B9 domain-containing protein 1

Overview
NameB9 domain-containing protein 1
Smed IDSMED30020039
Length (bp)691
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of B9 domain-containing protein 1 (SMED30020039) t-SNE clustered cells

Violin plots show distribution of expression levels for B9 domain-containing protein 1 (SMED30020039) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of B9 domain-containing protein 1 (SMED30020039) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for B9 domain-containing protein 1 (SMED30020039) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020039

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30020039SMESG000017059.1 dd_Smed_v4_5678_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020039SMESG000017059.1 dd_Smed_v4_5678_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020039SMESG000017059.1 dd_Smed_v4_5678_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020039SMESG000017059.1 dd_Smed_v6_5678_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30020039SMESG000017059.1 dd_Smed_v4_5678_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of B9 domain-containing protein 1 vs. Ensembl Human
Match: B9D1 (B9 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:24123])

HSP 1 Score: 239.965 bits (611), Expect = 4.187e-80
Identity = 108/186 (58.06%), Postives = 138/186 (74.19%), Query Frame = 3
Query:   48 MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEV 605
            MA    S  FL+  NGQ+ESA+FP +D ++C+YCF YG+DW   AG+EE  +Q   K+ D R   ++NFPID+TFKS  P GWPQI++  YG DVFG DV+RGYGA H+P  PG+H R I MFVPES+  L KF +W MG+RPE+ +P+VVA GE R+VT+VR+QGFVTL FNVV K+MRKLGY+ 
Sbjct:    1 MATASPS-VFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMRKLGYDT 185          
BLAST of B9 domain-containing protein 1 vs. Ensembl Human
Match: B9D1 (B9 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:24123])

HSP 1 Score: 197.208 bits (500), Expect = 1.672e-63
Identity = 84/151 (55.63%), Postives = 110/151 (72.85%), Query Frame = 3
Query:   69 ECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRD 521
              FL+  NGQ+ESA+FP +D ++C+YCF YG+DW   AG+EE  +Q   K+ D R   ++NFPID+TFKS  P GWPQI++  YG DVFG DV+RGYGA H+P  PG+H R I MFVPES+  L KF +W MG+RPE+ +P+VVA GE R+
Sbjct:    7 SVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSWFMGRRPEYTDPKVVAQGEGRE 157          
BLAST of B9 domain-containing protein 1 vs. Ensembl Human
Match: B9D1 (B9 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:24123])

HSP 1 Score: 196.438 bits (498), Expect = 1.710e-63
Identity = 84/150 (56.00%), Postives = 110/150 (73.33%), Query Frame = 3
Query:   75 FLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDV 524
            FL+  NGQ+ESA+FP +D ++C+YCF YG+DW   AG+EE  +Q   K+ D R   ++NFPID+TFKS  P GWPQI++  YG DVFG DV+RGYGA H+P  PG+H R I MFVPES+  L KF +W MG+RPE+ +P+VVA GE R+ 
Sbjct:    9 FLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSWFMGRRPEYTDPKVVAQGEGREA 158          
BLAST of B9 domain-containing protein 1 vs. Ensembl Human
Match: B9D1 (B9 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:24123])

HSP 1 Score: 196.052 bits (497), Expect = 4.468e-63
Identity = 84/150 (56.00%), Postives = 110/150 (73.33%), Query Frame = 3
Query:   72 CFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRD 521
             FL+  NGQ+ESA+FP +D ++C+YCF YG+DW   AG+EE  +Q   K+ D R   ++NFPID+TFKS  P GWPQI++  YG DVFG DV+RGYGA H+P  PG+H R I MFVPES+  L KF +W MG+RPE+ +P+VVA GE R+
Sbjct:    8 VFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSWFMGRRPEYTDPKVVAQGEGRE 157          
BLAST of B9 domain-containing protein 1 vs. Ensembl Human
Match: B9D1 (B9 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:24123])

HSP 1 Score: 195.667 bits (496), Expect = 7.044e-63
Identity = 84/149 (56.38%), Postives = 110/149 (73.83%), Query Frame = 3
Query:   75 FLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRD 521
            FL+  NGQ+ESA+FP +D ++C+YCF YG+DW   AG+EE  +Q   K+ D R   ++NFPID+TFKS  P GWPQI++  YG DVFG DV+RGYGA H+P  PG+H R I MFVPES+  L KF +W MG+RPE+ +P+VVA GE R+
Sbjct:    9 FLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSWFMGRRPEYTDPKVVAQGEGRE 157          
BLAST of B9 domain-containing protein 1 vs. Ensembl Celegans
Match: mksr-1 (MecKel Syndrome 1 (MKS1)-Related [Source:UniProtKB/TrEMBL;Acc:Q21191])

HSP 1 Score: 88.9669 bits (219), Expect = 2.106e-21
Identity = 46/172 (26.74%), Postives = 85/172 (49.42%), Query Frame = 3
Query:   66 SECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIF-NFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLK 578
            ++  +++ +G + + EFP    +  +       DW ++ G   + +  + +  D +   IF + P +   K   P  WP++++  +  D  G+D + GYG   IP +PGKH  ++  F+PE S  + +  A L     EFV+P + A  + R   +  T+G+V L  NV +K
Sbjct:    4 ADSIVLTIHGNVRTTEFPEESNVCVKLSTVATGDWKIINGETVSLSSFSFRGADNQ---IFIDLPFECGLKGSSPFMWPRLVLNCFSKDHSGKDCVTGYGMLPIPTEPGKHVCRVHCFLPEPSSTVQQLIAKLRRVNAEFVDPMLPANADGRYACRTSTKGYVDLEINVSIK 172          
BLAST of B9 domain-containing protein 1 vs. Ensembl Celegans
Match: mksr-2 (MecKel Syndrome 1 (MKS1)-Related [Source:UniProtKB/TrEMBL;Acc:Q9N423])

