEESSKGPELKQASRRDMYSICQIAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYTCSQFTTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKVNIIPTKKGKKEIDEAHFAYAFKYLKNKPVKELRDDL-FLKMCIAEEEQLLTIEICIDMKDVEGYGDQTYFEEIKQFYYRDEFSHQVQEWNRQRTLAIERALKQFLYPQMAKELKNKLVLEAKDFVIKSCSRKLYNWLKVASYRPDTQVEEDDDFMEENQGKGIRVLGMAYSSA 799          
BLAST of Transcription elongation factor spt6 vs. Ensembl Mouse
Match: Supt6 (SPT6, histone chaperone and transcription elongation factor [Source:MGI Symbol;Acc:MGI:107726])

HSP 1 Score: 884.019 bits (2283), Expect = 0.000e+0
Identity = 537/1381 (38.88%), Postives = 813/1381 (58.87%), Query Frame = 1
Query:  544 KSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV------DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFA--------------------SKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-------KNINEVNLEEPEVIEPNNLNKRL---------------KPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPER---AYSN---ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFI--QSTEKDDNY-DEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKK---DVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDR---DNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRT---PMIGSTPT 4485
            K  KK   + D   QEAQE+FGVD +  E    N  DEE   + E + +     IR R +K          + ++++P+EL+    T +D +I+  D+PERFQLRS+P +           +  E+EEEA W+Y+  FA                    S S K   T+  IKE L  ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++  R++N   +FEK+  +  + +  S D +  L++ ++A L+ +++       E +K  +SM+ LKD   +F +YY       +N  + + ++ + I+ +   +                 + S+ + +T+ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A++++CS F T + VL+G R M+A QI+ EP VR+ LR  F     + +TPTKKG+ ++DE H  Y  KYL +KP+    DD  FL I     + L+T  I +  +    Y N     ++ K F++RDE++   Q+WN QR + I++AL  FL   + KE++++LL +A+ES+      K++  + V P+   Q  E+DD++ DE    G R+LGI ++ A +       F A+++G G+V D  +L    +  RR  +  + ++K   D+E L   ++  +P+ V IA ++  A  L  ++ +++  L++   L+   VELVDNE+AI+Y NSK S+++F +YP +LRQA+S+ARR+QDPL EFAQ+ + D+D++ L+ HPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    AL+Q+VCGLGPRK  +L+K +K++   L SR  ++  C +GPKV MNC GF+KI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G KHITL DIR EL+ R++D R  +RS + +E F +LTKET ET  +G L+   V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK +SD  V    +R+++ M V  R++K+D E+   +++ +++DL D N  W+  KD YYD  AE  D +  E+   KQ++   Y+ RVI HP F NI +   EKM   ++ G+ IIRPSSKG NHLTV+WKV   + +H+DV EE K+N FSLG TL I  E+FEDLDEI+A YVQPMA+FAR++ ++KYY+   G ++  L +++   K   P  IPYFI   ++ PG+F++ Y P  K R +   +TP+GF +R   F  +  L  +FK H+ D P    TP + +RT     I +TP 
Sbjct:  197 KWRKKLPGYTDAALQEAQEIFGVDFDYDEFEKYNEYDEELEEDYEYEDDETEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQLRSIPVK---------AAEDDELEEEADWIYRNAFATPTISLQDSCDYLDRGQPTSSFSRKGPSTVQKIKEALGFMRNQHFEVPFIAFYRKEYVEP------ELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKMQAY--QYEQISADPDKPLADGIRA-LDTTDM-------ERLKDVQSMDELKDVYNHFLLYYGRDIPKMQNAAKASRKKLKRIKEDGDEEGEGEEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKLNITPTKKGRKDVDEAHYAYSFKYLKNKPVKELRDD-QFLKIGLAEDEGLLTIDISIDMKGVEGYGNDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQFLYVQMAKELKNKLLAEARESVVKACSRKLYNWLRVAPYRPDQQVEEDDDFMDENQGKGIRVLGIAFSSARDHP----VFCALVNGEGEVTDFLRLP--HFTKRRTAWREEEREKKAQDIETLKKFLVNKKPHVVTIAGENRDAQMLTEDVKRIVHELDQGQQLSSIGVELVDNELAILYMNSKKSEAEFRDYPPVLRQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYCEFINRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTMCHMGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTAYRSPNTEEIFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVGMTVHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQQRTT-YIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSAGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLNHKYYQDCSGGDRKKLEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVTVTPEGFRYRGQIFPTVNGLFRWFKDHYQD-PVPGITPSSSNRTRTPASINATPA 1541          
BLAST of Transcription elongation factor spt6 vs. Ensembl Mouse
Match: Srbd1 (S1 RNA binding domain 1 [Source:MGI Symbol;Acc:MGI:1925836])

HSP 1 Score: 51.9878 bits (123), Expect = 7.502e-6
Identity = 62/253 (24.51%), Postives = 100/253 (39.53%), Query Frame = 1
Query: 2518 LVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINH-------LMDIDYDDFQREL-----------------------LDSTRIHPESYELAKKM---------AIDALEWDDRDNQAAALEEIMESPEKLR 3159
            +V    A IY  S  +  + P     LR A+SIARR+QDPLAE  +  +     + +  H + +TL K  L   +E     V   + +             LL+ + GL   +A  +++  +K+   + +R  + +   +GPK    C GF++IN            D     +E                        LD T IHPESY++A +           I   E   + N +   E I E+ E+L+
Sbjct:  621 IVSEAGASIYSVSPEANKEMPGLDPNLRSAVSIARRVQDPLAELVKF-DPKHIGVGMYQHDVSQTLLKATLDSVVEECVSFVGVDINICSE---------VLLRHIAGLNANRAKNIIEWREKNGPFI-NREQLKKVKGLGPKSFQQCAGFVRINQDYIRTFCSQHTDSSGQSQETAMVTNEKLGKKKNKADATLIPNPLDQTCIHPESYDIAVRFLSFIGGTMCEIGKPEMQQKINVSLGKEGIEETAERLQ 862          
BLAST of Transcription elongation factor spt6 vs. UniProt/SwissProt
Match: sp|Q62383|SPT6H_MOUSE (Transcription elongation factor SPT6 OS=Mus musculus OX=10090 GN=Supt6h PE=1 SV=2)

HSP 1 Score: 884.019 bits (2283), Expect = 0.000e+0
Identity = 537/1381 (38.88%), Postives = 813/1381 (58.87%), Query Frame = 1
Query:  544 KSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV------DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFA--------------------SKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-------KNINEVNLEEPEVIEPNNLNKRL---------------KPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPER---AYSN---ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFI--QSTEKDDNY-DEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKK---DVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDR---DNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRT---PMIGSTPT 4485
            K  KK   + D   QEAQE+FGVD +  E    N  DEE   + E + +     IR R +K          + ++++P+EL+    T +D +I+  D+PERFQLRS+P +           +  E+EEEA W+Y+  FA                    S S K   T+  IKE L  ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++  R++N   +FEK+  +  + +  S D +  L++ ++A L+ +++       E +K  +SM+ LKD   +F +YY       +N  + + ++ + I+ +   +                 + S+ + +T+ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A++++CS F T + VL+G R M+A QI+ EP VR+ LR  F     + +TPTKKG+ ++DE H  Y  KYL +KP+    DD  FL I     + L+T  I +  +    Y N     ++ K F++RDE++   Q+WN QR + I++AL  FL   + KE++++LL +A+ES+      K++  + V P+   Q  E+DD++ DE    G R+LGI ++ A +       F A+++G G+V D  +L    +  RR  +  + ++K   D+E L   ++  +P+ V IA ++  A  L  ++ +++  L++   L+   VELVDNE+AI+Y NSK S+++F +YP +LRQA+S+ARR+QDPL EFAQ+ + D+D++ L+ HPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    AL+Q+VCGLGPRK  +L+K +K++   L SR  ++  C +GPKV MNC GF+KI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G KHITL DIR EL+ R++D R  +RS + +E F +LTKET ET  +G L+   V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK +SD  V    +R+++ M V  R++K+D E+   +++ +++DL D N  W+  KD YYD  AE  D +  E+   KQ++   Y+ RVI HP F NI +   EKM   ++ G+ IIRPSSKG NHLTV+WKV   + +H+DV EE K+N FSLG TL I  E+FEDLDEI+A YVQPMA+FAR++ ++KYY+   G ++  L +++   K   P  IPYFI   ++ PG+F++ Y P  K R +   +TP+GF +R   F  +  L  +FK H+ D P    TP + +RT     I +TP 
Sbjct:  197 KWRKKLPGYTDAALQEAQEIFGVDFDYDEFEKYNEYDEELEEDYEYEDDETEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQLRSIPVK---------AAEDDELEEEADWIYRNAFATPTISLQDSCDYLDRGQPTSSFSRKGPSTVQKIKEALGFMRNQHFEVPFIAFYRKEYVEP------ELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKMQAY--QYEQISADPDKPLADGIRA-LDTTDM-------ERLKDVQSMDELKDVYNHFLLYYGRDIPKMQNAAKASRKKLKRIKEDGDEEGEGEEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKLNITPTKKGRKDVDEAHYAYSFKYLKNKPVKELRDD-QFLKIGLAEDEGLLTIDISIDMKGVEGYGNDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQFLYVQMAKELKNKLLAEARESVVKACSRKLYNWLRVAPYRPDQQVEEDDDFMDENQGKGIRVLGIAFSSARDHP----VFCALVNGEGEVTDFLRLP--HFTKRRTAWREEEREKKAQDIETLKKFLVNKKPHVVTIAGENRDAQMLTEDVKRIVHELDQGQQLSSIGVELVDNELAILYMNSKKSEAEFRDYPPVLRQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYCEFINRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTMCHMGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTAYRSPNTEEIFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVGMTVHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQQRTT-YIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSAGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLNHKYYQDCSGGDRKKLEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVTVTPEGFRYRGQIFPTVNGLFRWFKDHYQD-PVPGITPSSSNRTRTPASINATPA 1541          
BLAST of Transcription elongation factor spt6 vs. UniProt/SwissProt
Match: sp|Q8UVK2|SPT6H_DANRE (Transcription elongation factor SPT6 OS=Danio rerio OX=7955 GN=supt6h PE=1 SV=1)

HSP 1 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 518/1369 (37.84%), Postives = 812/1369 (59.31%), Query Frame = 1
Query:  538 ARKSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAVDVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSAN----------FKNDLKEIEEEAKWMYQELFASKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-----KNINEVNLEEPEVIEPNNLNKRL---------------------KPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYL---PERAYSN--ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPF---IQSTEKDDNYDEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSD----AKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPM-IGSTPT 4485
             +K  KK   + D   QEAQE+FG D +  E  T      E+  ED+ D + D    +T++      + ++++P+EL+    T +D +I+  D+PERFQLR++P +P + +             F      ++E   ++ +    + S K   TI  IKE LN ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++ +R++N   +F+++  +  + +  S D +  L++  +  L+ +++       E +K  +S++ L D   +F +YY     K  N     + ++ +   +++                       + S+ + +++ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A++++CS F T + VL+G R M+A QI+ EP VR  LR  F     I + PTKKGK ++DE H  Y  KYL +KP+   + D  FL +    ++ L+   I +     + Y +    D+ K F++RDE++   Q+WN+QR L I+++L  FL P + KE++++L+ +A++++    C K++  + V P+    Q  E DD  DE    G R+LG+ +  A+ R+  +  F ++I+G G+V+D  +L    Y L+R+N   +     K++DVE L   +L  +P+ VA++ ++  A  +  +I + IS LE+   L    VELVDNE+A++Y NSK S++DF +YP LLRQA+S+AR++QDPL EFAQ+ + D D++ L+LHPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    +L+Q++CGLGPRK  +L+K +K++   L +R  ++  C +GPKV +NC GFIKI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G+K ITL DIR EL+ R++D R  +R  + +E F +LTKET ET  +G L+   V ++AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK +SD  V +  +R++  M V  R++K+D E+  ++++ +++DL D N  W+  KD YYD  AE  D +  EE+ +KQ++   Y+ RVI HP F NI +   EKM   ++ G+ +IRPSSKG NHLTV+WKV + + +H+DV EE K+N FSLG+TL I  E+FEDLDEI A YVQPMA FAR++  +KY+ + +G ++  + +++   K   P  IPY+I+  R  PG+F++ Y P  K R +   ITP GF +R+  F  +  L  +FK H+ D     T   + +RTP  + +TP 
Sbjct:  190 TKKKGKKFSGYTDAALQEAQEIFGGDFDFAEFDTEAYDHAEEEEEDQDDESWDRPKKQTKRRVSRRSIFEIYEPSELESSHMTDQDNEIRSTDMPERFQLRAIPVKPAEDDELEEEAEWIYRNAFSTPTISMQESTDYLDRGTTTNFSRKGPSTIAKIKEALNFMRNQHFEVPFIAFYRKEYVEP------ELNINDLWKVWQWDEKWTQLKTRKQNLTRLFQRMQSY--QFEQISADPDKPLADSTRP-LDTADM-------ERLKDVQSIDELGDVYNHFLLYYGRDIPKMQNAAKGGKKKLKKIKEVSEEDGEEAEVEEEEEEEEQKGPDLKQASRRDMYSICQSAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFNTPEAVLEGARYMVAMQIAREPLVRHVLRQTFQERAKINIKPTKKGKKDVDEAHFAYSFKYLKNKPVKELSGD-QFLKMCLAEEEGLLAIDICIDLVGVKGYGDQTYFDEIKQFYYRDEFSHQVQEWNKQRTLAIERSLQQFLYPQMAKELKNKLIAEAKDNIVKSCCKKLYNWLKVAPYRPDQQVEEDDDLMDESQGKGIRVLGVAF--ASGRD--TPVFCSLINGEGEVVDFLRLP---YFLKRRNAWREDEREKKQQDVENLKKFLLSKKPHVVAVSGENRDAHMVMEDIKRTISELEQNSSLPVVGVELVDNELAVLYMNSKKSEADFRDYPPLLRQAVSVARKIQDPLVEFAQVCSTDDDILCLKLHPLQEHVVKEELLSALYCEFINRVNEVGVDVNRAIAHPYTQSLVQYICGLGPRKGSHLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAGFIKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGNKGITLYDIRAELSCRYKDLRAPYRPPNTEEVFNMLTKETPETFYIGKLITCVVTNIAHRRPQGESYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVRTRLDNAVMGFIPTKFLSDKVVKHPEERVKPGMTVHCRIMKIDIEKFNVDLTCRTSDLSDKNNEWKLPKDTYYDFDAETDDVKQEEEQKKKQQRTT-YIKRVIAHPSFHNINFKQAEKMMESMDQGDVVIRPSSKGENHLTVTWKVADGIYQHVDVREEGKENAFSLGHTLWINTEEFEDLDEITARYVQPMAAFARDLLGHKYFHECNGGDRKKMEELLVRTKKEKPTFIPYYISACRDLPGKFLLGYQPRGKPRIEYVTITPDGFRYRSQIFPTVNGLFRWFKDHYQDPVPGVTPASSRTRTPASVNATPA 1531          
BLAST of Transcription elongation factor spt6 vs. UniProt/SwissProt
Match: sp|Q7KZ85|SPT6H_HUMAN (Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2)

HSP 1 Score: 865.144 bits (2234), Expect = 0.000e+0
Identity = 560/1468 (38.15%), Postives = 845/1468 (57.56%), Query Frame = 1
Query:  343 LEQPKKRSRLQRESDDEDDISEKRFKMTNVDEDIVDEVEGPNLGSDEEDEDDLRNFIVDANDSRSARKSS--------------------KKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV------DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFA--------------------SKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY------------------KNINEVNLEEPEVIEPNNLNKR----LKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPER---AYSN---ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFI--QSTEKDDNY-DEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKK---DVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDR---DNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRT---PMIGSTPT 4485
            +++ +K  R+++ SDDEDD  E+  K  +  E I +E+     G  EE ++ +   +    +     + S                    KK   + D   QEAQE+FGVD +  E    N  DEE   E E + +     IR R +K          + ++++P+EL+    T +D +I+  D+PERFQLRS+P +           +  E+EEEA W+Y+  FA                    S S K   TI  IKE L  ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++  R++N   +FEK+  +  + +  S D +  L++ ++A L+ +++       E +K  +SM+ LKD   +F +YY                  K + E   EE E  E  +  +R     + S+ + +T+ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A++++CS F T + VL+G R M+A QI+ EP VR+ LR  F     + +TPTKKG+ ++DE H  Y  KYL +KP+    DD  FL I     + L+T  I +  +    Y N     ++ K F++RDE++   Q+WN QR + I++AL  FL   + KE++++LL +A+E +      K++  + V P+   Q  E+DD++ DE    G R+LGI ++ A +       F A+++G G+V D  +L    +  RR  +  + ++K   D+E L   +L  +P+ V +A ++  A  L  ++ +++  L++   L+   VELVDNE+AI+Y NSK S+++F +YP +LRQA+S+ARR+QDPL EFAQ+ + D+D++ L+ HPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    AL+Q+VCGLGPRK  +L+K +K++   L SR  ++  C +GPKV MNC GF+KI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G KHITL DIR EL+ R++D R  +RS + +E F +LTKET ET  +G L+   V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK +SD  V    +R+++ M V  R++K+D E+   +++ +++DL D N  W+  KD YYD  AE  D +  E+   KQ++   Y+ RVI HP F NI +   EKM   ++ G+ IIRPSSKG NHLTV+WKV + + +H+DV EE K+N FSLG TL I  E+FEDLDEI+A YVQPMA+FAR++ ++KYY+   G ++  L +++   K   P  IPYFI   ++ PG+F++ Y P  K R +   +TP+GF +R   F  +  L  +FK H+ D P    TP + SRT     I +TP 
Sbjct:  112 VKRGQKYRRVKKMSDDEDDDEEEYGKEEHEKEAIAEEIF--QDGEGEEGQEAMEAPMAPPEEEEEDDEESDIDDFIVDDDGQPLKKPKWRKKLPGYTDAALQEAQEIFGVDFDYDEFEKYNEYDEELEEEYEYEDDEAEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQLRSIPVK---------GAEDDELEEEADWIYRNAFATPTISLQESCDYLDRGQPASSFSRKGPSTIQKIKEALGFMRNQHFEVPFIAFYRKEYVEP------ELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKMQAY--QYEQISADPDKPLADGIRA-LDTTDM-------ERLKDVQSMDELKDVYNHFLLYYGRDIPKMQNAAKASRKKLKRVREEGDEEGEGDEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKLNITPTKKGRKDVDEAHYAYSFKYLKNKPVKELRDD-QFLKICLAEDEGLLTTDISIDLKGVEGYGNDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQFLYVQMAKELKNKLLAEAKEYVIKACSRKLYNWLRVAPYRPDQQVEEDDDFMDENQGKGIRVLGIAFSSARDHP----VFCALVNGEGEVTDFLRLP--HFTKRRTAWREEEREKKAQDIETLKKFLLNKKPHVVTVAGENRDAQMLIEDVKRIVHELDQGQQLSSIGVELVDNELAILYMNSKKSEAEFRDYPPVLRQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYCEFINRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTMCHMGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTAYRSPNTEEIFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVGMTVHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQQRTT-YIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLNHKYYQDCSGGDRKKLEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVTVTPEGFRYRGQIFPTVNGLFRWFKDHYQD-PVPGITPSSSSRTRTPASINATPA 1541          
BLAST of Transcription elongation factor spt6 vs. UniProt/SwissProt
Match: sp|Q9W420|SPT6H_DROME (Transcription elongation factor SPT6 OS=Drosophila melanogaster OX=7227 GN=Spt6 PE=1 SV=1)

HSP 1 Score: 815.068 bits (2104), Expect = 0.000e+0
Identity = 509/1434 (35.50%), Postives = 794/1434 (55.37%), Query Frame = 1
Query:  478 DEEDEDDLRNFIVDANDSRSARKSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAVD--------VMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSMKKDE-------------TIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-------------KNINEV----------------NLEEPEVIEPNN-------LNKRLK-PSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINS-FTDDYSFLLIENGSQDHLITYKIYLPERAYSN-----ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDE-KNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKK-KDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD-NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKK--IDGD--NKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTP--MIGSTPTFGT----------PASRTPKASGG 4527
            D + E D  +FIVD N    A K  K+  I  D   QE Q++FGVD +  +       D ED SE +       +   TR +K+           + D+++P+EL RG +T  D +I+K DIPER QLR VP  P+   S        E++ EA+W+Y+  F   ++ + E             T++ IK+ L  I+ Q  E PFIA YRKEY++        L ++DLW +Y+ D  W ++N R++    +FEK+ +F  ++     D +  + + ++  L+           E +   +SME LKD   YF + Y             K I E                 +  E  V+           ++ +LK  S S+P+ V RKA +  F ++FGL  +Q+ E++RD Y  +E+    + P + A++++   F T D V+   + ++A Q++ EP +RK +R  ++    I + PTK G   IDE  P+Y MKY+  KP++  F D +  L++    +   IT+       A +N      +++ K+ +  D++    Q+WN+ RA  ++ AL  ++IP + KE+R  L ++AQ+ +      K+++ + V P+      D  Y+E     G R+LG+ Y    + +    AF A+    GD+ D  +L  I+      N    A+K  D+ +L+D I   +P+ V I  +S  A ++Q +I +++  LE      P  VE++DNE+A IY NSK  +SDF  YP LL+QA S+AR++QDPL E++QL + D +++ LR HPLQE + ++ LL ++ +QF+N  ++VG+DIN  + +   + LLQ++CGLGPRK   L+K +K+S + L +R  ++  C +GP+V +NC GFIKI+     D  +   E+LD +R+HPE+YE A+KMAIDA+E+DD + N A ALEEI+ESPE+L+DLDL+AFA EL+R   GSK ITL DIR EL+  ++D R  +     +E F++LTKET ++  VG  V A V    +++PQ DQLD A+P R ++   W CPFC +D FPEL+ VW HFD   CPG+  GV   L N +  F+  KN+SD  V N  +R+ +  M+  R++K+D +R  +E S+++ DL+D+N  WR ++D YYD   E QD + + +   +  K   Y  RVI HP F N +Y +   M    + GE  +RPSSK  +HLT +WKV +++ +HIDV EE K+NDFSLG +L I  E+FEDLDEIIA ++ PMA  ARE+  YKYYK   + GD   ++++  ++R EK  +P KI YF    R  PG+F++ Y+P +K R +   + P+G+ FR   F  + +L+ +FK H+ D  +T  +    + TP  ++   PT  +          P S T   +GG
Sbjct:  168 DVDTESDADDFIVDDNGRPIAEKKKKRRPIFTDASLQEGQDIFGVDFDYDDFSKYEEDDYEDDSEGDEYDEDLGVGDDTRVKKKKALKKKVVKKTIFDIYEPSELKRGHFTDMDNEIRKTDIPERMQLREVPVTPVPEGS-------DELDLEAEWIYKYAFCKHTVSEQEKPESREKMRKPPTTVNKIKQTLEFIRNQQLEVPFIAFYRKEYVKP------ELNIDDLWKVYYYDGIWCQLNERKRKLKVLFEKMRQF--QLDTLCADTDQPVPDDVRLILDSD--------FERLADVQSMEELKDVHMYFLLNYSHELPRMQAEQRRKAIQERREAKARRQAAAAENGDDAAEAIVVPEPEDDDDPELIDYQLKQASNSSPYAVFRKAGICGFAKHFGLTPEQYAENLRDNYQRNEITQESIGPTELAKQYLSPRFMTTDEVIHAAKYVVARQLAQEPLLRKTMREVYFDRARINIRPTKNGMVLIDENSPVYSMKYVAKKPVSDLFGDQFIKLMMAEEEKLLEITFLEEFEGNACANGTPGDYVEESKALYQLDQFAKHVQEWNKLRAECVQLALQKWVIPDLIKELRSTLHEEAQQFVLRSCTGKLYKWLKVAPYKPQLPPDFGYEEWSTLRGIRVLGLAY----DPDHSVAAFCAVTTVEGDISDYLRLPNILKRKNSYNLEEKAQKLADLRKLSDFIKMKKPHIVVIGAESRDAQNIQADIKEILHELETSEQFPPIEVEIIDNELAKIYANSKKGESDFKEYPPLLKQAASLARKMQDPLVEYSQLCDADDEILCLRYHPLQERVPREQLLEQLSLQFINRTSEVGLDINLMVQNSRTINLLQYICGLGPRKGQALLKLLKQSNQRLENRTQLVTVCHLGPRVFINCSGFIKIDTSSLGDSTEAYVEVLDGSRVHPETYEWARKMAIDAMEYDDEETNPAGALEEILESPERLKDLDLDAFAVELERQGFGSKSITLYDIRNELSCLYKDYRTPYTKPSAEELFDMLTKETPDSFYVGKCVTAMVTGFTYRRPQGDQLDSANPVRLDSNESWQCPFCHKDDFPELSEVWNHFDANACPGQPSGVRVRLENGLPGFIHIKNLSDRQVRNPEERVRVSQMIHVRIIKIDIDRFSVECSSRTADLKDVNNEWRPRRDNYYDYVTEEQDNRKVSDAKARALKRKIYARRVIAHPSFFNKSYAEVVAMLAEADQGEVALRPSSKSKDHLTATWKVADDIFQHIDVREEGKENDFSLGRSLWIGTEEFEDLDEIIARHIMPMALAARELIQYKYYKPNMVTGDENERDVMEKLLREEKANDPKKIHYFFTASRAMPGKFLLSYLPKTKVRHEYVTVMPEGYRFRGQIFDTVNSLLRWFKEHWLDPTATPASASASNLTPLHLMRPPPTISSSSQTSLGPQAPYSVTGSVTGG 1574          
BLAST of Transcription elongation factor spt6 vs. UniProt/SwissProt
Match: sp|P34703|SPT6H_CAEEL (Suppressor of Ty 6 homolog OS=Caenorhabditis elegans OX=6239 GN=emb-5 PE=1 SV=1)

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 435/1289 (33.75%), Postives = 693/1289 (53.76%), Query Frame = 1
Query:  739 VMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSM-------------------------KKDETIDIIKEVLNLIKVQL--FEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKT--AESMEALKDCSEYFTMYYKNI--NEVNLEEPEVI---EPNNLNKRLKPS-KSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLI----ENGSQDHLITYKIYLPERAYSNILDKY--KSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQS----INVQPFIQSTEKDDNYDEKNFYGRILGITYTIATNRNEESYAFAAIIDGSGDVID--------KAKLTGIMYGLRRKNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDL-NPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRDNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHF--DTQE--CPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERF--DQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRP 4425
            +++  +P+E+DRGF    D+KI K D+PERFQLR  P    D +         E+E EA W+ +  F   ++                         +K   I  IK+VL  I+V+   FEP FI  YRKE I+++      LT+ +LW +Y  DEKW  ++ ++     +  ++ ++ E            LS+ L AK      + P    + + T  AE++E L D    F + Y  +  + +  E+  +    E      + K S +++ + +  +  + +    FGL A+QF E++   +  H+++  PM P +AAEE++C  F+  D+VL G + MLA +IS +P+VR ++R  F       + PTKKG+D ID+ HPLY  +Y+  KP+ S T +  FL      E+G  D LI Y+    + + + +++KY   S F +DEY    +QWN  R   +  A+ + L+P +  E+ + +L++A+ ++  + C K F S        P   + + DD+  +++   RI+ + Y   T R+E S  F  ++D +G ++D        K    G   GLR+   + D  KK V+R        +P+A+ +  + +    L+ ++ + ++ L   + +  P PV L+DNE A +Y  S  S ++ P++P  LRQA+S+AR L DP+ E+A L N+D+D+  L LHPLQ  ++++ L   +  + VN VN+ GVDIN C    +   +LQF CGLGPRKA  L+K+IK +  L+ SR+ ++  C +GPKV MNC GFIKI+ +   +  D   E+LD +R+HPE+YE A+KMA+DALE DD  +  AAL+EIMESP++LRDLDL+AFA+EL R   G K  TL DI  EL+ R++D R  F+    +  ++LL +   E  + G  V   V S+ ++K  +D  D   P   E+ G + CP C   T      + +H   D+++  CPG  +G+     N +  F   KNIS +HV N L R++++     +VLK+D ER  L +S KS+DL++ + +   Q+D Y+DE     D +L++ + +K+ +    V RVI HP F N++Y    KM   ++  E IIRPS+   + L+V+WK+ + V  +  V E  KD  FS+G  L + GE FEDLDE+IA +VQPM   + E+ ++KY+       +   V+    EK     + PY  +   + P +F I YM D+ ER   + FKI P G  FR+  F  L  ++ +FK HF++ P
Sbjct:  255 LLESIEPSEIDRGFLLPGDKKIAKEDLPERFQLRRTPVTEADDD---------ELESEALWIIKYAFEEGTVTNQADLDQDDKLDCIMNLDPSVYEDRKKAVIKSIKKVLQFIRVRSNSFEPTFIGFYRKEDIDNL------LTMNNLWRVYDFDEKWCHLSEKKNKIYDLMRRMREYQE------------LSDDLTAK------RRPISDADLMDTKYAETLEQLTDIHANFQLLYGALLDDMIRWEKGRLTGEEEEQEYRVKFKSSIRNDKYQMCVENGIGELAGRFGLTAKQFSENL--NWKKHDIEQDPMLPLEAAEEYVCPAFSDSDMVLNGAKFMLAKEISRQPQVRHSVRQEFRQSAHFWIKPTKKGRDTIDQTHPLYDKRYIKSKPVRSLTAE-EFLFYHKAKEDGLVDVLIMYESEEDQDSNNYLVNKYLSDSIFQKDEYTENVEQWNSVRDECVNMAITEMLVPYMRDELYNTILEEAKTAVAKK-CRKEFASRISRSGYLPDFDNNDDDDDGMDQHGARRIMAVCY--PTERDEAS--FGVMVDENGAIVDYLRMVHFTKRTFGGGNNGLRKAESM-DLFKKFVQR-------RKPHAIGLNIEDMECTRLKRDLEEAVADLFSQNLIYKPIPVFLMDNEAAKVYMRSNVSLAENPDHPPTLRQALSLARLLLDPIPEYAHLWNIDEDIFCLSLHPLQRDIDQEQLALVLSHELVNKVNEEGVDINKCAEFPHYTNMLQFTCGLGPRKATDLLKSIKANDNLIESRSKLVVGCKLGPKVFMNCAGFIKIDTIKVSEKTDAYVEVLDGSRVHPETYEWARKMAVDALEVDDSADPTAALQEIMESPDRLRDLDLDAFADELSRQGFGEKKSTLYDISSELSARYKDLRQPFQEPTGELLYDLLARSGKEIRE-GAKVLGTVQSVQYRKVDKDAADSMLPDVGED-GLFTCPCCKSFTSSAPGGIQEHMLGDSRQGGCPGTPVGIRVRFDNGMTGFCPNKNISSSHVDNPLTRVKINQPYYFKVLKLDKERFSLFLSCKSSDLKEDDLS---QRDQYWDEHQYQADLELMKSESKKKTEANTRVKRVIAHPNFHNVSYEAATKMLDEMDWSECIIRPSANKDSGLSVTWKICDRVYHNFFVKESAKDQVFSIGRQLSVGGEDFEDLDELIARFVQPMIQISHEITTHKYFFPNGTCEETEAVEQFVREKKRELGRSPYVFSASYRQPCQFCISYMFDNTERIRHEYFKIVPHGVRFRHQNFDTLDRMMAWFKRHFHEPP 1489          
BLAST of Transcription elongation factor spt6 vs. TrEMBL
Match: A0A2T7PE28 (Transcription elongation factor spt6 OS=Pomacea canaliculata OX=400727 GN=C0Q70_07087 PE=3 SV=1)