HSP 1 Score: 74.7146 bits (182), Expect = 1.623e-16
Identity = 48/172 (27.91%), Postives = 77/172 (44.77%), Query Frame = 3
Query:   81 VSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLG 596
            V  +GQI SA   G + +  RY   +G  W VV G  E  TQT   +  E +   F  PID+   +    GWP++++  +  D +G+  I GYG   +P  PGKH      + P+ S      +  L+G   +  +   +     R+     + G V    N++ KN ++ G
Sbjct:    4 VFVSGQILSARGFGDNRLSIRYQLSFGGGWRVVQGESEGQTQTDCPSVFENAH--FAHPIDLHLATSSIQGWPRLLLQIWHHDNYGRQEIAGYGTLLLPTSPGKHVLTSGCWRPKGSWREEMMHK-LVGGGLQLTSLSALEDPSIREKIVSVSAGVVKFELNIITKNFQRYG 172          
BLAST of B9 domain-containing protein 1 vs. Ensembl Fly
Match: B9d1 (gene:FBgn0038342 transcript:FBtr0083145)

HSP 1 Score: 103.219 bits (256), Expect = 1.199e-26
Identity = 60/199 (30.15%), Postives = 99/199 (49.75%), Query Frame = 3
Query:   45 VMAAGDVSECFLVSTNGQIESAEFP-GFD--YIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLH-----IFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPM----QPGKHTRKI--AMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGY 599
             M A   +  F +S  GQI SA FP G D  +++ RY    G DW + +G +   TQ A      R  H     +FN PI++T+KS  P GWPQI++  +G    G++ + GY   H+P+    +P   T ++   + +P+    +A   +WL+ + PE  +P+V+          + + G +    + V++  RKLGY
Sbjct:   43 AMDAKATASYFSLSIVGQIVSATFPLGPDKEFVFLRYEMVAGPDWQLSSGPQHGLTQLA----TNRRGHFNEPIVFNMPIEVTYKSTSPYGWPQILVTVFGRSGLGRETLLGYAHIHLPVFGSRRPADQTEQLQAPILMPKCPNMMADITSWLLRREPELKDPKVLLDNLKCKGLSMESYGSLQFQLSSVMRGARKLGY 237          
BLAST of B9 domain-containing protein 1 vs. Ensembl Fly
Match: B9d2 (gene:FBgn0261683 transcript:FBtr0303078)

HSP 1 Score: 66.2402 bits (160), Expect = 2.577e-13
Identity = 40/170 (23.53%), Postives = 72/170 (42.35%), Query Frame = 3
Query:   93 GQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            GQI  A      +++C++  + G  W +V G  E   Q+ + +   +S   F  P+DI   +    GWP++++  Y V+V  Q    GYG  H+P  PG H  +I  +    +           G         ++ +G  R   +  + G V +  N++ +   + G E
Sbjct:    8 GQILKAVDFAEPHLYCKWSLQSGNAWRLVQG--EVQGQSHVASHRLQSSSDFAQPLDIHLSTASVQGWPRLLVEVYAVNVLQQSWPVGYGFVHVPSTPGTHRLEIGTWKVAPNGLWQSLRERFGGGGAALSKTDLLYSGVERYKLQTLSSGKVIVELNLIFRKFDEYGVE 175          
BLAST of B9 domain-containing protein 1 vs. Ensembl Zebrafish
Match: b9d1 (B9 protein domain 1 [Source:NCBI gene;Acc:554150])

HSP 1 Score: 236.884 bits (603), Expect = 4.410e-79
Identity = 107/180 (59.44%), Postives = 136/180 (75.56%), Query Frame = 3
Query:   72 CFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVS 611
             FL+  NGQIESA+FP +D ++C+YCF YG DW   +G+EE  +Q   K    +SL ++NFP+DITFKS  P GWPQI++  YG D FG DV+RGYGA HIP  PGKHT+ I MFVPES+  L KF +WLMG+RPEF +P+VVA GE R+VT+VR+QGFVTL FN+V K+M+KLGY+  S
Sbjct:    8 VFLLMVNGQIESADFPEYDDLYCKYCFVYGHDWAPTSGLEEGISQITSKGRLSQSL-VWNFPLDITFKSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTKTIPMFVPESTSRLQKFTSWLMGRRPEFTDPKVVAQGEGREVTRVRSQGFVTLQFNIVTKDMKKLGYDTTS 186          
BLAST of B9 domain-containing protein 1 vs. Ensembl Zebrafish
Match: b9d1 (B9 protein domain 1 [Source:NCBI gene;Acc:554150])

HSP 1 Score: 189.504 bits (480), Expect = 5.460e-61
Identity = 87/143 (60.84%), Postives = 109/143 (76.22%), Query Frame = 3
Query:  183 GVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVS 611
            G+EE  +Q   K    +SL ++NFP+DITFKS  P GWPQI++  YG D FG DV+RGYGA HIP  PGKHT+ I MFVPES+  L KF +WLMG+RPEF +P+VVA GE R+VT+VR+QGFVTL FN+V K+M+KLGY+  S
Sbjct:    3 GLEEGISQITSKGRLSQSL-VWNFPLDITFKSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTKTIPMFVPESTSRLQKFTSWLMGRRPEFTDPKVVAQGEGREVTRVRSQGFVTLQFNIVTKDMKKLGYDTTS 144          
BLAST of B9 domain-containing protein 1 vs. Ensembl Zebrafish
Match: b9d2 (B9 domain containing 2 [Source:NCBI gene;Acc:436667])

HSP 1 Score: 75.485 bits (184), Expect = 1.269e-16
Identity = 42/170 (24.71%), Postives = 81/170 (47.65%), Query Frame = 3
Query:   93 GQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            GQI  A     + ++C++    G  W +++G+ E  TQ  +  P    +  ++ PID+ + +    GWP++ +  +  D FG+  + GYG  H+P  PG+H  +   + P  S    + +   +G  P+  +P ++ +G  R        G V L   ++L++  + G E
Sbjct:    8 GQIIGATGFPQNSLFCKWGVHTGGAWRLLSGLREGQTQVDM--PQTGDMAYWSHPIDLHYTTKGLQGWPKLHLQVWHQDSFGRCQLYGYGYIHVPSSPGQHRLQCVTWRPLGSW-QDQLSEMFVGGGPQLRSPDLIYSGADRYRLHTVGMGTVELELCIILRHFDRYGVE 174          
BLAST of B9 domain-containing protein 1 vs. Ensembl Zebrafish
Match: b9d2 (B9 domain containing 2 [Source:NCBI gene;Acc:436667])

HSP 1 Score: 75.485 bits (184), Expect = 1.269e-16
Identity = 42/170 (24.71%), Postives = 81/170 (47.65%), Query Frame = 3
Query:   93 GQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            GQI  A     + ++C++    G  W +++G+ E  TQ  +  P    +  ++ PID+ + +    GWP++ +  +  D FG+  + GYG  H+P  PG+H  +   + P  S    + +   +G  P+  +P ++ +G  R        G V L   ++L++  + G E
Sbjct:    8 GQIIGATGFPQNSLFCKWGVHTGGAWRLLSGLREGQTQVDM--PQTGDMAYWSHPIDLHYTTKGLQGWPKLHLQVWHQDSFGRCQLYGYGYIHVPSSPGQHRLQCVTWRPLGSW-QDQLSEMFVGGGPQLRSPDLIYSGADRYRLHTVGMGTVELELCIILRHFDRYGVE 174          
BLAST of B9 domain-containing protein 1 vs. Ensembl Xenopus
Match: b9d1 (B9 protein domain 1 [Source:NCBI gene;Acc:549063])

HSP 1 Score: 229.95 bits (585), Expect = 3.395e-76
Identity = 107/196 (54.59%), Postives = 139/196 (70.92%), Query Frame = 3
Query:   45 VMAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVSQNAINSN 632
             MA+G     FL++ +GQIESAEFP FD ++C+Y F YG DW   +GVEE  +Q   K+   +   ++NFPI+ITFKS  P GWPQI+I  YG D FG DV+RGYGA H+P  PG+H R I MFVPESS  L +F +W MG+RPEF +P+VVA GE R+VT+VR+QG VT+SFNVV K+++KLGY   S +  N+ 
Sbjct:    5 AMASG--PSVFLLNVSGQIESAEFPEFDDLYCKYSFVYGHDWAPTSGVEEGISQITSKSQGGKQALVWNFPIEITFKSTNPFGWPQIVISVYGPDAFGNDVVRGYGAVHLPFTPGRHARTIPMFVPESSSRLQRFTSWFMGRRPEFTDPKVVAQGEGREVTRVRSQGCVTVSFNVVTKDLKKLGYNTGSGDFPNAT 198          
BLAST of B9 domain-containing protein 1 vs. Ensembl Xenopus
Match: cdh13 (cadherin 13 [Source:Xenbase;Acc:XB-GENE-5752189])

HSP 1 Score: 73.9442 bits (180), Expect = 7.110e-16
Identity = 46/171 (26.90%), Postives = 79/171 (46.20%), Query Frame = 3
Query:   93 GQIESAE-FPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            GQI  A  FP    ++C++    G  W +++GV E  TQ  +  P    +  ++ PID+ F +    GWP++ +  +  D FG++ + GY   HIP  PG H+     + P  +    +     +G  P+  +  ++  G  R   +    G V L   V+L+N  + G E
Sbjct:    8 GQIIGASGFPQHS-LFCKWGVHTGGAWKLLSGVVEGQTQ--VDRPQNDDMAFWSHPIDMHFATKGLQGWPKLHLQVWHQDTFGRNELYGYSFLHIPSTPGTHSLLSPTWRPLGTW-QEQICQMFVGGGPQLKSSSLIYGGSDRYRLQTVAMGQVHLQLTVILRNFERYGVE 174          
BLAST of B9 domain-containing protein 1 vs. Ensembl Mouse
Match: B9d1 (B9 protein domain 1 [Source:MGI Symbol;Acc:MGI:1351471])

HSP 1 Score: 241.506 bits (615), Expect = 8.006e-81
Identity = 108/185 (58.38%), Postives = 140/185 (75.68%), Query Frame = 3
Query:   48 MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            MAA   S  FL+   GQ+ESA+FP +D ++C+YCF YG+DW   AG+EE  +Q A K+ D R   ++NFPID+TFKS  P GWPQI++  YG DVFG DV+RGYGA H+P+ PG+H R I MFVPES+  L KF +W MG+RPE+ +P+VVA GE R+VT+VR+QGFVTL FNVV K+M+KLGY+
Sbjct:    1 MAAASPS-VFLLMITGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQIASKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPLSPGRHKRTIPMFVPESTSTLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMKKLGYD 184          
BLAST of B9 domain-containing protein 1 vs. Ensembl Mouse
Match: B9d1 (B9 protein domain 1 [Source:MGI Symbol;Acc:MGI:1351471])