HSP 1 Score: 961.829 bits (2485), Expect = 0.000e+0
Identity = 564/1392 (40.52%), Postives = 856/1392 (61.49%), Query Frame = 1
Query:  508 FIVDANDSRSARKSSKKTVIHDDPLTQEAQELFGVXXXXXX--XXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV---DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSMKKDETIDI-------------------IKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFL-ERVKDS--SVDGNF-DLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-------KNINEVN------------LEEPEVIEPNNLNKRLKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPER--AYSNILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDEKNFYG--RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRR-KNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGT--YSRTPMIGSTPTFGTPASRTP 4512
            FIVD      ++   KK +IH D   QEAQ++FGVD    E  +    +L +E+Y E+E         +RT+++K+      + DVF+P+EL+RG +T  D +I+  D+PERFQLR +P +P          +  E+EEE++W+Y++ F++ ++     +D                    IKE LN ++ Q  E PFIA YRKEY+E        L ++DLW ++  DEKW ++ +RRKN   +FEK+  FL ER  D+  +VD +F  ++EQ                ++ V++ ++ME L+D  ++F +YY       +N  +               E+P+  + ++L K+   ++ + +++   AKLD+  R FGL   + GE++RD Y  H+V  CP+ P + A++++CS FAT + +L G R M+A QI+ +P VR+ +R  F+    + + PTKKG   IDE H  Y MKYL + P+    D+  FL I     D LI   I + E     ++  ++ +  ++RDE++ + QQWN QR+  +KQAL   L P + KE+R +L+ +A+E +      +++  + V P+    + D+ YD+ +     R+LGI ++     ++++ AF A+IDG G V D  +L    Y L+  +    D K+KD+++L + IL  +P+ +A++ +S  A  +  ++  +++ LE+   L P  VELVDNEVA+I++NS  +Q++F  YP  LR A+SIARRLQDPL EF+QL N D+D++ L+ HP+Q+ ++K++LL  + ++FVN VN+VGVDIN CI   +   LLQFVCGLGPRKA YL+K +K++   L +R  ++Q C +GPKV +NC GFIK++     D  D   ++LD +R+HPE+YE A+KMA+DALE+DD     N A ALEEI+ESPE+L+DLDL+AFAEEL+R E+G KHITL DIR EL  R++D R  +RS   +ERF +LTKET ET  VG LV  RV  +A+K+PQ +QLD A+P RN+ TG W CPFC +D FPEL+ VW HFD   CPG  +GV   L N +  F+ TKNISD ++ N  +R+++ M + AR++K+D +R Q+E++ KS++L D +  W+ QKD+YYD   E  D +   EK ++  + + Y+ RVI HP FKNI Y + EK+   ++ G+ I+RPSSKGA+HLTV+WKV + +++HIDV EE K+N FSLG +L I  E+FEDLDEIIA ++QPMA   RE+ SY+Y+++IDG  +++L  M+  EK   P++IPY  +   +YPG+F++ YMP +K R +   ITP+G  +R   F  L ++I +FK HF D       PGT   +RTP+  S  TF TP+   P
Sbjct:  187 FIVDDQGRPISKGKKKKHIIHSDAALQEAQDIFGVDFNFDEFDQDGEEDLYDEEYEEEEEGEEDGEQQVRTKRQKKRATKKSIFDVFEPSELERGHFTDLDNEIRITDVPERFQLRQIPVKP---------TEEGELEEESEWIYKQAFSTPTVSNQSYLDQEQSAQYNYSTRRSPTMVSKIKEALNFMRNQRLEVPFIAFYRKEYVER------ELNIKDLWKVWQWDEKWTQLTTRRKNLTRLFEKMQNFLSERYLDAEKNVDKSFRPITEQD---------------LDRVRSVQTMEELRDVYQHFILYYGHEIPAMRNAEKQQRARYQSEREGDEAEQPDQDQHDSLVKQA--TRRSAYSICLSAKLDEMARQFGLKPSEVGENLRDNYQRHDVQQCPVEPLELAKDYVCSQFATVEDILIGARHMVAMQIAHDPLVRQAVRQTFFERAKLCVRPTKKGLKLIDEAHSCYPMKYLRNMPVKDLKDE-QFLKIVQAETDGLIVASITMDEEDSNTTSYFEEVRQLYYRDEFSHLVQQWNIQRSEALKQALYKILYPQMAKELRSKLIAEAKEGIVKACSRRLYNWLKVAPYQAEQQLDEEYDDDDNNNGVRVLGIAFSP----DKDTSAFGAMIDGDGVVSDFVRLPYFCYRLKSFRQMERDCKEKDMQKLKEFILNKKPHVIAVSAESREAMMICDDVKLILNELEQEEHLPPISVELVDNEVAMIFENSNKAQAEFREYPPTLRHAVSIARRLQDPLIEFSQLCNPDEDILCLKYHPMQDQVSKEDLLNALYLEFVNRVNEVGVDINRCINFPHTAPLLQFVCGLGPRKAQYLLKILKQNSGRLENRTQLVQLCHMGPKVFINCAGFIKLDTNSLGDSTDTYVDVLDGSRVHPEAYEWARKMAVDALEYDDTAEDANPAGALEEILESPERLKDLDLDAFAEELERQEYGDKHITLYDIRAELNQRYKDLRTPYRSPTNEERFNMLTKETPETFYVGKLVLCRVTGIAYKRPQGEQLDQANPNRNDETGLWECPFCHKDDFPELSEVWSHFDGSNCPGSAVGVKTRLDNGVSGFIHTKNISDKNIKNPEERVKIGMTIHARIIKIDIDRFQVELTCKSSELVDKDNQWKPQKDLYYDFDMEKVDMEKETEKAKQHARQM-YIKRVIAHPNFKNIGYKECEKVMASMDNGDVIVRPSSKGADHLTVTWKVCDGILQHIDVKEEKKENAFSLGKSLYIGEEEFEDLDEIIARHIQPMAATVREIMSYRYFREIDG-KRDVLDKMLTEEKRKTPSRIPYAFSTCPQYPGKFLLSYMPRNKTRHEYISITPEGIKYRQQIFNSLNSMIRWFKEHFRD-----PIPGTPASTRTPLASS--TFATPSMALP 1532          
BLAST of Transcription elongation factor spt6 vs. TrEMBL
Match: A0A074ZFA9 (Transcription elongation factor spt6 OS=Opisthorchis viverrini OX=6198 GN=T265_06784 PE=3 SV=1)

HSP 1 Score: 957.592 bits (2474), Expect = 0.000e+0
Identity = 537/1395 (38.49%), Postives = 831/1395 (59.57%), Query Frame = 1
Query:  508 FIVDANDSRSARKSSKKTVIHDDPLTQEAQELFGVX---------XXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV----DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASK-SMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYYKNINE---------------------VNLEEPEVIEPNNLN----------------KRLKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPE---RAYSNILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFI----QSTEKDDNYDEKNFYG---------------RILGITYTIAT----------NRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFP-NYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKIN--HLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD--NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXX-XXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRP 4425
            FIVD     +  K++++ ++H D   Q+AQ++FGVD          +     +    +E +    + +  + S+  + RK + +V     V ++FDP++L+R +Y+  DE+I+K DIPERFQLR VP + +DP S N+  +L E+ +EA W+Y++ F  +  +K    I  I E L L++  LFE PFIA YRKE +E        L ++DLW IY +DEKW  +N R++N + +F+KL  F E           D    ++ K   S +K    L+   ++AES+E L D    + ++Y +  E                     V+  E E   P   N                ++ +   +  + V ++A L   ++ FGL+A QF E+V+DQY  H+VD CPM P DAA +F+   F T ++ L   R MLA++IS EP VR+ +R  F     I++ PT +G  EIDE HPL  +KYL +KP++       FL + N S + L+TY+I+LP    R  S +LD+ + FFH+DE++ + Q WNE+R+LV+KQA +DF+ P++ +E++ R+L+ +Q+++      ++F  + V P+     +S E D       F G                + G  ++             +   +S   A  +D +G+V+D   L G+M   R +      K+KD++RL+  ++KHRP  + I  D   A  LQ +I +L+  L     L    VEL++ E++I++  S  + +D P +Y  LLRQAIS+ RRLQDPLAEF+QL+N +++++ +R HPLQ++L ++ LL  +E++F+N VN+VGVD+N C++H +   +LQFV GLGPRK  +++K ++     L +R  ++     GP+V +N  GFIKI+   + D+D DD   E+LDSTR+HPESY+LAKKMA+DALE++D +  +   ALEEI++SP +LR+LDL+AFAEELKR +HG KHITL DIRKEL NR+ D R  ++S +P+  F ++T ET ET  VG L+E RVV++A ++P+ +QLD+A+P +NE  G W+CPFC QD F  LNNVW HFD  ECPG+ +G+  +L N I  F+  + ++D     + +R +   +++ RV+K+D  +  +E++ K +DLQD    WR + D +YD  A+ QD    E    K K+   PY++RVIFHP +KNI+Y+    M P LE G  +IRPS +GA+HLTVSWKVD+  ++HIDV+E++K N FSLG  L+I  E+FEDLDEI+A +VQPMA+  R++ +Y+YY+   G ++ +L  ++  EK+ NP++IPYF++  +  PG F++ YMP+    F+ F + P+GF FR + F  L  +I +FK H+ND P
Sbjct:  198 FIVDDRAGEAPAKTTRR-IVHKDAALQQAQDIFGVDFDMSEFEAFRKGHAAGSEEYSEESEVEYSDDEEASASVRRKQRKPRSSVVLDDKVYELFDPSDLERAYYSQADERIRKTDIPERFQLRQVPVQSIDPYSPNYAQELTELSDEANWIYRKAFKEEPELKPPSVIPKILETLKLMRESLFEVPFIAFYRKECVER------DLNIKDLWRIYQLDEKWTILNQRKRNMIQLFQKLHDFFEATSP-------DDPGSVQKKHATSILK----LISCARSAESLEELIDVRLNYLLHYSSFTEPMQRWFKRKQEKDEAKKDGVEVDENEEESYLPEQGNAIPLTFSFDPLTGRQIRQRQARATASYEVAKRAALGGLVQRFGLSAAQFAENVQDQYLRHDVDQCPMLPLDAAGDFLSPQFPTANVALSAARYMLAFEISREPFVRRMMRQMFQSQAVISVRPTPRGVKEIDESHPLISIKYLKNKPVSDLMGSVLFLHLHNASLEKLLTYEIHLPSEHIRGLS-LLDELQRFFHQDEFSSLVQAWNEERSLVLKQAAEDFIFPVLIRELKDRMLEASQQAVLRMCAKRLFNYLQVAPYPPDGHRSYETDTENAASPFSGSRGKHSGRGHGDSESHVSGAVWSKGARVLAMAIKDEDDARQSVVSAVHLDSNGEVVDFLHLHGLMQSNRVQEDFKKLKEKDMQRLSGFMVKHRPQVIVIGCDCRRALYLQEDIQRLVDELASERRLPRIHVELMETELSIVFAQSSRASADLPVSYSPLLRQAISLGRRLQDPLAEFSQLVNTEEEILGVRWHPLQDSLPREKLLEALEIEFINRVNEVGVDVNRCLSHPHTAGVLQFVSGLGPRKGLHMLKILRHRKMFLTNRMQLVTVIKFGPRVVINSAGFIKIDTAAVRDLDADDV--EILDSTRVHPESYDLAKKMAVDALEYEDNEECDPTTALEEIVQSPARLRELDLDAFAEELKRQDHGDKHITLYDIRKELNNRYRDYRAPYQSANPEMIFSMVTHETPETFHVGRLIECRVVAVATRRPRPEQLDNANPTKNETNGLWMCPFCRQDNFQFLNNVWSHFDNNECPGQAVGLRVQLDNGIAGFIPLR-LTDPPAEKLFERAQPGTLIRCRVMKIDITKFNVELTCKQSDLQDERHMWRPRPDPFYDYEADEQDVLAEETAKAKVKENATPYLSRVIFHPYYKNISYDQLLAMEPELEPGSIVIRPSRRGADHLTVSWKVDDGTLQHIDVLEKEKTNSFSLGRLLIIGDEEFEDLDEIVARHVQPMASLVRDIMTYRYYRDSRGGDRAVLGALLLQEKSNNPDRIPYFLSSTKDRPGYFLLAYMPNRTPHFELFSVRPEGFRFRRLIFPNLDRMITWFKEHYNDVP 1570          
BLAST of Transcription elongation factor spt6 vs. TrEMBL
Match: A0A4S2LCJ0 (Transcription elongation factor spt6 OS=Opisthorchis felineus OX=147828 GN=CRM22_008561 PE=3 SV=1)

HSP 1 Score: 957.207 bits (2473), Expect = 0.000e+0
Identity = 536/1395 (38.42%), Postives = 832/1395 (59.64%), Query Frame = 1
Query:  508 FIVDANDSRSARKSSKKTVIHDDPLTQEAQELFGVX---------XXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAV----DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASK-SMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYYKNINE---------------------VNLEEPEVIEPNNLN----------------KRLKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPE---RAYSNILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFI----QSTEKDDNYDEKNFYG---------------RILGITYTIAT----------NRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFP-NYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKIN--HLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD--NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXX-XXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRP 4425
            FIVD     +  K++++ ++H D   Q+AQ++FGVD          +     T    +E +    + +  + S+  + RK + +V     V ++FDP++L+R +Y+  DE+++K DIPERFQLR VP + +DP S N+  +L E+ +EA W+Y++ F  +  +K    I  I E L L++  LFE PFIA YRKE +E        L ++DLW IY +DEKW  +N R++N + +F+KL  F E           D    ++ K   S +K    L+   ++AES+E L D    + ++Y N  E                     V+  E E   P   N                ++ +   +  + V ++A L   ++ FGL+A QF E+V+DQY  H+VD CPM P DAA +F+   F T ++ L   R MLA++IS EP VR+ +R  F     I++ PT +G  EIDE HPL  +KYL +KP++       FL + N S + L+TY+I+LP    R  S +LD+ + FFH+DE++ + Q WNE+R+LV+KQA ++F+ P++ +E++ R+++ +Q+++      ++F  + V P+     +S E D       F G                + G  ++             +   +S   A  +D +G+V+D   L G+M   R +      K+KD++RL+  ++KHRP  + I  D   A  LQ +I +L+  L     L    VEL++ E++I++  S  + +D P +Y  LLRQAIS+ RRLQDPLAEF+QL+N +++++ +R HPLQ++L ++ LL  +E++F+N VN+VGVD+N C++H +   +LQFV GLGPRK+ +++K ++     L +R  ++     GP+V +N  GFIKI+   + D+D DD   E+LDSTR+HPESY+LAKKMA+DALE++D +  +   ALEEI++SP +LR+LDL+AFAEELKR +HG KHITL DIRKEL NR+ D R  ++S +P+  F ++T ET ET  VG L+E RVV++A ++P+ +QLD+A+P +NE  G W+CPFC QD F  LNNVW HFD  ECPG+ +G+  +L N I  F+  + ++D     + +R +   +++ RV+K+D  +  +E++ K +DLQD    WR + D +YD  A+ QD    E    K K+   PY++RVIFHP +KNI+Y+    M P LE G  +IRPS +GA+HLTVSWKVD+  ++HIDV+E++K N FSLG  L+I  E+FEDLDEI+A +VQPMA+  R++ +Y+YY+   G ++ +L  ++  EK+ NP++IPYF++  +  PG F++ YMP+    F+ F + P+GF FR + F  L  +I +FK H+ND P
Sbjct:  196 FIVDDRAGEAPAKTTRR-IVHKDAALQQAQDIFGVDFDMSEFEAFRKGHAAGTEEYSEESEVEYSDDEEASASVRRKQRKPRSSVVLDDRVYELFDPSDLERAYYSQADERVRKTDIPERFQLRQVPVQSIDPYSPNYAQELTELSDEANWIYRKAFKEEPELKPPSVIPKILETLKLMRESLFEVPFIAFYRKECVER------DLNIKDLWRIYQLDEKWTILNQRKRNIIQLFQKLHDFFEATSP-------DDPGSVQKKHATSILK----LISCARSAESLEELIDVRLNYLLHYSNFTEPMQRWFKRKQEKDEAKKDGVEVDENEEESYLPEQGNAVPLTFSFDPLTGRQIRQRQARATASYEVAKRAALGGLVQRFGLSAAQFAENVQDQYLRHDVDQCPMLPLDAAGDFLSPQFPTANVALSAARYMLAFEISREPFVRRMMRQMFQSQAVISVRPTPRGVKEIDESHPLISIKYLKNKPVSDLMGSVLFLHLHNASLEKLLTYEIHLPSEHIRGLS-LLDELQRFFHQDEFSSLVQAWNEERSLVLKQAAEEFIFPVLIRELKDRMIEASQQAVLRMCAKRLFNYLQVAPYPPDGHRSYETDTENAASPFSGSRGKHSGRGHGDSDSHVSGAVWSKGARVLAMAIKDEDDARQSVVSAVHLDSNGEVVDFLHLHGLMQSNRVQEDFKKLKEKDMQRLSGFMVKHRPQVIVIGCDCRRALYLQEDIQRLVDELASERRLPRIHVELMETELSIVFAQSSRASADLPVSYSPLLRQAISLGRRLQDPLAEFSQLVNTEEEILGVRWHPLQDSLPREKLLEALEIEFINRVNEVGVDVNRCLSHPHTAGVLQFVSGLGPRKSLHMLKILRHRKMFLTNRMQLVTVIKFGPRVVINSAGFIKIDTAAVRDLDADDV--EILDSTRVHPESYDLAKKMAVDALEYEDNEECDPTTALEEIVQSPARLRELDLDAFAEELKRQDHGDKHITLYDIRKELNNRYRDYRAPYQSANPEMIFSMVTHETPETFHVGRLIECRVVAVATRRPRPEQLDNANPTKNETNGLWMCPFCRQDNFQFLNNVWSHFDNNECPGQAVGLRVQLDNGIAGFIPLR-LTDPPAEKLFERAQPGTLIRCRVMKIDITKFNVELTCKQSDLQDERHMWRSRPDPFYDYEADEQDVLAEETAKAKVKENATPYLSRVIFHPYYKNISYDQLLAMEPELEPGSIVIRPSRRGADHLTVSWKVDDGTLQHIDVLEKEKTNSFSLGRLLIIGDEEFEDLDEIVARHVQPMASLVRDIMTYRYYRDSRGGDRTVLGALLLQEKSNNPDRIPYFLSSTKDRPGYFLLAYMPNRTPHFELFSVRPEGFRFRRLIFPNLDRMITWFKEHYNDVP 1568          
BLAST of Transcription elongation factor spt6 vs. TrEMBL
Match: G7Y340 (Transcription elongation factor SPT6 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_100285 PE=4 SV=1)