HSP 1 Score: 122.865 bits (307), Expect = 1.807e-35
Identity = 56/98 (57.14%), Postives = 72/98 (73.47%), Query Frame = 3
Query:  342 DVIRGYGACHIPMQPGK----------HTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEV 605
            DV+RGYGA H+P+ PG+          H R I MFVPES+  L KF +W MG+RPE+ +P+VVA GE R+VT+VR+QGFVTL FNVV K+M+KLGY+ 
Sbjct:    2 DVVRGYGAVHVPLSPGRTSLYENICFRHKRTIPMFVPESTSTLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMKKLGYDT 99          
BLAST of B9 domain-containing protein 1 vs. Ensembl Mouse
Match: B9d2 (B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:2387643])

HSP 1 Score: 80.4925 bits (197), Expect = 1.704e-18
Identity = 48/176 (27.27%), Postives = 82/176 (46.59%), Query Frame = 3
Query:   81 VSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESS--QGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            V   GQI  A       ++C++    G  W +++GV E  TQ  + TP    +  ++ PID+ F +    GWP++ +  +  D FG+  + GYG CH+P  PG H      + P  S  + LA+     +G  P+ ++   + +G  R        G V L   ++L++  + G E
Sbjct:    4 VHVIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVREGQTQ--VDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPLGSWREQLARA---FVGGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGLLLRHFDRYGVE 174          
BLAST of B9 domain-containing protein 1 vs. Ensembl Mouse
Match: B9d2 (B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:2387643])