HSP 1 Score: 956.051 bits (2470), Expect = 0.000e+0
Identity = 537/1403 (38.28%), Postives = 837/1403 (59.66%), Query Frame = 1
Query:  508 FIVDANDSRSARKSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXX---------XXXADSLTIRTRKEKEAV----DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASK-SMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYYKNINE---------------------VNLEEPEVIEPNNLN----------------KRLKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPE---RAYSNILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNY--DEKNFYGRIL--GITYTIATNRNE----ESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFP-NYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKIN--HLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD--NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXX-XXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPMIGSTPTFGTPASRTP 4512
            FIVD     +  K++++ ++H D   Q+AQ++FGVD +  E             E            +  + S+  + RK + +V     V ++FDP++L+R +Y+  DE+++K DIPERFQLR VP + +DP S N+  +L E+ +EA W+Y++ F  +  +K    I  I E L L++  LFE PFIA YRKE +E        L ++DLW IY +DEKW  +N R++N + +F+KL  F E           D    ++ K   S +K    L+   ++AES+E L D    + ++Y +  E                     V+  E E   P   N                ++ +   +  + V ++A L   ++ FGL+A QF E+V+DQY  H+VD CPM P DAA +F+   F T ++ L   R MLA++IS EP VR+ +R  F     I++ PT +G  EIDE HPL  +KYL +KP++       FL + N S + L+TY+I+LP    R  S +LD+ + FFH+DE++ + Q WNE+R+LV+KQA ++F+ P++ +E++ ++L+ +Q+++      ++F  + V P+         +   E +  G +   G        ++E    +S   A  +D +G+V+D   L G+M   R +      K+KD++RL+  ++KHRP  + I  D   A  LQ +I +L+  L     L    VEL++ E++I++  S  + +D P +Y  LLRQAIS+ RRLQDPLAEF+QL+N +++++ +R HPLQ++L ++ LL  +E++F+N VN+VGVD+N C++H +   +LQFV GLGPRK+ +++K ++     L +R  ++     GP+V +N  GFIKI+   + D+D DD   E+LDSTR+HPESY+LAKKMA+DALE++D +  +   ALEEI++SP +LR+LDL+AFAEELKR +HG KHITL DIRKEL NR+ D R  ++S +P+  F ++T ET ET  VG L+E RVV++A ++P+ +QLD+A+P +NE  G W+CPFC QD F  LNNVW HFD  ECPG+ +G+  +L N I  F+  + ++D     + +R +   +++ RV+K+D  +  +E++ K +DLQD    WR + D +YD  A+ QD    E    K K+   PY++RVIFHP +KNI+Y+    M P LE G  +IRPS +GA+HLTVSWKVD+  ++HIDV+E++K N FSLG  L+I  E+FEDLDEI+A +VQPMA+  R++ +Y+YY+   G ++ +L  ++  EK+ NP++IPYF++  +  PG F++ YMP+    F+ F + P+GF FR + F  L  +I +FK H+ND     +T  ++++ P   + P    P    P
Sbjct:  198 FIVDDRAGEAPAKTTRR-IVHKDAALQQAQDIFGVDFDMSEFEAFRKGHAAGGEEYSEESEVEYSDDEEASASVRRKQRKPRSSVVLDDRVYELFDPSDLERAYYSQADERVRKTDIPERFQLRQVPVQSIDPYSPNYAQELTELSDEANWIYRKAFKEEPELKPPSVIPKILETLKLMRESLFEVPFIAFYRKECVER------DLNIKDLWRIYQLDEKWTILNQRKRNMIQLFQKLHDFFEATSP-------DDPGSVQKKHANSVLK----LISCARSAESLEELIDVRLNYLLHYSSFTEPMQRWFKRKQEKDEAKKDGVEVDENEEESYLPEQGNAVPLTFSFDPLTGRQIRQRQARATASYEVAKRAALGGLVQRFGLSAAQFAENVQDQYLRHDVDQCPMLPLDAAGDFLSPQFPTANVALSAARYMLAFEISREPFVRRMMRQMFQSQAVISVRPTPRGVKEIDESHPLISIKYLKNKPVSDLMGSVLFLHLHNASLEKLLTYEIHLPSEHIRGLS-LLDELQRFFHQDEFSSLVQAWNEERSLVLKQAAEEFIFPVLIRELKDKMLEASQQAVLRMCAKRLFNYLQVAPYPPDGHSGRGHGDSESHVSGAVWSKGARVLAMAIKDEDDARQSVVSAVYLDSNGEVVDFLHLHGLMQSNRVQEDFKKLKEKDMQRLSGFMVKHRPQVIVIGCDCRRALYLQEDIQRLVDELASERRLPRIHVELMETELSIVFAQSSRASADLPVSYSPLLRQAISLGRRLQDPLAEFSQLVNTEEEILGVRWHPLQDSLPREKLLEALEIEFINRVNEVGVDVNRCLSHPHTAGVLQFVSGLGPRKSLHMLKILRHRKMFLTNRMQLVTVIKFGPRVVINSAGFIKIDTAAVRDLDADDV--EILDSTRVHPESYDLAKKMAVDALEYEDNEECDPTTALEEIVQSPARLRELDLDAFAEELKRQDHGDKHITLYDIRKELNNRYRDYRAPYQSANPEMIFSMVTHETPETFHVGRLIECRVVAVATRRPRPEQLDNANPTKNETNGLWMCPFCRQDNFQFLNNVWSHFDNNECPGQAVGLRVQLDNGIAGFIPLR-LTDPPAEKLFERAQPGTLIRCRVMKIDITKFNVELTCKQSDLQDERHMWRPRPDPFYDYEADEQDVLAEETAKAKVKENATPYLSRVIFHPYYKNISYDQLLAMEPELEPGSIVIRPSRRGADHLTVSWKVDDGTLQHIDVLEKEKTNSFSLGRLLIIGDEEFEDLDEIVARHVQPMASLVRDIMTYRYYRDSRGGDRAVLGALLLQEKSNNPDRIPYFLSSTKDRPGYFLLAYMPNRTPHFELFSVRPEGFRFRRLIFPNLDRMITWFKEHYNDVVPI-STRFSFAKLPDFFTNPVHRLPNDLRP 1577          
BLAST of Transcription elongation factor spt6 vs. TrEMBL
Match: A0A419QG36 (Transcription elongation factor spt6 OS=Clonorchis sinensis OX=79923 GN=supt6h PE=3 SV=1)

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 541/1417 (38.18%), Postives = 839/1417 (59.21%), Query Frame = 1
Query:  508 FIVDANDSRSARKSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXX---------XADSLTIRTRKEKEAV----DVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASK-SMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYYKNINE---------------------VNLEEPEVIEPNNLN----------------KRLKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPE---RAYSNILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFI----QSTEKDDNYDEKNFYG---------------RILGITYTIAT----------NRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFP-NYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKIN--HLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD--NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXX-XXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPM-IGSTPTF 4488
            FIVD     +  K++++ ++H D   Q+AQ++FGVD +  E             E   +S          + S+  + RK + +V     V ++FDP++L+R +Y+  DE+++K DIPERFQLR VP + +DP S N+  +L E+ +EA W+Y++ F  +  +K    I  I E L L++  LFE PFIA YRKE +E        L ++DLW IY +DEKW  +N R++N + +F+KL  F E           D    ++ K   S +K    L+   ++AES+E L D    + ++Y +  E                     V+  E E   P   N                ++ +   +  + V ++A L   ++ FGL+A QF E+V+DQY  H+VD CPM P DAA +F+   F T ++ L   R MLA++IS EP VR+ +R  F     I++ PT +G  EIDE HPL  +KYL +KP++       FL + N S + L+TY+I+LP    R  S +LD+ + FFH+DE++ + Q WNE+R+LV+KQA ++F+ P++ +E++ ++L+ +Q+++      ++F  + V P+     +S E D       F G                + G  ++             +   +S   A  +D +G+V+D   L G+M   R +      K+KD++RL+  ++KHRP  + I  D   A  LQ +I +L+  L     L    VEL++ E++I++  S  + +D P +Y  LLRQAIS+ RRLQDPLAEF+QL+N +++++ +R HPLQ++L ++ LL  +E++F+N VN+VGVD+N C++H +   +LQFV GLGPRK+ +++K ++     L +R  ++     GP+V +N  GFIKI+   + D+D DD   E+LDSTR+HPESY+LAKKMA+DALE++D +  +   ALEEI++SP +LR+LDL+AFAEELKR +HG KHITL DIRKEL NR+ D R  ++S +P+  F ++T ET ET  VG L+E RVV++A ++P+ +QLD+A+P +NE  G W+CPFC QD F  LNNVW HFD  ECPG+ +G+  +L N I  F+  + ++D     + +R +   +++ RV+K+D  +  +E++ K +DLQD    WR + D +YD  A+ QD    E    K K+   PY++RVIFHP +KNI+Y+    M P LE G  +IRPS +GA+HLTVSWKVD+  ++HIDV+E++K N FSLG  L+I  E+FEDLDEI+A +VQPMA+  R++ +Y+YY+   G ++ +L  ++  EK+ NP++IPYF++  +  PG F++ YMP+    F+ F + P+GF FR + F  L  +I +FK H+ND  S    PG    T + +G+ P +
Sbjct:  129 FIVDDRAGEAPAKTTRR-IVHKDAALQQAQDIFGVDFDMSEFEAFRKGHAAGGEEYSEESEVEYSDDEEASASVRRKQRKPRSSVVLDDRVYELFDPSDLERAYYSQADERVRKTDIPERFQLRQVPVQSIDPYSPNYAQELTELSDEANWIYRKAFKEEPELKPPSVIPKILETLKLMRESLFEVPFIAFYRKECVER------DLNIKDLWRIYQLDEKWTILNQRKRNMIQLFQKLHDFFEATSP-------DDPGSVQKKHANSVLK----LISCARSAESLEELIDVRLNYLLHYSSFTEPMQRWFKRKQEKDEAKKDGVEVDENEEESYLPEQGNAVPLIFSFDPLTGRQIRQRQARATASYEVAKRAALGGLVQRFGLSAAQFAENVQDQYLRHDVDQCPMLPLDAAGDFLSPQFPTANVALSAARYMLAFEISREPFVRRMMRQMFQSQAVISVRPTPRGVKEIDESHPLISIKYLKNKPVSDLMGSVLFLHLHNASLEKLLTYEIHLPSEHIRGLS-LLDELQRFFHQDEFSSLVQAWNEERSLVLKQAAEEFIFPVLIRELKDKMLEASQQAVLRMCAKRLFNYLQVAPYPPDGHRSYETDTENAASPFSGSRGKHSGRGHGDSESHVSGAVWSKGARVLAMAIKDEDDARQSVVSAVYLDSNGEVVDFLHLHGLMQSNRVQEDFKKLKEKDMQRLSGFMVKHRPQVIVIGCDCRRALYLQEDIQRLVDELASERRLPRIHVELMETELSIVFAQSSRASADLPVSYSPLLRQAISLGRRLQDPLAEFSQLVNTEEEILGVRWHPLQDSLPREKLLEALEIEFINRVNEVGVDVNRCLSHPHTAGVLQFVSGLGPRKSLHMLKILRHRKMFLTNRMQLVTVIKFGPRVVINSAGFIKIDTAAVRDLDADDV--EILDSTRVHPESYDLAKKMAVDALEYEDNEECDPTTALEEIVQSPARLRELDLDAFAEELKRQDHGDKHITLYDIRKELNNRYRDYRAPYQSANPEMIFSMVTHETPETFHVGRLIECRVVAVATRRPRPEQLDNANPTKNETNGLWMCPFCRQDNFQFLNNVWSHFDNNECPGQAVGLRVQLDNGIAGFIPLR-LTDPPAEKLFERAQPGTLIRCRVMKIDITKFNVELTCKQSDLQDERHMWRPRPDPFYDYEADEQDVLAEETAKAKVKENATPYLSRVIFHPYYKNISYDQLLAMEPELEPGSIVIRPSRRGADHLTVSWKVDDGTLQHIDVLEKEKTNSFSLGRLLIIGDEEFEDLDEIVARHVQPMASLVRDIMTYRYYRDSRGGDRAVLGALLLQEKSNNPDRIPYFLSSTKDRPGYFLLAYMPNRTPHFELFSVRPEGFRFRRLIFPNLDRMITWFKEHYNDVRS----PGHGMLTAVKLGTFPVW 1519          
BLAST of Transcription elongation factor spt6 vs. Ensembl Cavefish
Match: supt6h (SPT6 homolog, histone chaperone and transcription elongation factor [Source:NCBI gene;Acc:103045879])

HSP 1 Score: 880.167 bits (2273), Expect = 0.000e+0
Identity = 508/1302 (39.02%), Postives = 783/1302 (60.14%), Query Frame = 1
Query:  739 VMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSAN----------FKNDLKEIEEEAKWMYQELFASKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-KNINEVNLEEPEVIEPNNLNKRL-------------------KPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYL---PERAYSN---ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPF---IQSTEKDDNYDEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKK----KDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPMIGSTPTFGTPAS 4503
            + ++++P+EL+    T +D +I+  D+PERFQLR++P +P + +             F      ++E   ++ +    + S +   TI  IKE LN ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++ +R++N   +F+K+  +  + +  S D +  L++ ++  L+ +++       E +K  +SM+ L D   +F +YY ++I  +        +     K                     + S+ + +++ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A++++CS F+T + VL+G R M+A QI+ EP VR  LR  F     I + PTKKGK +IDE H  Y  KYL +KP+     D  FL I     + L++  I +     + Y       D+ K F++RDE++   Q+WN+QR L I++AL  FL P + KE++++L+ +A++++    C K++  + V P+    Q  E DD  DE    G R+LG+ +  A+ R+  +  F A+I+G G+V+D  +L    Y L+R+N   + ++    +D+E L   +L  +P+ VA+A ++  A  L  +I + ++ LE+   L    VELVDNE+A +Y NSK S++DF +YP LLRQA+S+AR++QDPL EFAQ+ + D+D++ L+LHPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    +L+Q+VCGLGPRK  +L+K +K++   L +R  ++  C +GPKV +NC GFIKI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G+K ITL DIR EL+ R++D R  +R  + +E F LLTKET ET  +G L+ + V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK +SD  V +  +R+++ M V  R++K+D E+  ++++ +S+DL D N  W+  KD YYD  AE  D +  EE  +KQ++   Y+ RVI HP F NI +   EKM   ++ G+ +IRPSSKG NHLTV+WKV + + +H+DV EE K+N FSLG+TL I  E+FEDLDEI A YVQPMA FAR++ S+KY+++ +G ++  + +++   K   P  IPYF++  R  PG+F++ Y P  K R +   ITP GF +R+  F  +  L  +FK H+ + P    TP + SRT    S     TPA+
Sbjct:  208 IFEIYEPSELESSHMTDQDNEIRSTDMPERFQLRAIPVKPAEDDELEEEAEWIYRNAFSTPTISMQESTDYLDRGTTTNFSRRGPSTIAKIKEALNFMRNQHFEVPFIAFYRKEYVEP------ELNINDLWKVWQWDEKWTQLKTRKQNLTRLFQKMQSY--QFEQISADPDKPLADAVRP-LDTADM-------ERLKDVQSMDELSDVYNHFLLYYGRDIPRMQNSAKPTKKKLKKIKEEAEVEEEEEEEEEQKGPDLKQASRRDMYSICQSAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFSTPEAVLEGTRYMVAMQIAREPLVRHVLRQTFQERAKINIKPTKKGKKDIDEAHYAYSFKYLKNKPVKELNGD-QFLKICMAEDEGLLSIDICIDLVGVKGYGGDQTYFDEIKQFYYRDEFSHQVQEWNKQRMLAIERALQQFLYPQMAKELKNKLVAEAKDNIVKSCCRKLYNWLKVAPYRPDQQIEEDDDLMDESQGKGIRVLGVAF--ASGRD--TPVFCALINGEGEVVDFLRLP---YFLKRRNAWREEEREKKLQDIENLKKFLLSKKPHVVAVAGENRDAHMLIEDIKRTVAELEQDSSLPAVGVELVDNELATLYMNSKKSETDFRDYPPLLRQAVSVARKIQDPLVEFAQVCSTDEDILCLKLHPLQEHVVKEELLGALYCEFINRVNEVGVDVNRAIAHPYTQSLVQYVCGLGPRKGSHLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAGFIKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGNKGITLYDIRAELSCRYKDLRAPYRPPNTEEVFNLLTKETPETFYIGKLITSVVTGIAHRRPQGESYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVRTRLDNAVMGFIPTKFLSDKVVKHPEERVKVGMTVHCRIMKIDIEKFNVDLTCRSSDLADKNNEWKLPKDTYYDFDAETDDVKQEEELKKKQQRTT-YIKRVIAHPSFHNINFKQAEKMMETMDQGDVVIRPSSKGENHLTVTWKVADGIYQHVDVREEGKENAFSLGHTLWINTEEFEDLDEITARYVQPMAAFARDLLSHKYFQECNGGDRKKMEELLVRCKKEKPTFIPYFVSACRDLPGKFLLGYQPRGKPRIEYVTITPDGFRYRSQIFPTVNGLFRWFKDHYQE-PVPGITPSSSSRTRTPASVN--ATPAN 1479          
BLAST of Transcription elongation factor spt6 vs. Ensembl Cavefish
Match: supt6h (SPT6 homolog, histone chaperone and transcription elongation factor [Source:NCBI gene;Acc:103045879])