HSP 1 Score: 80.4925 bits (197), Expect = 1.704e-18
Identity = 48/176 (27.27%), Postives = 82/176 (46.59%), Query Frame = 3
Query:   81 VSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESS--QGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            V   GQI  A       ++C++    G  W +++GV E  TQ  + TP    +  ++ PID+ F +    GWP++ +  +  D FG+  + GYG CH+P  PG H      + P  S  + LA+     +G  P+ ++   + +G  R        G V L   ++L++  + G E
Sbjct:    4 VHVIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVREGQTQ--VDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPLGSWREQLARA---FVGGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGLLLRHFDRYGVE 174          
BLAST of B9 domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|P0C5J2|B9D1_RAT (B9 domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=B9d1 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.261e-80
Identity = 109/185 (58.92%), Postives = 140/185 (75.68%), Query Frame = 3
Query:   48 MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            MAA   S  FL+  NGQ+ESA+FP +D ++C+YCF YG+DW   AG+EE  +Q A K+ D R   ++NFPID+TFKS  P GWPQI++  YG DVFG DV+RGYGA H+P  PG+H R I MFVPES+  L KF +W MG+RPE+ +P+VVA GE R+VT+VR+QGFVTL FNVV K+M+KLGY+
Sbjct:    1 MAAASPS-VFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQIASKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSTLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMKKLGYD 184          
BLAST of B9 domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9R1S0|B9D1_MOUSE (B9 domain-containing protein 1 OS=Mus musculus OX=10090 GN=B9d1 PE=1 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 5.600e-80
Identity = 108/185 (58.38%), Postives = 140/185 (75.68%), Query Frame = 3
Query:   48 MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            MAA   S  FL+   GQ+ESA+FP +D ++C+YCF YG+DW   AG+EE  +Q A K+ D R   ++NFPID+TFKS  P GWPQI++  YG DVFG DV+RGYGA H+P+ PG+H R I MFVPES+  L KF +W MG+RPE+ +P+VVA GE R+VT+VR+QGFVTL FNVV K+M+KLGY+
Sbjct:    1 MAAASPS-VFLLMITGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQIASKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPLSPGRHKRTIPMFVPESTSTLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMKKLGYD 184          
BLAST of B9 domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9UPM9|B9D1_HUMAN (B9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=B9D1 PE=1 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 2.011e-79
Identity = 108/186 (58.06%), Postives = 138/186 (74.19%), Query Frame = 3
Query:   48 MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEV 605
            MA    S  FL+  NGQ+ESA+FP +D ++C+YCF YG+DW   AG+EE  +Q   K+ D R   ++NFPID+TFKS  P GWPQI++  YG DVFG DV+RGYGA H+P  PG+H R I MFVPES+  L KF +W MG+RPE+ +P+VVA GE R+VT+VR+QGFVTL FNVV K+MRKLGY+ 
Sbjct:    1 MATASPS-VFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMRKLGYDT 185          
BLAST of B9 domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q503B7|B9D1_DANRE (B9 domain-containing protein 1 OS=Danio rerio OX=7955 GN=b9d1 PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 2.589e-78
Identity = 107/180 (59.44%), Postives = 136/180 (75.56%), Query Frame = 3
Query:   72 CFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVS 611
             FL+  NGQIESA+FP +D ++C+YCF YG DW   +G+EE  +Q   K    +SL ++NFP+DITFKS  P GWPQI++  YG D FG DV+RGYGA HIP  PGKHT+ I MFVPES+  L KF +WLMG+RPEF +P+VVA GE R+VT+VR+QGFVTL FN+V K+M+KLGY+  S
Sbjct:    8 VFLLMVNGQIESADFPEYDDLYCKYCFVYGHDWAPTSGLEEGISQITSKGRLSQSL-VWNFPLDITFKSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTKTIPMFVPESTSRLQKFTSWLMGRRPEFTDPKVVAQGEGREVTRVRSQGFVTLQFNIVTKDMKKLGYDTTS 186          
BLAST of B9 domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q6DFD7|B9D1_XENLA (B9 domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=b9d1 PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 3.379e-76
Identity = 106/190 (55.79%), Postives = 139/190 (73.16%), Query Frame = 3
Query:   48 MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVSQN 617
            MA+G     FL++ +GQIESAEFP FD ++C+Y F YG DW   +G+EE  +Q   K+   +   ++NFP++ITFKS  P GWPQI+I  YG DVFG DV+RGYGA H+P  PG+HTR I MFVPESS  L +F +W MG+RPEF +P+VVA GE R+VT+VR+QG VT+SFNVV K+++KLGY   S +
Sbjct:    1 MASG--PSVFLLNVSGQIESAEFPEFDDLYCKYSFVYGHDWAPTSGIEEGISQITSKSQGGKQTLVWNFPVEITFKSTNPYGWPQIVISVYGPDVFGNDVVRGYGAVHLPFTPGRHTRTIPMFVPESSSRLQRFTSWFMGRRPEFTDPKVVAQGEGREVTRVRSQGCVTVSFNVVTKDLKKLGYNTGSSD 188          
BLAST of B9 domain-containing protein 1 vs. TrEMBL
Match: A0A2C9JLS2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106059348 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.710e-84
Identity = 115/193 (59.59%), Postives = 148/193 (76.68%), Query Frame = 3
Query:   48 MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVSQNAIN 626
            MAA  V   FLV  NGQIESAEFP FD I+C+YCF YG DW + +G+EE+ TQ   K+ D+    ++NFPID TFKS  PSGWPQ+++YAYG+D FG DV+RGYG CHIP+ PG+H  KI MFVPESS    K  AW +G+RPE+VNPRVVA GE R+VT+VR+QGFVT+SFN+++K+M+KLGY+++  +  N
Sbjct:    3 MAAPSV---FLVMINGQIESAEFPEFDDIYCKYCFSYGLDWAITSGLEESITQITKKSRDQYQRFVWNFPIDATFKSTSPSGWPQLVVYAYGLDAFGTDVVRGYGVCHIPITPGRHKLKIPMFVPESSSLFQKLTAWFLGRRPEYVNPRVVAQGEGREVTRVRSQGFVTVSFNIIMKDMKKLGYDILPSDVQN 192          
BLAST of B9 domain-containing protein 1 vs. TrEMBL
Match: A0A210QX18 (B9 domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05362 PE=4 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 5.451e-84
Identity = 111/178 (62.36%), Postives = 144/178 (80.90%), Query Frame = 3
Query:   75 FLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVV 608
            FL+   GQIESAEFP FD I+C+YCF YG DW + +G+EE  TQ   K+ D+R   ++NFP+DITFKS  P GWPQ++I+ YG+DVFGQDV+RGYG CH+P+ PG+H RK+ MFVPES+  L KF AW +G+RPEFV+P+VVA GE R+VT+VR+QGFVT+SFNVV K+M+KLGY+V+
Sbjct:   24 FLLMAGGQIESAEFPEFDDIYCKYCFTYGSDWLITSGLEEGITQITKKSKDDRQEFVWNFPLDITFKSTNPHGWPQLVIHCYGIDVFGQDVVRGYGMCHVPITPGRHKRKVPMFVPESASALQKFTAWFLGRRPEFVDPKVVAQGEGREVTRVRSQGFVTVSFNVVSKDMKKLGYDVI 201          
BLAST of B9 domain-containing protein 1 vs. TrEMBL
Match: A0A433TW30 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_006456 PE=4 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 7.189e-83
Identity = 108/184 (58.70%), Postives = 145/184 (78.80%), Query Frame = 3
Query:   75 FLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVSQNAIN 626
            FL+  +GQIESAEFP FD I+C+YCF YG DW + +G++E+ TQ   K+ DE    ++NFPID TFKS  PSGWPQ+++YAYG+D FG DV+RGYG CHIP+ PG+H  ++ MFVPESS  L K  AW +G+RPE+VNPRVVA GE R+VT+VRTQGF+T+SFN+++K+M+KLGY+++  +  N
Sbjct:    7 FLLMVSGQIESAEFPEFDDIYCKYCFSYGLDWAITSGLDESITQITKKSRDEHQRFVWNFPIDATFKSTSPSGWPQLVVYAYGLDAFGTDVVRGYGVCHIPITPGRHRLRLPMFVPESSSLLQKLTAWFLGRRPEYVNPRVVAQGEGREVTRVRTQGFLTVSFNIIMKDMKKLGYDILPSDLQN 190          
BLAST of B9 domain-containing protein 1 vs. TrEMBL
Match: V3ZIT4 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_184197 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.189e-82
Identity = 111/190 (58.42%), Postives = 149/190 (78.42%), Query Frame = 3
Query:   48 MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVSQN 617
            MA+  V   FL+  +GQIESAEFP FD ++CRYCF +G+DW + +G+EE  TQ   K+ DE+   ++NFPIDITFKS  PSGWPQI+++AYG DVFG DV+RGYG CH+P+ PG+H  KI MFVPESS    K  +W +G+RPE+++PRVVA GE R+VT+VR+QGF+TLSFNVV+K+M+KLGY+++  +
Sbjct:    1 MASNSV---FLLMVSGQIESAEFPEFDDVYCRYCFTHGQDWLITSGLEEGITQVTKKSQDEKQRFVWNFPIDITFKSTNPSGWPQIVVHAYGPDVFGTDVVRGYGNCHVPITPGRHKLKIPMFVPESSSAFQKLTSWFLGRRPEYIDPRVVAQGEGREVTRVRSQGFLTLSFNVVMKDMKKLGYDILPSD 187          
BLAST of B9 domain-containing protein 1 vs. TrEMBL
Match: A0A4E0RQD3 (B9 protein domain 1 [Latimeria chalumnae] OS=Fasciola hepatica OX=6192 GN=D915_001286 PE=4 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 7.879e-82
Identity = 108/178 (60.67%), Postives = 139/178 (78.09%), Query Frame = 3
Query:   72 CFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEV 605
            CF++S  GQI  A+FPG +YIWC+YCF YG+DW+ +AG+EE  TQT+LK  D    HIFNFP+D+++KS  PSGWPQ++++AYG+D FG+DVIRGYGA H+PM+ G H R I MFVP+SS  L + NAW  GKRPEFVNPRV+A+G+ R VT+V+TQGFV + FNV  KN+  LGY V
Sbjct:    7 CFMLSVTGQISHAQFPGCNYIWCKYCFSYGRDWSNIAGMEEGMTQTSLKGSDPSQGHIFNFPLDVSWKSSNPSGWPQLVVHAYGLDFFGKDVIRGYGAVHVPMESGSHKRTIPMFVPQSSSVLMQLNAWFSGKRPEFVNPRVIASGDGRKVTRVKTQGFVDVIFNVATKNLHSLGYRV 184          
BLAST of B9 domain-containing protein 1 vs. Ensembl Cavefish
Match: b9d1 (B9 domain containing 1 [Source:NCBI gene;Acc:103038659])