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 525/1366 (38.43%), Postives = 809/1366 (59.22%), Query Frame = 1
Query:  568 HDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAVDVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSAN----------FKNDLKEIEEEAKWMYQELFASKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-KNINEVNLEEPEVIEPNNLNKRL--------------------------KPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYL---PERAYSN---ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPF---IQSTEKDDNYDEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKK----KDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPMIGSTPTFGTPAS 4503
            + D   QEAQE+FG D +  E  T      E+  ED+ D   D    +T++      + ++++P+EL+    T +D +I+  D+PERFQLR++P +P + +             F      ++E   ++ +    + S +   TI  IKE LN ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++ +R++N   +F+K+  +  + +  S D +  L++ ++  L+ +++       E +K  +SM+ L D   +F +YY ++I  +        +     K +                          + S+ + +++ + A LD   + FGL  +QFGE++RD Y  HE +  P  P + A++++CS F+T + VL+G R M+A QI+ EP VR  LR  F     I + PTKKGK +IDE H  Y  KYL +KP+     D  FL I     + L++  I +     + Y       D+ K F++RDE++   Q+WN+QR L I++AL  FL P + KE++++L+ +A++++    C K++  + V P+    Q  E DD  DE    G R+LG+ +  A+ R+  +  F A+I+G G+V+D  +L    Y L+R+N   + ++    +D+E L   +L  +P+ VA+A ++  A  L  +I + ++ LE+   L    VELVDNE+A +Y NSK S++DF +YP LLRQA+S+AR++QDPL EFAQ+ + D+D++ L+LHPLQE + K+ LL  +  +F+N VN+VGVD+N  I H    +L+Q+VCGLGPRK  +L+K +K++   L +R  ++  C +GPKV +NC GFIKI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G+K ITL DIR EL+ R++D R  +R  + +E F LLTKET ET  +G L+ + V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N +  F+ TK +SD  V +  +R+++ M V  R++K+D E+  ++++ +S+DL D N  W+  KD YYD  AE  D +  EE  +KQ++   Y+ RVI HP F NI +   EKM   ++ G+ +IRPSSKG NHLTV+WKV + + +H+DV EE K+N FSLG+TL I  E+FEDLDEI A YVQPMA FAR++ S+KY+++ +G ++  + +++   K   P  IPYF++  R  PG+F++ Y P  K R +   ITP GF +R+  F  +  L  +FK H+ + P    TP + SRT    S     TPA+
Sbjct:  215 YTDAALQEAQEIFGGDFDFAEFDTEAYDRAEEEEEDQDDEAWDRPKKQTKRRVGRRSIFEIYEPSELESSHMTDQDNEIRSTDMPERFQLRAIPVKPAEDDELEEEAEWIYRNAFSTPTISMQESTDYLDRGTTTNFSRRGPSTIAKIKEALNFMRNQHFEVPFIAFYRKEYVEP------ELNINDLWKVWQWDEKWTQLKTRKQNLTRLFQKMQSY--QFEQISADPDKPLADAVRP-LDTADM-------ERLKDVQSMDELSDVYNHFLLYYGRDIPRMQNSAKPTKKKLKKIKEVSEEDGEEAEVEEEEEEEEEQKGPDLKQASRRDMYSICQSAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFSTPEAVLEGTRYMVAMQIAREPLVRHVLRQTFQERAKINIKPTKKGKKDIDEAHYAYSFKYLKNKPVKELNGD-QFLKICMAEDEGLLSIDICIDLVGVKGYGGDQTYFDEIKQFYYRDEFSHQVQEWNKQRMLAIERALQQFLYPQMAKELKNKLVAEAKDNIVKSCCRKLYNWLKVAPYRPDQQIEEDDDLMDESQGKGIRVLGVAF--ASGRD--TPVFCALINGEGEVVDFLRLP---YFLKRRNAWREEEREKKLQDIENLKKFLLSKKPHVVAVAGENRDAHMLIEDIKRTVAELEQDSSLPAVGVELVDNELATLYMNSKKSETDFRDYPPLLRQAVSVARKIQDPLVEFAQVCSTDEDILCLKLHPLQEHVVKEELLGALYCEFINRVNEVGVDVNRAIAHPYTQSLVQYVCGLGPRKGSHLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAGFIKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGNKGITLYDIRAELSCRYKDLRAPYRPPNTEEVFNLLTKETPETFYIGKLITSVVTGIAHRRPQGESYDQAI--RNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVRTRLDNAVMGFIPTKFLSDKVVKHPEERVKVGMTVHCRIMKIDIEKFNVDLTCRSSDLADKNNEWKLPKDTYYDFDAETDDVKQEEELKKKQQRTT-YIKRVIAHPSFHNINFKQAEKMMETMDQGDVVIRPSSKGENHLTVTWKVADGIYQHVDVREEGKENAFSLGHTLWINTEEFEDLDEITARYVQPMAAFARDLLSHKYFQECNGGDRKKMEELLVRCKKEKPTFIPYFVSACRDLPGKFLLGYQPRGKPRIEYVTITPDGFRYRSQIFPTVNGLFRWFKDHYQE-PVPGITPSSSSRTRTPASVN--ATPAN 1550          
BLAST of Transcription elongation factor spt6 vs. Ensembl Cavefish
Match: si:ch211-117n7.8 (S1 RNA binding domain 1 [Source:NCBI gene;Acc:103026349])

HSP 1 Score: 55.4546 bits (132), Expect = 5.203e-7
Identity = 78/309 (25.24%), Postives = 124/309 (40.13%), Query Frame = 1
Query: 2350 AKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVE-LVDNEV-AIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDF--------------------------QRELLDSTRIHPESYELAKKMAIDALEWDDRDNQAAALEEIMESPEKLRDLDLEAFAEEL 3192
             + ++ ++L  ++LKH  + V I       G    E     + L K     P  V   + NE  A IY  S  +  + P+    LR A+SI RR+QDPLAE  ++     D  ++ +   Q  +++  L   ++      V+ VGVDIN C        L++ V GL   +A  + +  + +   L    L + +  +GPK    C GF++IN      Y                             Q   LD T IHPESY +A +      +     NQ  + E   +    ++   LEA A+ L
Sbjct:  609 GRNREADKLRHLMLKHSCHTVVIGN-----GTACRETEAFFADLIKSGFFKPLDVSYCITNEAGASIYSVSPEAVKEMPDMDPNLRSAVSIGRRVQDPLAELVKI-----DPKHIGIGTYQHDVSQSLLRAALDGVVQECVSFVGVDINICSE-----TLMRHVAGLNAGRAKSIAEWRETNGPFLNREQLKLVK-GLGPKSFQQCAGFVRINPETVNSYGSGGNPDSAAAEKPAAKKSRTKTTGSICNQPNPLDQTCIHPESYSIAMRFLS---QIGGGLNQLGSPELRQQVESSVKSSGLEALAQSL 898          
BLAST of Transcription elongation factor spt6 vs. Ensembl Cavefish
Match: si:ch211-117n7.8 (S1 RNA binding domain 1 [Source:NCBI gene;Acc:103026349])

HSP 1 Score: 55.0694 bits (131), Expect = 6.547e-7
Identity = 78/309 (25.24%), Postives = 124/309 (40.13%), Query Frame = 1
Query: 2350 AKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVE-LVDNEV-AIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDF--------------------------QRELLDSTRIHPESYELAKKMAIDALEWDDRDNQAAALEEIMESPEKLRDLDLEAFAEEL 3192
             + ++ ++L  ++LKH  + V I       G    E     + L K     P  V   + NE  A IY  S  +  + P+    LR A+SI RR+QDPLAE  ++     D  ++ +   Q  +++  L   ++      V+ VGVDIN C        L++ V GL   +A  + +  + +   L    L + +  +GPK    C GF++IN      Y                             Q   LD T IHPESY +A +      +     NQ  + E   +    ++   LEA A+ L
Sbjct:  583 GRNREADKLRHLMLKHSCHTVVIGN-----GTACRETEAFFADLIKSGFFKPLDVSYCITNEAGASIYSVSPEAVKEMPDMDPNLRSAVSIGRRVQDPLAELVKI-----DPKHIGIGTYQHDVSQSLLRAALDGVVQECVSFVGVDINICSE-----TLMRHVAGLNAGRAKSIAEWRETNGPFLNREQLKLVK-GLGPKSFQQCAGFVRINPETVNSYGSGGNPDSAAAEKPAAKKSRTKTTGSICNQPNPLDQTCIHPESYSIAMRFLS---QIGGGLNQLGSPELRQQVESSVKSSGLEALAQSL 872          
BLAST of Transcription elongation factor spt6 vs. Ensembl Yeast
Match: SPT6 (Nucleosome remodeling protein; functions in various aspects of transcription, chromatin maintenance, and RNA processing; required for the maintenance of chromatin structure during transcription in order to inhibit transcription from promoters within the coding region; required for H3K36 trimethylation but not dimethylation by Set2p [Source:SGD;Acc:S000003348])

HSP 1 Score: 252.292 bits (643), Expect = 3.109e-68
Identity = 314/1265 (24.82%), Postives = 554/1265 (43.79%), Query Frame = 1
Query:  715 RKEKEAVDVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEE-EAKWMYQELFASKSMKKDETIDIIKEVLN----LIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISE-IKPPYELVEFVKTAESMEALKDCSEYFTMYYKN-INEVNLEEPEVIEPNNLNKRLKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHE-VDHCPMTPADAAEEFICSH-------FATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDK-PINSFTDDYSFLLIENGSQDHLITYKIYLPERAYSNILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDEKNFYGRILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPT-PVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKIN-HLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRDNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCE--LHNRIRAFLATKNI-------SDNHVTNILDR-----LELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQF--KITPKGFMFRNICFTFLINLIDYFKA 4407
            +  K+ + + D++D  +L +   T  D KI+K DIPER+Q        L     ++ N   E +E E  W+ +++   K+   +  +   KE +      I  +  E PFI  YR+ YI S     F LT +DLW I  +D ++  + +++                          D  ++  A+L+I + I   Y   +   +   + +L+D  +Y    Y N INE+ +            K LK S    F   + + L + +   G++A+  GE++  Q+ +H  VDH    P +  E  + ++        +   L +  V+   + ++S   ++R+ +R+ F       +  T KGK EI +      +KY +++ P++   D   FL +      +L++ K+++  +A   I   ++        + IA +WN  R L   QA+D  +   +++E++  L K+ Q+ +   +  K    ++  PFI +       D K    +IL +T      R       A  ++  GD I   K+           F     +K  + L ++I   +PNA+ I   +         + +++   + V     T P+  V++EVAI YQNS+ +  +FPN P L++  I++AR +  PL E+A L +  +++ +L +HP Q  L+ + L   +E  FV++VN V V++N    +    + L+++ G G RKA   ++++++  E L +R  +I    +   + MN  GF+ I+ +     Y+D + + LDSTRIHPE Y LA K+A            A ALE            D +  AE   + E G+    +  +R++      D R K  SL+ +   E L K T     +  L     + L       + LD     RN+       P    + F  L       +     G +I V  E   HN I   + T N        +  H    L R      E+     A+V+ +DY  +  E+S    D++         KD    +  +  +    E KL   +      +RVI HP +        E      E GEF+IR SS+G +HL ++WK+D+++ +HID+ E +K+N  +LG  L+++ +K+ DLD+II  Y+Q       E+ S + +K   G  K+ +V  I      NPNK  Y+ +     PG F +++  ++  +   +  K+T  G+   N  +  +I L + FK 
Sbjct:  288 KSTKKKISLQDIYDLEDLKKNLMTEGDMKIRKTDIPERYQ-------ELRAGITDYGNMSSEDQELERNWIAEKISVDKNFDANYDLTEFKEAIGNAIKFITKENLEVPFIYAYRRNYISSREKDGFLLTEDDLWDIVSLDIEFHSLVNKK--------------------------DYVQRFYAELHIDDPIVTEYFKNQNTASIAELNSLQDIYDYLEFKYANEINEMFINHT----GKTGKKHLKNSSYEKF---KASPLYQAVSDIGISAEDVGENISSQHQIHPPVDHPSSKPVEVIESILNANSGDLQVFTSNTKLAIDTVQKYYSLELSKNTKIREKVRSDFSKYYLADVVLTAKGKKEIQKGSLYEDIKYAINRTPMHFRRDPDVFLKMVEAESLNLLSVKLHMSSQA-QYIEHLFQIALETTNTSDIAIEWNNFRKLAFNQAMDK-IFQDISQEVKDNLTKNCQKLVAKTVRHKFMTKLDQAPFIPNVR-----DPK--IPKILSLT--CGQGRFGADAIIAVYVNRKGDFIRDYKIVD-------NPFDKTNPEKFEDTLDNIIQSCQPNAIGINGPNPKTQKFYKRLQEVLHKKQIVDSRGHTIPIIYVEDEVAIRYQNSERAAQEFPNKPPLVKYCIALARYMHSPLLEYANLTS--EEVRSLSIHPHQNLLSSEQLSWALETAFVDIVNLVSVEVNKATDNNYYASALKYISGFGKRKAIDFLQSLQRLNEPLLARQQLITHNILHKTIFMNSAGFLYISWNEKRQKYEDLEHDQLDSTRIHPEDYHLATKVA------------ADALE-----------YDPDTIAE---KEEQGTMSEFIELLRED-----PDRRAKLESLNLESYAEELEKNTG----LRKLNNLNTIVL-------ELLDGFEELRND-----FHPLQGDEIFQSLTG---ESEKTFFKGSIIPVRVERFWHNDI---ICTTNSEVECVVNAQRHAGAQLRRPANEIYEIGKTYPAKVIYIDYANITAEVSLLDHDVKQQYVPISYSKDPSIWDLKQELEDAEEERKLMMAEARAKRTHRVINHPYYFPFNGRQAEDYLRSKERGEFVIRQSSRGDDHLVITWKLDKDLFQHIDIQELEKENPLALGKVLIVDNQKYNDLDQIIVEYLQNKVRLLNEMTSSEKFKS--GTKKD-VVKFIEDYSRVNPNKSVYYFSLNHDNPGWFYLMFKINANSKLYTWNVKLTNTGYFLVNYNYPSVIQLCNGFKT 1436          
BLAST of Transcription elongation factor spt6 vs. Ensembl Nematostella
Match: EDO33602 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRR7])

HSP 1 Score: 889.026 bits (2296), Expect = 0.000e+0
Identity = 529/1398 (37.84%), Postives = 827/1398 (59.16%), Query Frame = 1
Query:  499 LRNFIVDANDSRSARKSSKKTVI----HDDPLTQEAQELFGVX----XXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAVDVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFA-----------------SKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYYKN----INEVNLEEPE---------------VIEP----NNLNKRLKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYL----PERAYSNIL---DKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVS---DAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWD---DRDNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDR-----PSTRTTPGTYSR--TPMI-GSTP 4482
              NFIVD ++ +  +++ +K V+    HD  L QEAQ++FG++      D       + +E+   ED+ D     +  ++RK+     + +VF+P+EL++G  T KD  IK  DIPERFQLR VP +         + D  E+E+EA+W+Y+  F                    ++K    +  I+E LNL++ Q FE PFIA YRKEY+E        L ++DLW ++  DEKW ++ +R++N       L +  E+++D   +   D SE   A  ++  ++P  E ++ +   ++ME LKD   +F +YY N    ++E   ++ +                +EP    +   K  KP K + +++ R++ L    + FGL   QFGE++RD Y  HE +  P+  A+AAE+F  S FAT D VL+G R M+A QI+ +P VR+ +R  ++   +++++PTKKGK EIDE HP Y  KYL  KP+     D  +L +     + L+   I +          N++   D+ K  ++RDE++++ Q+WN QR   + +A    L P + KE++ +LL +++  +     +K+  +I V P+    + D  Y++    G R+L ++Y      +    AF A++DG G V D  +L  ++  +RR  +     +AK+KD+E L + ILK RP  +A+A  S  A  +  +I   ++ LE+ H ++P  VELVD EVA IYQ S  + ++   YP +LR A+S+ RRLQDP+ EFA L   + +L+ ++ HPLQ+ ++K+ L+R +  +FV VVN VGVD N  + H + + LLQFVCGLGPRKA  L+K +++    L +R+ ++  C++GPK+ +NC GFIKI+     D      E+LD +R+HPE+YE AK+MA+DALE+D   + +N +AALEEI+E+P++L+DLDL+AFAEEL+R  +G+K ITL DIR EL  R+ + R  FR L  ++RF++LT ETSETL VG +V   V   A +KP  D +D A+P++ E+TG W CPFC ++ +PEL+ VW H D   CPG   GV   + N I  F+ TK ISD H+ +  +R++  M +  RV +++ ER Q+++S +S+DL D ++ +    D+YYD+ AE +DK+  E   +K  +   Y+ RVI HP F+NI++ + E++   L+ GE I+RPSSKG++HLTV+WKVD+ + +HID+ EE K+N FSLG++L I+ E+FEDLDEIIA ++QPMA  ARE+ ++KYY+  DG +K  L +++  EK   P +IPYF++  +++PG+F++ Y+P  K R +   I P+GF +R      L  L  +FK HF D+     P  RTTP   S   TP   G+TP
Sbjct:   32 FDNFIVD-DEGKPIKQARRKRVVIEGQHDSAL-QEAQDIFGLEFDFDEFDKFGQDDYDEEEDYEDEDDDDDEQAVMRRKSRKKATKKSIYEVFEPSELEKGMLTDKDTLIKNTDIPERFQLRGVPVK---------ETDEGELEDEAEWIYKHAFLYLPISQQDVTEQGIHGNPPALKPHTAVGKIREALNLMRNQFFEVPFIANYRKEYVEP------ELNIDDLWKVFEWDEKWTQLRTRKQN-------LHRLFEQMQDYQFNKARDDSETPLAD-DVRILQP--EDIDRLDQVQTMEQLKDVYSHFMLYYGNELPAMHEARKKKAKEEREQKRLENENEEEAVEPKIDYDEGPKLKKPMKKDLYSICRQSGLGTLAKKFGLTPDQFGENLRDNYQRHETEQHPLELAEAAEQFQTSMFATTDQVLEGTRHMVAMQIARDPLVRQCVRETYYKRATLSVSPTKKGKKEIDESHPCYTFKYLKQKPVRDLRGD-QYLKLSMAEAEGLLNISISIDIANSTGWVVNLMTYFDEVKQLYYRDEFSLLVQEWNGQRMQALSRAFYQMLYPALEKELKTKLLTESKNFVIKSCRNKLKSAIEVAPYQPEQQPDQEYEDMGGDGFRVLALSYL----PDPTVPAFLAMLDGEGQVTDYLRLKSLL--VRRNAYRQSEREAKEKDMESLKEFILKKRPQVIAVAAVSREATTIVEDIKLCLAELEQEHQMSPIGVELVDGEVARIYQTSIRADNESREYPPVLRHAVSVGRRLQDPVTEFAGLCIEEDELLCIKFHPLQDEVDKEQLIRALHEEFVTVVNDVGVDPNRLLDHAHVIPLLQFVCGLGPRKAAALLKCLRQQGSRLENRSQLVTLCNLGPKIFLNCAGFIKIDTQAISDTSTNYVEVLDGSRVHPETYEWAKQMAVDALEYDEATEENNPSAALEEILEAPDRLKDLDLDAFAEELERQNYGNKRITLYDIRDELFGRYAERRVPFRPLSVEDRFKVLTGETSETLYVGKMVMCTVTGFAFRKPSHDMVDQANPEKVEDTGLWQCPFCLKNDYPELSEVWTHLDNGSCPGNATGVRVRMENGISGFIPTKMISDKHIKSPQERVKPGMTLHCRVTRMNMERFQVDLSCRSSDLADKDKKFSLPFDLYYDKDAEEKDKKEDETAKKKANRPK-YIKRVIVHPAFRNISFKEAERILSELDQGESIVRPSSKGSDHLTVTWKVDQGIYQHIDIREEGKENAFSLGHSLWIDTEEFEDLDEIIARHIQPMAALAREILNHKYYRAADGGSKAKLEELLVLEKKKAPQRIPYFLSASKEFPGKFLLGYLPRVKPRVEFVSICPEGFRYRGRVHGTLNALFKWFKEHFRDQIPGVTPRMRTTPVAMSESNTPYTPGATP 1394          
BLAST of Transcription elongation factor spt6 vs. Ensembl Medaka
Match: supt6h (SPT6 homolog, histone chaperone and transcription elongation factor [Source:NCBI gene;Acc:101164914])