HSP 1 Score: 229.95 bits (585), Expect = 2.042e-76
Identity = 101/180 (56.11%), Postives = 132/180 (73.33%), Query Frame = 3
Query:   72 CFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVS 611
             FL+  +GQIE A+FP +D ++C+YCF YG DW   +G+EE  +Q   K        ++NFP+DITFKS  P GWPQI++  YG D FG DV+RGYGA HIP  PGKHTR I MFVPES+  L KF +WLMG+RPE+ +P+VVA GE R+VT+VR+QGFVTL F+++ K+M+KLGY+  S
Sbjct:    8 VFLLMISGQIEGAQFPEYDDLYCKYCFVYGHDWAPTSGLEEGISQITSKGRGSTQSLVWNFPLDITFKSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTRTIPMFVPESTSRLQKFTSWLMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLQFSIITKDMKKLGYDTTS 187          
BLAST of B9 domain-containing protein 1 vs. Ensembl Cavefish
Match: b9d1 (B9 domain containing 1 [Source:NCBI gene;Acc:103038659])

HSP 1 Score: 217.238 bits (552), Expect = 1.256e-71
Identity = 95/167 (56.89%), Postives = 123/167 (73.65%), Query Frame = 3
Query:  111 EFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVS 611
            EFP +D ++C+YCF YG DW   +G+EE  +Q   K        ++NFP+DITFKS  P GWPQI++  YG D FG DV+RGYGA HIP  PGKHTR I MFVPES+  L KF +WLMG+RPE+ +P+VVA GE R+VT+VR+QGFVTL F+++ K+M+KLGY+  S
Sbjct:    4 EFPEYDDLYCKYCFVYGHDWAPTSGLEEGISQITSKGRGSTQSLVWNFPLDITFKSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTRTIPMFVPESTSRLQKFTSWLMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLQFSIITKDMKKLGYDTTS 170          
BLAST of B9 domain-containing protein 1 vs. Ensembl Cavefish
Match: b9d2 (B9 domain containing 2 [Source:NCBI gene;Acc:103043513])

HSP 1 Score: 78.9518 bits (193), Expect = 5.367e-18
Identity = 47/172 (27.33%), Postives = 84/172 (48.84%), Query Frame = 3
Query:   93 GQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESS--QGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            GQI  A       ++C++    G  W +++G++E  TQ  +  P       ++ PID+ + +    GWP++ +  +  D FG+  + GYG CHIP  PG+H  + A + P  +  + LA+     +G  P+  +P ++ +G  R        G V L   V+L++  + G E
Sbjct:    8 GQIVGASGFPQSSLFCKWGVHTGGAWRLLSGLKEGQTQVDM--PQIGDTAYWSHPIDLHYTTKGLQGWPKLHLQVWYQDSFGRCELYGYGYCHIPSSPGQHRLQCATWRPLGTWQEQLAQM---FVGGGPQLRSPDLIYSGADRYRLHTVAMGNVELDLCVILRHFDRYGVE 174          
BLAST of B9 domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO44485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP3])

HSP 1 Score: 233.417 bits (594), Expect = 4.974e-78
Identity = 105/183 (57.38%), Postives = 140/183 (76.50%), Query Frame = 3
Query:   54 AGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            AG  S  FLV  +GQIESA FP FD ++C++ F YG+DW V +G EE  +Q   K+ D+R + ++NFPIDITFKS  P GWPQI+I  YG+D+F +DV+RGYGA H+P  PG H+R+I MFVPESS  L K  +WL+G+RPEFV+P+VVA GE R+VT+VR+QG V ++FNVV ++M+KLGY+
Sbjct:    2 AGLHSSVFLVMVSGQIESASFPEFDDLYCKFGFVYGQDWVVTSGWEEGISQVTKKSMDKRQIVVWNFPIDITFKSTSPFGWPQIVISCYGLDMFNRDVVRGYGAIHVPTTPGSHSREIPMFVPESSSKLQKLTSWLLGRRPEFVDPKVVAQGEGREVTRVRSQGRVKVTFNVVTRDMKKLGYD 184          
BLAST of B9 domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO46834 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP12])

HSP 1 Score: 85.5001 bits (210), Expect = 6.700e-21
Identity = 46/168 (27.38%), Postives = 77/168 (45.83%), Query Frame = 3
Query:   99 IESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            I ++ FP  + ++C++       W ++AG++E  TQ  +  P       +  PID+ F +    GWP+     +  D +G++ I GYG CH+P  PG H      + P  S    +   + +G  P+  +  V+ +G  R   K    G V L   +V +N  K G E
Sbjct:   11 IGASGFPSHN-LYCKWSVHVEGSWKLIAGLKEGQTQ--VDNPQNEEEAKWGHPIDLHFATKGLKGWPKFHFQVWHQDAYGRNEIYGYGYCHVPTSPGSHKIDCVTWRPTGSW-REQLRTFFVGGAPQLKSSDVIYSGSDRYRLKTEAMGTVHLQLGIVTRNFDKFGIE 174          
BLAST of B9 domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO26199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP12])

HSP 1 Score: 85.5001 bits (210), Expect = 6.700e-21
Identity = 46/168 (27.38%), Postives = 77/168 (45.83%), Query Frame = 3
Query:   99 IESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            I ++ FP  + ++C++       W ++AG++E  TQ  +  P       +  PID+ F +    GWP+     +  D +G++ I GYG CH+P  PG H      + P  S    +   + +G  P+  +  V+ +G  R   K    G V L   +V +N  K G E
Sbjct:   11 IGASGFPSHN-LYCKWSVHVEGSWKLIAGLKEGQTQ--VDNPQNEEEAKWGHPIDLHFATKGLKGWPKFHFQVWHQDAYGRNEIYGYGYCHVPTSPGSHKIDCVTWRPTGSW-REQLRTFFVGGAPQLKSSDVIYSGSDRYRLKTEAMGTVHLQLGIVTRNFDKFGIE 174          
BLAST of B9 domain-containing protein 1 vs. Ensembl Medaka
Match: b9d1 (B9 domain containing 1 [Source:NCBI gene;Acc:101164060])

HSP 1 Score: 227.254 bits (578), Expect = 2.075e-75
Identity = 102/190 (53.68%), Postives = 140/190 (73.68%), Query Frame = 3
Query:   48 MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVSQN 617
            MA+ + S  FL++ NGQIE A FP +D ++C+Y + YG DW +  G+EE  TQ   K+   R+L ++NFP++ TFKS  PSGWPQI+I  YG DVFG DV+RGYGA HIP+ PG+HT+ I MFVPE +  L KF  WL+G+RPE+ +P+VVA GE R+VT+VR+QGFVT+SF++  K+M+K+GY+    N
Sbjct:    1 MASSNPS-LFLLTVNGQIEGANFPEYDSLYCKYSYVYGHDWAITTGLEEGITQITCKSSLSRTL-VWNFPLETTFKSTNPSGWPQIVISVYGPDVFGNDVVRGYGATHIPITPGQHTKTIPMFVPEPTWRLQKFTGWLLGRRPEYTDPKVVAQGEGREVTRVRSQGFVTVSFHITTKDMKKMGYDTGPSN 188          
BLAST of B9 domain-containing protein 1 vs. Ensembl Medaka
Match: b9d1 (B9 domain containing 1 [Source:NCBI gene;Acc:101164060])

HSP 1 Score: 153.295 bits (386), Expect = 2.440e-46
Identity = 72/136 (52.94%), Postives = 95/136 (69.85%), Query Frame = 3
Query:   48 MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNA 455
            MA+ + S  FL++ NGQIE A FP +D ++C+Y + YG DW +  G+EE  TQ   K+   R+L ++NFP++ TFKS  PSGWPQI+I  YG DVFG DV+RGYGA HIP+ PG+HT+ I MFVPE +  L KF  
Sbjct:    1 MASSNPS-LFLLTVNGQIEGANFPEYDSLYCKYSYVYGHDWAITTGLEEGITQITCKSSLSRTL-VWNFPLETTFKSTNPSGWPQIVISVYGPDVFGNDVVRGYGATHIPITPGQHTKTIPMFVPEPTWRLQKFTG 134          
BLAST of B9 domain-containing protein 1 vs. Ensembl Medaka
Match: b9d2 (B9 domain containing 2 [Source:NCBI gene;Acc:436667])

HSP 1 Score: 82.4185 bits (202), Expect = 4.778e-19
Identity = 44/170 (25.88%), Postives = 83/170 (48.82%), Query Frame = 3
Query:   93 GQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            GQI  A     + ++C++    G  W +++G++E  TQ  +  P   ++  ++ PID+ F +    GWP++ +  +  D FG+  + GYG CH+P  PG H  +   + P  S    +     +G  P+  +P ++ +G  R   +    G V L   V++++  K G +
Sbjct:   37 GQILGARGFPQNSLFCKWGVHTGGAWRLLSGLKEGQTQVDI--PQTGNMAYWSHPIDLQFATKGLQGWPKLHLQVWHQDSFGRCQLYGYGYCHVPCSPGTHRIECVTWRPLGSW-QEQITQMFVGGGPQLRSPDLIYSGADRYRLQTEAMGTVELELGVIMRHFDKYGVD 203          
BLAST of B9 domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000017059.1 (SMESG000017059.1)

HSP 1 Score: 413.305 bits (1061), Expect = 3.849e-149
Identity = 196/196 (100.00%), Postives = 196/196 (100.00%), Query Frame = 3
Query:   48 MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVSQNAINSNE 635
            MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVSQNAINSNE
Sbjct:    1 MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVSQNAINSNE 196          
BLAST of B9 domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000000764.1 (SMESG000000764.1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.755e-24
Identity = 51/170 (30.00%), Postives = 83/170 (48.82%), Query Frame = 3
Query:   93 GQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYE 602
            GQI  A     + ++C++   YG  W V++G+EE  TQ  +   D+  +  F  PID+   +    GWP++    +  D  G+  + GYG C +P  PG H   +  + P SS    +     +G  P+   P +V +GE R   +  + G V L+ NV+ +NM + G E
Sbjct:    8 GQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDD--IAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIE 175          
BLAST of B9 domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000058562.1 (SMESG000058562.1)