HSP 1 Score: 886.715 bits (2290), Expect = 0.000e+0
Identity = 527/1364 (38.64%), Postives = 812/1364 (59.53%), Query Frame = 1
Query:  538 ARKSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAVDVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSA----------NFKNDLKEIEEEAKWMYQELFASKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-KNINEVNLEEPEVIEPNNLNKRLK-----------------------------PSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKI---YLPERAYSN---ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPF---IQSTEKDDNYDEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKK---DVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRT 4461
             +K  KK   + D   QEAQE+FG D +  +       +EE+   +E   +      + R  ++++   ++++P+EL+    T +D +I+  D+PERFQLRS+P +P + +             F      ++E   ++ +    + S K   TI  IKE LN ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++ +R++N   +F+K+  +  + +  S D +  L++ ++  L+ +++       E +K  +++E L D   +F +YY ++I ++           +  KRLK                              S+ + +++ +   LD   + FGL  +QFGE++RD Y  HE +  P  P + A++++CS F+T + VL G R M+A QI+ EP VR  LR  F     I + PTKKGK E+DE H  Y  KYL +KP+     D  FL +    ++ L+T  I    +  + Y+      D+ K F++RDE++   Q+WN QR L I++AL+ FL P + KE++ +L+ +A+E++    C +++  + V P+    Q  E DD  DE    G R+LG+ Y  A +R+  +  F A+I+G G+V+D  +L   M   RR  F  D ++K   D+E L   +   +P+ VA+A ++  A  +  +I + IS LE+   L+P  VELVDNE+A +Y NSK S++DF +YP LLRQA+SIAR++QDPL E+AQ+ + D+D++ L+LHPLQE + K++LL  +  +F+N VN+VGVD+N  I H +  +L+Q+VCGLG RK  +L+K +K++   L +R  ++  C +GPKV +NC GFIKI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G+K ITL DIR EL+ R++D R  +R  + +E F +LTKET ET  +G L+ + V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N ++ F+ TK +SD  V +  +R+++ M V  R++K+D E+  ++++ +++DL D N  W+  KD YYD   E +D++  EE  +KQ++  PY+ RVI HP F NI++N  EKM   L+ G+ IIRPSSKG NHLTV+WKV + + +H+DV EE K+N FSLG+TL I  E+FEDLDEIIA Y+QPMA+FAR++  +KY++  +G ++  + + +   K   P  IPYFI+  +  PG+FI+ Y P  K R +   ITP GF +R+  F  +  L  +FK H+ + P    TP   SRT
Sbjct:  189 TKKRGKKFSGYTDAALQEAQEIFGGDFDFADIGVDEGGEEEEEDPEEEGWDRPKKQTKRRLGRKSI--FEIYEPSELESSHMTDQDNEIRSTDMPERFQLRSIPVKPAEDDELEEEAEWIFRHGFSTLTISMQESTDYLDRGTTTNFSRKGPSTIAKIKEALNFMRNQQFEVPFIAFYRKEYVEP------ELNINDLWKVWQWDEKWTQLRTRKQNLTRLFQKMQSY--QFEQISADPDKPLADGVRP-LDTADM-------ERLKDVQTLEELGDVYNHFLLYYGRDIPKMQ------NAAKSTKKRLKKIREVTEDGEEEELEIEEEEEQKAPDLKQASRRDMYSICQSVGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFSTPENVLVGTRYMVAMQIAREPLVRHVLRQTFQERAKINIKPTKKGKKEVDEAHFAYSFKYLKNKPVKELNGD-QFLKMCLAEEEGLLTIDICIDLIGVKGYAGDQTYFDEIKQFYYRDEFSHQVQEWNRQRTLAIERALNQFLYPQMAKELKSKLIAEAKENIVRSCCRRLYNWLKVAPYRPDQQVEEDDDLMDESQGKGIRVLGVAY--APSRD--TPVFCALINGEGEVVDFLRLPYFMK--RRNAFREDEREKKANDIENLKKFLSSKKPHVVAVAGENRDAQMIMEDIKRTISELEQESSLSPVGVELVDNELATLYMNSKKSENDFRDYPPLLRQAVSIARKIQDPLLEYAQVCSTDEDILCLKLHPLQEHVVKEDLLSALYCEFINRVNEVGVDVNRAIAHPHTQSLVQYVCGLGSRKGSHLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAGFIKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGNKGITLYDIRAELSCRYKDLRVLYRVPNTEEVFNMLTKETPETFYIGKLITSIVTGIAHRRPQGESYDQAI--RNDATGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVRSRLDNGVQGFIPTKFLSDKVVKHPEERVKVGMTVHCRIMKIDIEKFSVDLTCRTSDLMDKNNEWKLPKDTYYDFDTEAEDQKHDEELKKKQQRT-PYIKRVIAHPNFHNISFNQAEKMMETLDQGDLIIRPSSKGENHLTVTWKVADGIYQHVDVREEGKENAFSLGHTLWINNEEFEDLDEIIARYIQPMASFARDLLGHKYFQDCNGGSREKMEEALIKTKREKPTFIPYFISACKDLPGKFILGYQPRGKPRIEYVTITPDGFRYRSQIFPTVNGLFRWFKDHYQE-PVPGVTPSNSSRT 1517          
BLAST of Transcription elongation factor spt6 vs. Ensembl Medaka
Match: supt6h (SPT6 homolog, histone chaperone and transcription elongation factor [Source:NCBI gene;Acc:101164914])

HSP 1 Score: 884.019 bits (2283), Expect = 0.000e+0
Identity = 511/1290 (39.61%), Postives = 784/1290 (60.78%), Query Frame = 1
Query:  739 VMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSA----------NFKNDLKEIEEEAKWMYQELFASKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-KNINEVNLEEPEVIEPNNLNKRLK----------------------PSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKI---YLPERAYSN---ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPF---IQSTEKDDNYDEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKK---DVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRT 4461
            + ++++P+EL+    T +D +I+  D+PERFQLRS+P +P + +             F      ++E   ++ +    + S K   TI  IKE LN ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++ +R++N   +F+K+  +  + +  S D +  L++ ++  L+ +++       E +K  +++E L D   +F +YY ++I ++           +  KRLK                       S+ + +++ +   LD   + FGL  +QFGE++RD Y  HE +  P  P + A++++CS F+T + VL G R M+A QI+ EP VR  LR  F     I + PTKKGK E+DE H  Y  KYL +KP+     D  FL +    ++ L+T  I    +  + Y+      D+ K F++RDE++   Q+WN QR L I++AL+ FL P + KE++ +L+ +A+E+++   C +++  + V P+    Q  E DD  DE    G R+LG+ Y  A +R+  +  F A+I+G G+V+D  +L   M   RR  F  D ++K   D+E L   +   +P+ VA+A ++  A  +  +I + IS LE+   L+P  VELVDNE+A +Y NSK S++DF +YP LLRQA+SIAR++QDPL E+AQ+ + D+D++ L+LHPLQE + K++LL  +  +F+N VN+VGVD+N  I H +  +L+Q+VCGLG RK  +L+K +K++   L +R  ++  C +GPKV +NC GFIKI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G+K ITL DIR EL+ R++D R  +R  + +E F +LTKET ET  +G L+ + V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N ++ F+ TK +SD  V +  +R+++ M V  R++K+D E+  ++++ +++DL D N  W+  KD YYD   E +D++  EE  +KQ++  PY+ RVI HP F NI++N  EKM   L+ G+ IIRPSSKG NHLTV+WKV + + +H+DV EE K+N FSLG+TL I  E+FEDLDEIIA Y+QPMA+FAR++  +KY++  +G ++  + + +   K   P  IPYFI+  +  PG+FI+ Y P  K R +   ITP GF +R+  F  +  L  +FK H+ + P    TP   SRT
Sbjct:  199 IFEIYEPSELESSHMTDQDNEIRSTDMPERFQLRSIPVKPAEDDELEEEAEWIFRHGFSTLTISMQESTDYLDRGTTTNFSRKGPSTIAKIKEALNFMRNQQFEVPFIAFYRKEYVEP------ELNINDLWKVWQWDEKWTQLRTRKQNLTRLFQKMQSY--QFEQISADPDKPLADGVRP-LDTADM-------ERLKDVQTLEELGDVYNHFLLYYGRDIPKMQ------NAAKSTKKRLKKIREEELEIEEEEEQKAPDLKQASRRDMYSICQSVGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFSTPENVLVGTRYMVAMQIAREPLVRHVLRQTFQERAKINIKPTKKGKKEVDEAHFAYSFKYLKNKPVKELNGD-QFLKMCLAEEEGLLTIDICIDLIGVKGYAGDQTYFDEIKQFYYRDEFSHQVQEWNRQRTLAIERALNQFLYPQMAKELKSKLIAEAKENIS--CCRRLYNWLKVAPYRPDQQVEEDDDLMDESQGKGIRVLGVAY--APSRD--TPVFCALINGEGEVVDFLRLPYFMK--RRNAFREDEREKKANDIENLKKFLSSKKPHVVAVAGENRDAQMIMEDIKRTISELEQESSLSPVGVELVDNELATLYMNSKKSENDFRDYPPLLRQAVSIARKIQDPLLEYAQVCSTDEDILCLKLHPLQEHVVKEDLLSALYCEFINRVNEVGVDVNRAIAHPHTQSLVQYVCGLGSRKGSHLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAGFIKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGNKGITLYDIRAELSCRYKDLRVLYRVPNTEEVFNMLTKETPETFYIGKLITSIVTGIAHRRPQGESYDQAI--RNDATGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVRSRLDNGVQGFIPTKFLSDKVVKHPEERVKVGMTVHCRIMKIDIEKFSVDLTCRTSDLMDKNNEWKLPKDTYYDFDTEAEDQKHDEELKKKQQRT-PYIKRVIAHPNFHNISFNQAEKMMETLDQGDLIIRPSSKGENHLTVTWKVADGIYQHVDVREEGKENAFSLGHTLWINNEEFEDLDEIIARYIQPMASFARDLLGHKYFQDCNGGSREKMEEALIKTKREKPTFIPYFISACKDLPGKFILGYQPRGKPRIEYVTITPDGFRYRSQIFPTVNGLFRWFKDHYQE-PVPGVTPSNSSRT 1453          
BLAST of Transcription elongation factor spt6 vs. Ensembl Medaka
Match: supt6h (SPT6 homolog, histone chaperone and transcription elongation factor [Source:NCBI gene;Acc:101164914])

HSP 1 Score: 854.358 bits (2206), Expect = 0.000e+0
Identity = 515/1364 (37.76%), Postives = 798/1364 (58.50%), Query Frame = 1
Query:  538 ARKSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAVDVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSA----------NFKNDLKEIEEEAKWMYQELFASKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYY-KNINEVNLEEPEVIEPNNLNKRLK-----------------------------PSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKI---YLPERAYSN---ILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPF---IQSTEKDDNYDEKNFYG-RILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKK---DVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRD---NQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRT 4461
             +K  KK   + D   QEAQE+FG D +  +       +EE+   +E   +      + R  ++++   ++++P+EL+    T +D +I+  D+PERFQLRS+P +P + +             F      ++E   ++ +    + S K   TI  IKE LN ++ Q FE PFIA YRKEY+E        L + DLW ++  DEKW ++ +R++N   +F+K+  +  + +  S D +  L++ ++  L+ +++       E +K  +++E L D   +F +YY ++I ++           +  KRLK                              S+ + +++ +   LD   + FGL  +QFGE++RD Y  HE +  P  P + A++++CS F+T + VL                        F     I + PTKKGK E+DE H  Y  KYL +KP+     D  FL +    ++ L+T  I    +  + Y+      D+ K F++RDE++   Q+WN QR L I++AL+ FL P + KE++ +L+ +A+E++    C +++  + V P+    Q  E DD  DE    G R+LG+ Y  A +R+  +  F A+I+G G+V+D  +L   M   RR  F  D ++K   D+E L   +   +P+ VA+A ++  A  +  +I + IS LE+   L+P  VELVDNE+A +Y NSK S++DF +YP LLRQA+SIAR++QDPL E+AQ+ + D+D++ L+LHPLQE + K++LL  +  +F+N VN+VGVD+N  I H +  +L+Q+VCGLG RK  +L+K +K++   L +R  ++  C +GPKV +NC GFIKI+     D  D   E+LD +R+HPE+YE A+KMA+DALE+D+     N A ALEEI+E+PE+L+DLDL+AFAEEL+R  +G+K ITL DIR EL+ R++D R  +R  + +E F +LTKET ET  +G L+ + V  +AH++PQ +  D A   RN+ TG W CPFC QD FPEL+ VW HFD+  CPG+ IGV   L N ++ F+ TK +SD  V +  +R+++ M V  R++K+D E+  ++++ +++DL D N  W+  KD YYD   E +D++  EE  +KQ++  PY+ RVI HP F NI++N  EKM   L+ G+ IIRPSSKG NHLTV+WKV + + +H+DV EE K+N FSLG+TL I  E+FEDLDEIIA Y+QPMA+FAR++  +KY++  +G ++  + + +   K   P  IPYFI+  +  PG+FI+ Y P  K R +   ITP GF +R+  F  +  L  +FK H+ + P    TP   SRT
Sbjct:  189 TKKRGKKFSGYTDAALQEAQEIFGGDFDFADIGVDEGGEEEEEDPEEEGWDRPKKQTKRRLGRKSI--FEIYEPSELESSHMTDQDNEIRSTDMPERFQLRSIPVKPAEDDELEEEAEWIFRHGFSTLTISMQESTDYLDRGTTTNFSRKGPSTIAKIKEALNFMRNQQFEVPFIAFYRKEYVEP------ELNINDLWKVWQWDEKWTQLRTRKQNLTRLFQKMQSY--QFEQISADPDKPLADGVRP-LDTADM-------ERLKDVQTLEELGDVYNHFLLYYGRDIPKMQ------NAAKSTKKRLKKIREVTEDGEEEELEIEEEEEQKAPDLKQASRRDMYSICQSVGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFSTPENVLT-----------------------FQERAKINIKPTKKGKKEVDEAHFAYSFKYLKNKPVKELNGD-QFLKMCLAEEEGLLTIDICIDLIGVKGYAGDQTYFDEIKQFYYRDEFSHQVQEWNRQRTLAIERALNQFLYPQMAKELKSKLIAEAKENIVRSCCRRLYNWLKVAPYRPDQQVEEDDDLMDESQGKGIRVLGVAY--APSRD--TPVFCALINGEGEVVDFLRLPYFMK--RRNAFREDEREKKANDIENLKKFLSSKKPHVVAVAGENRDAQMIMEDIKRTISELEQESSLSPVGVELVDNELATLYMNSKKSENDFRDYPPLLRQAVSIARKIQDPLLEYAQVCSTDEDILCLKLHPLQEHVVKEDLLSALYCEFINRVNEVGVDVNRAIAHPHTQSLVQYVCGLGSRKGSHLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAGFIKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGNKGITLYDIRAELSCRYKDLRVLYRVPNTEEVFNMLTKETPETFYIGKLITSIVTGIAHRRPQGESYDQAI--RNDATGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQAIGVRSRLDNGVQGFIPTKFLSDKVVKHPEERVKVGMTVHCRIMKIDIEKFSVDLTCRTSDLMDKNNEWKLPKDTYYDFDTEAEDQKHDEELKKKQQRT-PYIKRVIAHPNFHNISFNQAEKMMETLDQGDLIIRPSSKGENHLTVTWKVADGIYQHVDVREEGKENAFSLGHTLWINNEEFEDLDEIIARYIQPMASFARDLLGHKYFQDCNGGSREKMEEALIKTKREKPTFIPYFISACKDLPGKFILGYQPRGKPRIEYVTITPDGFRYRSQIFPTVNGLFRWFKDHYQE-PVPGVTPSNSSRT 1494          
BLAST of Transcription elongation factor spt6 vs. Planmine SMEST
Match: SMESG000058110.1 (SMESG000058110.1)

HSP 1 Score: 2797.69 bits (7251), Expect = 0.000e+0
Identity = 1491/1492 (99.93%), Postives = 1492/1492 (100.00%), Query Frame = 1
Query:   94 MAEFFDSEADESVESNLSDKGKDRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRNEVADLLEQPKKRSRLQRESDDEDDISEKRFKMTNVDEDIVDEVEGPNLGSDEEDEDDLRNFIVDANDSRSARKSSKKTVIHDDPLTQEAQELFGVXXXXXXXXXXXXXXXXXXXXXXXXXXADSLTIRTRKEKEAVDVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYYKNINEVNLEEPEVIEPNNLNKRLKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPERAYSNILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDEKNFYGRILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRDNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPMIGSTPTFGTPASRTPKASGGKWYNANSSGPETPS 4569
            MAEFFDSEADESVESNLSDKGKDREIDSSDDEIENEEELLKKEAEGFIVDEEIEEEEEEVESDGDDKEDDDSELDIRNEVADLLEQPKKRSRLQRESDDEDDISEKRFKMTNVDEDIVDEVEGPNLGSDEEDEDDLRNFIVDANDSRSARKSSKKTVIHDDPLTQEAQELFGVDLEDLEELTLNNLDEEDYSEDELDSNADSLTIRTRKEKEAVDVMDVFDPTELDRGFYTAKDEKIKKIDIPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTL+DLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYYKNINEVNLEEPEVIEPNNLNKRLKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPERAYSNILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDEKNFYGRILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEVQFVNVVNKVGVDINYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRDNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDKQLIEEKLEKQKKILPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPMIGSTPTFGTPASRTPKASGGKWYNANSSGPETPS
Sbjct:    1 MAEFFDSEADESVESNLSDKGKDREIDSSDDEIENEEELLKKEAEGFIVDEEIEEEEEEVESDGDDKEDDDSELDIRNEVADLLEQPKKRSRLQRESDDEDDISEKRFKMTNVDEDIVDEVEGPNLGSDEEDEDDLRNFIVDANDSRSARKSSKKTVIHDDPLTQEAQELFGVDLEDLEELTLNNLDEEDYSEDELDSNADSLTIRTRKEKEAVDVMDVFDPTELDRGFYTAKDEKIKKIDIPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLDDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYYKNINEVNLEEPEVIEPNNLNKRLKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPERAYSNILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDEKNFYGRILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEVQFVNVVNKVGVDINYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDRDNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDKQLIEEKLEKQKKILPYVNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTPGTYSRTPMIGSTPTFGTPASRTPKASGGKWYNANSSGPETPS 1492          
BLAST of Transcription elongation factor spt6 vs. Planmine SMEST
Match: SMESG000059332.1 (SMESG000059332.1)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 429/1246 (34.43%), Postives = 708/1246 (56.82%), Query Frame = 1
Query:  721 EKEAVDVMDVFDPTELDRGFYTAXXXXXXXXXXPERFQLRSVPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSMKKDETIDIIKEVLNLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRINSRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLK-AKLNISEIKPPYELVEFVKTAESMEALKDCSEYFTMYYKNINEVNLEEPEVIEPNNLNKRLKPSKSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADAAEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLTPTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYKIYLPERAYSNILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDEKNFYGRILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIM-YGLRRKNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPK--------------VGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALEWDDR-DNQAAALEEIMESP-EKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKKPQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVIGVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQLEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDXXXXXXXXXXXXXXXPYVN-RVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDENVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFAREVQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIVYMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYF 4401
            E E +D  +V++P +L+RG++T +DE I+K D+PERFQL+ + +E L  N A+       +++EA  ++++LF+ +   KD+T  ++  +L +I+ + +E P+I  Y ++ I    D     +LEDLW ++    KW  +  ++       EKL   + ++++  V    +  +Q+   K +I  IK   E    ++  + + +     +Y T++                PN  NK+      N F + + AKLDK  + FGL + Q+G ++++ Y  +++ +    P + A+++I  +F   + +L+  R +LAYQ+S E  +   + + F  +G I + PT  G D ID +H LY  KY+ DKP++ F  +Y +L+I    +D  IT+ +YL +   + +L+K    FH DE+N IA+ WN Q +LV  + +++FL+P + K    RLL++ Q  L  +I +K++++INV  +      + N +EK     ++GI+Y   T+ +E S A A  ++  G VI    L  ++  G  RK    + ++ D++ + +M++  +PNA+ IA +  ++ +L+ +IT LI + +K  +L    V +++++ A  Y+ S  S   +P+  SL RQA  +A  L DPL  ++QLMN D D+  L  H      ++D LL + E  FVNVV+K GVDINY + HKN    LQFV GLGPR A  L++ I +      SR   I+   V                 V  NC  F+KI  + ++D       +LD TRI+P  Y+ A  +A + L+ ++  +    A+  ++E+P + + DLD E+FAE +    +  KHI +  I  EL + F+D RP+F SL  +ERF  LT E  ETL++GT+ E RV+++ +++ Q+D  D+A+PK N++TG + CP C +D F +L+ +W HFD Q CPGK IGV     N+I  F++ +NI+D  V N+ D +++D +V   V  V Y +++LE S K +D++      + ++D +YDE AEN +K    +   ++       N RV FHP FKN+ Y  F KM   L   +FIIRPSSKG N L++SWK+  N+ RHIDV EE+K N+F++G  L I+ E+FEDLD+IIA+Y+QPM  +  E+ ++KY+K I  ++K  L  MI  +K  NP +IPY+I P+  YPG F+ V +P+ K  ++ F +TP+G+ FRN  F  +  L+++F
Sbjct:  248 EAEEIDHNEVYNPEDLERGYHTEQDEIIRKTDLPERFQLKGLTYENLSENDAS-------LQKEALSVFEKLFSDRFWDKDKTCQLLVRLLYMIRCKCYEIPYINLYEQDMI---SDNEIKFSLEDLWDVFDFHIKWKIVWVKK-------EKLLDTICQIEEDLVKTKMNKPDQINYIKHSILSIKSTEE----IRMTDELLSFSFPHQYKTLF----------------PNLKNKK----HFNKFRIEKSAKLDKLAQLFGLESFQYGTNIKENYMQYQIQNPDQLPEEEAKKYISRNFPVVEKILQKARTILAYQMSREISIYNFVDSFFRKNGKIKIRPTPNGYDIIDNKHDLYKYKYITDKPLSDFEKNYDYLMINESEKDKTITFSLYLNDDDKTELLEKLNGLFHNDEFNTIAKAWNHQSSLVTSELVNEFLLPEIIKSSHRRLLQNGQRFLVKEIGNKLYKNINVACY-----DNQNGNEKTI---VIGISYQ-KTSESENSTAVA--MNSYGSVISTVNLKNLLKIGKSRKQ--KEIRQNDLDCILNMVVTRKPNAIVIAGNCSLSIELKNDITDLILNADKEFELPNVDVFVINSKFAATYETSSISSKLYPSLSSLQRQAAGVAMNLLDPLMAYSQLMNYDNDIKKLNWHLHMSLASEDLLLTEYERHFVNVVSKTGVDINYILKHKNMQYTLQFVPGLGPRMAKSLIEKITQKCIRQYSRRTHIEDIAVNLTNRKELLSEKYMVFIVAKNCAPFLKIVDISELD----DGNILDETRINPMDYDFAINIARNVLDLEESSETSQVAIRTVLENPMQYIADLDFESFAESIYERNNIKKHIIIKQINDELMHPFQDHRPRFISLTEQERFYFLTNENEETLNIGTVAEFRVINVVNRRNQKD-FDNANPKGNKDTGLFSCPICQKDNFHQLSEIWVHFDNQ-CPGKAIGVNLLFENQIMTFVSIRNIADKFVRNVYDFVKVDQLVVGVVTNVSYSKMKLEASLKQSDIKKAFEREKGRRDPHYDEKAENDEKNRKTKHKPRKNNKPIATNTRVSFHPNFKNLNYEQFMKMSHTLRANDFIIRPSSKGPNRLSISWKLSSNLFRHIDVKEEEKKNEFTIGQVLFIDSERFEDLDDIIANYLQPMIGYVDEIFTHKYFKDIRAEDKLTLERMIFEDKRNNPKRIPYYIVPMYNYPGAFVFVVLPNDKVFYESFLVTPQGYSFRNKYFQNMNKLLEHF 1433          
BLAST of Transcription elongation factor spt6 vs. Planmine SMEST
Match: SMESG000045847.1 (SMESG000045847.1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.426e-17
Identity = 120/465 (25.81%), Postives = 201/465 (43.23%), Query Frame = 1
Query: 1996 RALVIKQALDDF---LIPLVTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDEKNFYGRILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFVSDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVHDLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLAEFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEXXXXXXXXXXXXXXXYCITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGPKVGMNCLGFIKINHLMDIDYDDFQREL--------------------------LDSTRIHPESYELAKKMAIDALEWDDRDNQAAALE----EIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRKELTNRFE-DSRPKFRS 3288
            RA V   ALD +   ++P + +++R++L K A  +  +     +F+S N++  + S+              + G++  +  +    +     IID    ++D    T I+Y  +      +A  K     T+++LKH    +AI        D+  +    +++     +LN     +V    A +Y  +  ++S+FPN    LR ++SIARRLQDP+AE+ ++     D  NL +   Q  L   +L+ K+     + ++ VG+DIN+   H     +L  V GLG  +A  ++ + ++      +RN ++    +G KV + C GFI+I H       +F+ EL                          LD T IHPESYE+A K+ I     D  D    A++      M + E L    L +F  E    E      TL DI   L+   E D R  F S
Sbjct:  283 RAFVSNCALDAYERLVLPHLIRKIRNQLTKKAHSTSLD-----VFES-NLRQLVMSSP-------------LRGVS-ILGVDPGYYNGCKIVIIDRKSQLLD----TAIIYLSKGPQAYLEAGAK----FTELVLKHSVEYIAIGDGK--GNDMVIKFVSELTTKNAFGNLN-VRFTIVRECGASVYSVTPEAESEFPNLTDTLRSSVSIARRLQDPMAEYVKM-----DPKNLGVGMYQHDLPTKSLVDKVNAVLDDCISFVGIDINHAPLH-----ILVHVSGLGRVRASEII-SYREKYGAFKNRNQLLNVKGIGEKVFIQCAGFIRIKHSASESVKNFEYELDGDAKMIDLSKKVNRKKKALCSDINYLDQTSIHPESYEIATKI-IQIFNMDVSDVGTIAMQHAAKSFMSNSEYLN--VLSSFQTETCGIE------TLKDILISLSRPLEFDERYNFNS 696          
The following BLAST results are available for this feature:
BLAST of Transcription elongation factor spt6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SUPT6H0.000e+038.15SPT6 homolog, histone chaperone and transcription ... [more]
SUPT6H0.000e+038.15SPT6 homolog, histone chaperone and transcription ... [more]
back to top
BLAST of Transcription elongation factor spt6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
emb-50.000e+033.75Suppressor of Ty 6 homolog [Source:UniProtKB/Swis... [more]
back to top
BLAST of Transcription elongation factor spt6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Spt60.000e+035.50gene:FBgn0028982 transcript:FBtr0070896[more]
Spt60.000e+035.50gene:FBgn0028982 transcript:FBtr0340027[more]
back to top
BLAST of Transcription elongation factor spt6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
supt6h0.000e+037.84SPT6 homolog, histone chaperone and transcription ... [more]
back to top
BLAST of Transcription elongation factor spt6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SUPT6H0.000e+039.19SPT6 homolog, histone chaperone [Source:NCBI gene;... [more]
SUPT6H0.000e+038.95SPT6 homolog, histone chaperone [Source:NCBI gene;... [more]
SUPT6H0.000e+038.99SPT6 homolog, histone chaperone [Source:NCBI gene;... [more]
SUPT6H0.000e+038.12SPT6 homolog, histone chaperone [Source:NCBI gene;... [more]
SUPT6H5.779e-6746.36SPT6 homolog, histone chaperone [Source:NCBI gene;... [more]
back to top
BLAST of Transcription elongation factor spt6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Supt60.000e+038.88SPT6, histone chaperone and transcription elongati... [more]
Srbd17.502e-624.51S1 RNA binding domain 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Transcription elongation factor spt6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q62383|SPT6H_MOUSE0.000e+038.88Transcription elongation factor SPT6 OS=Mus muscul... [more]
sp|Q8UVK2|SPT6H_DANRE0.000e+037.84Transcription elongation factor SPT6 OS=Danio reri... [more]
sp|Q7KZ85|SPT6H_HUMAN0.000e+038.15Transcription elongation factor SPT6 OS=Homo sapie... [more]
sp|Q9W420|SPT6H_DROME0.000e+035.50Transcription elongation factor SPT6 OS=Drosophila... [more]
sp|P34703|SPT6H_CAEEL0.000e+033.75Suppressor of Ty 6 homolog OS=Caenorhabditis elega... [more]
back to top
BLAST of Transcription elongation factor spt6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PE280.000e+040.52Transcription elongation factor spt6 OS=Pomacea ca... [more]
A0A074ZFA90.000e+038.49Transcription elongation factor spt6 OS=Opisthorch... [more]
A0A4S2LCJ00.000e+038.42Transcription elongation factor spt6 OS=Opisthorch... [more]
G7Y3400.000e+038.28Transcription elongation factor SPT6 (Fragment) OS... [more]
A0A419QG360.000e+038.18Transcription elongation factor spt6 OS=Clonorchis... [more]
back to top
BLAST of Transcription elongation factor spt6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
supt6h0.000e+039.02SPT6 homolog, histone chaperone and transcription ... [more]
supt6h0.000e+038.43SPT6 homolog, histone chaperone and transcription ... [more]
si:ch211-117n7.85.203e-725.24S1 RNA binding domain 1 [Source:NCBI gene;Acc:1030... [more]
si:ch211-117n7.86.547e-725.24S1 RNA binding domain 1 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Transcription elongation factor spt6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription elongation factor spt6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SPT63.109e-6824.82Nucleosome remodeling protein; functions in variou... [more]
back to top
BLAST of Transcription elongation factor spt6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO336020.000e+037.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription elongation factor spt6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
supt6h0.000e+038.64SPT6 homolog, histone chaperone and transcription ... [more]
supt6h0.000e+039.61SPT6 homolog, histone chaperone and transcription ... [more]
supt6h0.000e+037.76SPT6 homolog, histone chaperone and transcription ... [more]
back to top
BLAST of Transcription elongation factor spt6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000058110.10.000e+099.93SMESG000058110.1[more]
SMESG000059332.10.000e+034.43SMESG000059332.1[more]
SMESG000045847.12.426e-1725.81SMESG000045847.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020054 ID=SMED30020054|Name=Transcription elongation factor spt6|organism=Schmidtea mediterranea sexual|type=transcript|length=4704bp
ATTTTAATATTCAATTGAAATTAATAGTCAATTTAAATTTTTCATTTTTT
TACAGTTATACGTTAAATTAATAAAAAATATCGTATAATAAAAATGGCGG
AATTTTTTGATTCAGAAGCAGATGAATCTGTAGAATCTAACCTCTCTGAT
AAAGGAAAGGATAGAGAAATTGACAGCTCTGATGATGAAATTGAAAATGA
AGAGGAATTGCTTAAAAAGGAAGCTGAGGGTTTTATTGTTGATGAAGAAA
TAGAGGAAGAAGAGGAAGAAGTTGAGTCTGATGGTGATGATAAAGAAGAT
GATGATAGTGAACTGGATATTAGAAATGAAGTTGCGGATTTACTCGAACA
ACCTAAAAAGCGATCTCGTCTTCAAAGAGAAAGTGATGATGAGGATGATA
TATCTGAAAAAAGATTTAAGATGACTAATGTTGATGAAGATATAGTTGAC
GAAGTTGAAGGTCCAAATTTAGGATCTGATGAAGAAGATGAAGATGATTT
AAGAAATTTCATTGTGGATGCTAATGACTCCAGGTCCGCTAGAAAGTCAT
CTAAAAAAACTGTAATTCATGATGATCCTTTAACACAGGAAGCACAAGAA
TTGTTTGGTGTTGATTTAGAAGATTTGGAAGAATTAACTTTAAACAATTT
GGACGAAGAAGATTATTCAGAAGATGAACTCGATTCAAATGCAGATTCAT
TGACAATTAGAACTCGCAAAGAAAAAGAAGCCGTTGATGTGATGGATGTT
TTTGATCCTACAGAGCTAGATCGTGGATTTTATACCGCGAAAGATGAGAA
AATAAAGAAAATTGACATCCCAGAACGATTTCAATTAAGAAGTGTTCCAT
TTGAACCCTTAGATCCAAATTCGGCAAATTTTAAAAACGACTTGAAAGAA
ATTGAAGAAGAAGCCAAATGGATGTACCAAGAATTGTTTGCGTCTAAGTC
AATGAAAAAAGATGAAACTATCGATATAATTAAGGAAGTTCTTAATCTTA
TTAAAGTGCAATTATTTGAGCCACCCTTTATCGCAACATATCGCAAAGAA
TATATTGAAAGTGTTGGCGATTTTAGATTTTCACTTACTCTAGAAGATTT
ATGGAGTATTTATTTTATGGATGAGAAATGGATTCGTATAAATAGTCGAC
GCAAAAATCAACTTAGTATATTTGAGAAATTGACAAAATTCCTAGAACGA
GTTAAAGATAGTTCTGTTGATGGAAATTTCGATTTGAGTGAACAATTGAA
AGCCAAGCTAAACATATCGGAAATTAAACCTCCATACGAATTAGTGGAAT
TTGTGAAAACTGCGGAGTCAATGGAAGCTTTAAAGGATTGCTCGGAATAT
TTTACAATGTATTACAAGAACATAAATGAAGTCAACTTAGAAGAACCGGA
AGTTATCGAGCCGAATAATCTCAATAAGCGATTGAAACCGTCTAAATCTA
ATCCATTTACAGTGGGCCGCAAAGCAAAACTGGACAAATTCATTCGTTAC
TTCGGGTTGAATGCTCAACAGTTTGGAGAACATGTCCGTGATCAATACGC
AGTGCACGAAGTCGATCATTGTCCTATGACCCCTGCTGATGCTGCCGAAG
AGTTCATTTGTTCTCATTTCGCTACTCGTGATCTTGTATTGAAAGGCGTA
AGAGCAATGTTAGCATATCAGATTTCATGCGAGCCAGAGGTCAGAAAAAA
CCTCCGAAATCGGTTTTGGCACGACGGATCGATTACGCTAACACCAACCA
AAAAAGGCAAGGATGAAATCGATGAGCAACACCCATTATATTTAATGAAA
TATCTGTTGGATAAACCAATTAACAGCTTTACCGATGATTATAGCTTCTT
GCTCATTGAAAACGGAAGTCAGGATCATTTGATTACGTATAAAATCTATT
TACCAGAACGAGCCTATTCGAATATTTTGGACAAATACAAATCGTTCTTT
CATCGCGACGAATACAACATCATCGCTCAACAATGGAATGAGCAGCGGGC
ATTGGTCATTAAGCAGGCATTGGATGATTTTCTCATTCCGCTTGTCACGA
AAGAAATGCGCCATCGACTTTTGAAAGATGCTCAGGAAAGTCTCACGAAT
CAAATCTGTGACAAAATATTCCAATCAATCAACGTCCAACCGTTTATTCA
GAGCACAGAAAAGGATGACAATTACGATGAAAAGAATTTCTATGGTCGCA
TATTAGGGATTACTTACACAATTGCCACAAATCGGAATGAGGAGAGTTAT
GCTTTCGCCGCTATTATCGATGGAAGCGGCGATGTAATTGATAAAGCCAA
ATTAACAGGAATAATGTATGGTTTAAGGCGGAAAAATTTCGTCTCTGACG
CTAAAAAAAAAGACGTGGAAAGATTAACAGATATGATTTTGAAGCACCGT
CCTAATGCCGTAGCAATAGCAACTGATTCATTGGTGGCGGGAGATCTTCA
GTTTGAAATAACACAGCTGATTAGTTCACTGGAAAAAGTCCATGATTTGA
ACCCGACTCCAGTTGAACTCGTTGATAATGAAGTCGCAATCATATATCAA
AACTCGAAAACCTCTCAATCTGATTTTCCTAACTATCCGTCTTTATTACG
ACAAGCAATTTCTATTGCTCGACGATTGCAAGATCCACTGGCTGAATTTG
CTCAACTGATGAATGTTGATCAAGATTTAATGAACCTTCGATTGCATCCT
TTACAGGAGACTCTTAATAAAGATAACCTTTTACGAAAGATCGAAGTGCA
ATTTGTCAATGTTGTCAATAAAGTTGGAGTAGACATAAATTATTGTATTA
CACACAAAAATCGACTCGCTCTTCTTCAATTCGTTTGTGGTCTCGGTCCC
AGAAAAGCAGATTATTTAGTGAAGACCATTAAAAAATCTCTTGAACTTCT
GCCAAGTCGTAATTTAATAATCCAACAATGTGACGTTGGGCCTAAAGTTG
GCATGAATTGTTTGGGATTTATTAAAATCAATCATTTAATGGATATTGAC
TATGATGATTTTCAACGAGAATTGCTAGATAGTACTCGCATCCATCCTGA
ATCTTATGAGCTTGCAAAAAAAATGGCAATCGATGCTCTTGAATGGGATG
ACCGCGATAATCAGGCAGCCGCTTTAGAAGAAATTATGGAAAGTCCGGAA
AAGTTAAGAGATTTAGACTTGGAAGCATTTGCAGAGGAATTAAAACGAAC
AGAGCATGGCTCGAAACATATAACTCTAAATGATATCAGAAAGGAATTAA
CAAATCGTTTTGAAGATTCTCGTCCTAAATTTCGTTCTTTGGATCCTAAA
GAAAGATTTGAATTACTAACAAAGGAAACATCAGAAACATTAGATGTTGG
TACATTAGTTGAAGCTAGGGTCGTTTCTCTTGCTCACAAAAAGCCACAGC
AGGATCAACTGGACCATGCAAGTCCAAAAAGAAATGAGAATACCGGATAT
TGGATTTGCCCATTCTGTTTTCAAGATACATTCCCTGAACTGAATAATGT
CTGGCAACATTTCGATACTCAAGAGTGTCCTGGAAAAGTAATTGGCGTGT
ATTGCGAATTACACAACAGGATTCGTGCGTTTCTAGCAACGAAAAACATA
TCAGACAACCATGTAACAAACATTCTGGATCGCCTGGAATTGGACATGAT
GGTTCAGGCGAGAGTTCTTAAGGTCGATTACGAACGGTTGCAATTGGAAA
TTTCGACAAAGTCTACAGACTTACAAGATCTTAATAGGGCATGGAGAAAA
CAAAAGGACATGTATTATGACGAATTTGCTGAAAATCAGGATAAACAATT
GATTGAAGAGAAATTGGAAAAGCAAAAGAAAATTTTACCCTACGTCAATC
GGGTTATATTTCATCCTCAGTTTAAAAATATCACTTATAATGATTTTGAA
AAAATGTGTCCAAGACTGGAAATCGGGGAATTTATTATCAGGCCCAGCAG
TAAGGGAGCAAATCATTTGACAGTAAGTTGGAAAGTCGACGAAAATGTCG
TTCGTCACATAGACGTTATCGAAGAAGACAAAGATAACGATTTCTCTCTC
GGTAATACATTGGTTATAGAAGGTGAAAAGTTTGAAGATCTCGATGAGAT
AATTGCCAGTTACGTTCAACCAATGGCAAATTTCGCCCGAGAAGTCCAAA
GCTATAAATACTACAAAAAAATCGACGGCGACAACAAAAACTTACTTGTC
GACATGATTCGCGCCGAGAAAACCACCAATCCGAATAAAATCCCCTATTT
CATTGCCCCGTTGCGCAAATATCCGGGTCGGTTTATCATTGTGTACATGC
CGGATTCCAAGGAGAGATTCGATCAGTTTAAGATCACTCCGAAAGGTTTC
ATGTTCAGGAATATTTGTTTCACTTTCCTCATCAATTTGATTGATTATTT
CAAAGCACATTTCAATGACCGTCCGTCGACGAGAACCACTCCAGGCACAT
ATTCTCGCACCCCGATGATTGGATCGACACCGACATTTGGCACCCCTGCC
AGCAGAACTCCCAAGGCCAGTGGCGGCAAATGGTACAATGCTAATTCTTC
AGGCCCCGAAACTCCGAGCTATTGATTGTATATATTTATTATCAATATAT
TTCTTGTGTATTATTACTTGTGTATAAATCGATTTTCACTGTGTCCGGTG
ATGACGTCATCGGGAATGACATAAGATATATGTTGATTGGAAATATAATT
GGAG
back to top

protein sequence of SMED30020054-orf-1

>SMED30020054-orf-1 ID=SMED30020054-orf-1|Name=SMED30020054-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1494bp
MAEFFDSEADESVESNLSDKGKDREIDSSDDEIENEEELLKKEAEGFIVD
EEIEEEEEEVESDGDDKEDDDSELDIRNEVADLLEQPKKRSRLQRESDDE
DDISEKRFKMTNVDEDIVDEVEGPNLGSDEEDEDDLRNFIVDANDSRSAR
KSSKKTVIHDDPLTQEAQELFGVDLEDLEELTLNNLDEEDYSEDELDSNA
DSLTIRTRKEKEAVDVMDVFDPTELDRGFYTAKDEKIKKIDIPERFQLRS
VPFEPLDPNSANFKNDLKEIEEEAKWMYQELFASKSMKKDETIDIIKEVL
NLIKVQLFEPPFIATYRKEYIESVGDFRFSLTLEDLWSIYFMDEKWIRIN
SRRKNQLSIFEKLTKFLERVKDSSVDGNFDLSEQLKAKLNISEIKPPYEL
VEFVKTAESMEALKDCSEYFTMYYKNINEVNLEEPEVIEPNNLNKRLKPS
KSNPFTVGRKAKLDKFIRYFGLNAQQFGEHVRDQYAVHEVDHCPMTPADA
AEEFICSHFATRDLVLKGVRAMLAYQISCEPEVRKNLRNRFWHDGSITLT
PTKKGKDEIDEQHPLYLMKYLLDKPINSFTDDYSFLLIENGSQDHLITYK
IYLPERAYSNILDKYKSFFHRDEYNIIAQQWNEQRALVIKQALDDFLIPL
VTKEMRHRLLKDAQESLTNQICDKIFQSINVQPFIQSTEKDDNYDEKNFY
GRILGITYTIATNRNEESYAFAAIIDGSGDVIDKAKLTGIMYGLRRKNFV
SDAKKKDVERLTDMILKHRPNAVAIATDSLVAGDLQFEITQLISSLEKVH
DLNPTPVELVDNEVAIIYQNSKTSQSDFPNYPSLLRQAISIARRLQDPLA
EFAQLMNVDQDLMNLRLHPLQETLNKDNLLRKIEVQFVNVVNKVGVDINY
CITHKNRLALLQFVCGLGPRKADYLVKTIKKSLELLPSRNLIIQQCDVGP
KVGMNCLGFIKINHLMDIDYDDFQRELLDSTRIHPESYELAKKMAIDALE
WDDRDNQAAALEEIMESPEKLRDLDLEAFAEELKRTEHGSKHITLNDIRK
ELTNRFEDSRPKFRSLDPKERFELLTKETSETLDVGTLVEARVVSLAHKK
PQQDQLDHASPKRNENTGYWICPFCFQDTFPELNNVWQHFDTQECPGKVI
GVYCELHNRIRAFLATKNISDNHVTNILDRLELDMMVQARVLKVDYERLQ
LEISTKSTDLQDLNRAWRKQKDMYYDEFAENQDKQLIEEKLEKQKKILPY
VNRVIFHPQFKNITYNDFEKMCPRLEIGEFIIRPSSKGANHLTVSWKVDE
NVVRHIDVIEEDKDNDFSLGNTLVIEGEKFEDLDEIIASYVQPMANFARE
VQSYKYYKKIDGDNKNLLVDMIRAEKTTNPNKIPYFIAPLRKYPGRFIIV
YMPDSKERFDQFKITPKGFMFRNICFTFLINLIDYFKAHFNDRPSTRTTP
GTYSRTPMIGSTPTFGTPASRTPKASGGKWYNANSSGPETPSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0032968positive regulation of transcription elongation from RNA polymerase II promoter
GO:0006139nucleobase-containing compound metabolic process
GO:0032784regulation of DNA-templated transcription, elongation
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006414translational elongation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR041692HHH_9
IPR042066Spt6_death-like
IPR037027YqgF/RNaseH-like_dom_sf
IPR023319Tex-like_HTH_dom_sf
IPR035420Spt6_SH2
IPR035018Spt6_SH2_C
IPR035019Spt6_SH2_N
IPR000980SH2
IPR012340NA-bd_OB-fold
IPR028231Spt6_YqgF
IPR006641YqgF/RNaseH-like_dom
IPR028088Spt6_HTH_DNA-bd_dom
IPR027999Spt6_dom
IPR023323Tex-like_dom_sf
IPR017072TF_Spt6
IPR032706Spt6_HHH
IPR023097Tex_RuvX-like_dom
IPR003029S1_domain
IPR010994RuvA_2-like
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding
GO:0003746translation elongation factor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1196..1216
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 1148..1210
e-value: 6.3E-6
score: 27.9
NoneNo IPR availableGENE3DG3DSA:1.10.150.850coord: 219..965
e-value: 2.4E-198
score: 663.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..135
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 77..116
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1447..1493
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 13..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 49..76
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 117..135
NoneNo IPR availableSUPERFAMILYSSF158832Tex N-terminal region-likecoord: 290..669
IPR000980SH2 domainSMARTSM00252SH2_5coord: 1257..1346
e-value: 1.3E-5
score: 34.6
IPR000980SH2 domainPROSITEPS50001SH2coord: 1255..1340
score: 9.856
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 1244..1348
e-value: 1.6E-37
score: 129.6
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 1260..1342
IPR041692HHH domain 9PFAMPF17674HHH_9coord: 976..1060
e-value: 1.9E-8
score: 35.1
IPR042066Spt6, Death-like domainGENE3DG3DSA:1.10.10.2740coord: 971..1059
e-value: 2.4E-198
score: 663.1
IPR028088Helix-turn-helix DNA-binding domain of Spt6PFAMPF14641HTH_44coord: 268..364
e-value: 2.5E-16
score: 60.1
IPR028231Transcription elongation factor Spt6, YqgF domainPFAMPF14639YqgFcoord: 702..855
e-value: 8.0E-34
score: 116.6
IPR037027YqgF/RNase H-like domain superfamilyGENE3DG3DSA:3.30.420.140coord: 689..1079
e-value: 2.4E-198
score: 663.1
IPR032706Transcription elongation factor Spt6, helix-hairpin-helix motifPFAMPF14635HHH_7coord: 860..963
e-value: 2.8E-29
score: 101.5
IPR023319Tex-like protein, HTH domain superfamilyGENE3DG3DSA:1.10.10.650coord: 253..430
e-value: 2.4E-198
score: 663.1
IPR035420Spt6, SH2 domainPFAMPF14633SH2_2coord: 1224..1439
e-value: 7.6E-68
score: 228.1
IPR023323Tex-like domain superfamilyGENE3DG3DSA:1.10.3500.10coord: 431..894
e-value: 2.4E-198
score: 663.1
IPR017072Transcription elongation factor Spt6PIRSFPIRSF036947Spt6coord: 4..1486
e-value: 0.0
score: 1221.1
IPR017072Transcription elongation factor Spt6PANTHERPTHR10145TRANSCRIPTION ELONGATION FACTOR SPT6coord: 9..1445
IPR003029S1 domainPROSITEPS50126S1coord: 1151..1206
score: 10.189
IPR035018Spt6, SH2 domain, C terminusCDDcd09928SH2_Cterm_SPT6_likecoord: 1349..1440
e-value: 1.2366E-18
score: 79.9617
IPR035019Spt6, SH2 domain, N terminusCDDcd09918SH2_Nterm_SPT6_likecoord: 1257..1340
e-value: 7.13171E-37
score: 131.976
IPR010994RuvA domain 2-likeSUPERFAMILYSSF47781RuvA domain 2-likecoord: 976..1061
IPR010994RuvA domain 2-likeSUPERFAMILYSSF47781RuvA domain 2-likecoord: 871..963
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 1151..1208
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 718..856