HSP 1 Score: 47.3654 bits (111), Expect = 4.637e-6
Identity = 43/167 (25.75%), Postives = 71/167 (42.51%), Query Frame = 3
Query:  132 IWCRYCFEYGKDWNVVAGVEEAHTQTAL---KTPDERSLHIFNFPIDITF---KSCYPSG-------WPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVN---PRVVATGESRDVTK----VRTQGFVTLSFNVV 572
            I+ +Y  +  +DW +V+ +E+    T L   KT     L  F FPI+      K+ Y          WP I I  + +D + +    GYG   IP  PG H R +  + P S+    +   + +G   E  +     + AT E + ++K      + G+V L  N +
Sbjct:  302 IYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 467          
BLAST of B9 domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000058562.1 (SMESG000058562.1)

HSP 1 Score: 46.9802 bits (110), Expect = 4.830e-6
Identity = 43/167 (25.75%), Postives = 71/167 (42.51%), Query Frame = 3
Query:  132 IWCRYCFEYGKDWNVVAGVEEAHTQTAL---KTPDERSLHIFNFPIDITF---KSCYPSG-------WPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVN---PRVVATGESRDVTK----VRTQGFVTLSFNVV 572
            I+ +Y  +  +DW +V+ +E+    T L   KT     L  F FPI+      K+ Y          WP I I  + +D + +    GYG   IP  PG H R +  + P S+    +   + +G   E  +     + AT E + ++K      + G+V L  N +
Sbjct:  302 IYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIKWPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELEDLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 467          
The following BLAST results are available for this feature:
BLAST of B9 domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B9D14.187e-8058.06B9 domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
B9D11.672e-6355.63B9 domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
B9D11.710e-6356.00B9 domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
B9D14.468e-6356.00B9 domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
B9D17.044e-6356.38B9 domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of B9 domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mksr-12.106e-2126.74MecKel Syndrome 1 (MKS1)-Related [Source:UniProtK... [more]
mksr-21.623e-1627.91MecKel Syndrome 1 (MKS1)-Related [Source:UniProtK... [more]
back to top
BLAST of B9 domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
B9d11.199e-2630.15gene:FBgn0038342 transcript:FBtr0083145[more]
B9d22.577e-1323.53gene:FBgn0261683 transcript:FBtr0303078[more]
back to top
BLAST of B9 domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
b9d14.410e-7959.44B9 protein domain 1 [Source:NCBI gene;Acc:554150][more]
b9d15.460e-6160.84B9 protein domain 1 [Source:NCBI gene;Acc:554150][more]
b9d21.269e-1624.71B9 domain containing 2 [Source:NCBI gene;Acc:43666... [more]
b9d21.269e-1624.71B9 domain containing 2 [Source:NCBI gene;Acc:43666... [more]
back to top
BLAST of B9 domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
b9d13.395e-7654.59B9 protein domain 1 [Source:NCBI gene;Acc:549063][more]
cdh137.110e-1626.90cadherin 13 [Source:Xenbase;Acc:XB-GENE-5752189][more]
back to top
BLAST of B9 domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
B9d18.006e-8158.38B9 protein domain 1 [Source:MGI Symbol;Acc:MGI:135... [more]
B9d11.807e-3557.14B9 protein domain 1 [Source:MGI Symbol;Acc:MGI:135... [more]
B9d21.704e-1827.27B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:238... [more]
B9d21.704e-1827.27B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:238... [more]
back to top
BLAST of B9 domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0C5J2|B9D1_RAT2.261e-8058.92B9 domain-containing protein 1 OS=Rattus norvegicu... [more]
sp|Q9R1S0|B9D1_MOUSE5.600e-8058.38B9 domain-containing protein 1 OS=Mus musculus OX=... [more]
sp|Q9UPM9|B9D1_HUMAN2.011e-7958.06B9 domain-containing protein 1 OS=Homo sapiens OX=... [more]
sp|Q503B7|B9D1_DANRE2.589e-7859.44B9 domain-containing protein 1 OS=Danio rerio OX=7... [more]
sp|Q6DFD7|B9D1_XENLA3.379e-7655.79B9 domain-containing protein 1 OS=Xenopus laevis O... [more]
back to top
BLAST of B9 domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JLS21.710e-8459.59Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A210QX185.451e-8462.36B9 domain-containing protein 1 OS=Mizuhopecten yes... [more]
A0A433TW307.189e-8358.70Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
V3ZIT41.189e-8258.42Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A4E0RQD37.879e-8260.67B9 protein domain 1 [Latimeria chalumnae] OS=Fasci... [more]
back to top
BLAST of B9 domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
b9d12.042e-7656.11B9 domain containing 1 [Source:NCBI gene;Acc:10303... [more]
b9d11.256e-7156.89B9 domain containing 1 [Source:NCBI gene;Acc:10303... [more]
b9d25.367e-1827.33B9 domain containing 2 [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of B9 domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B9 domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B9 domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO444854.974e-7857.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468346.700e-2127.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261996.700e-2127.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of B9 domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
b9d12.075e-7553.68B9 domain containing 1 [Source:NCBI gene;Acc:10116... [more]
b9d12.440e-4652.94B9 domain containing 1 [Source:NCBI gene;Acc:10116... [more]
b9d24.778e-1925.88B9 domain containing 2 [Source:NCBI gene;Acc:43666... [more]
back to top
BLAST of B9 domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000017059.13.849e-149100.00SMESG000017059.1[more]
SMESG000000764.14.755e-2430.00SMESG000000764.1[more]
SMESG000058562.14.637e-625.75SMESG000058562.1[more]
SMESG000058562.14.830e-625.75SMESG000058562.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020039 ID=SMED30020039|Name=B9 domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=691bp
CTTAATCAAAATAGTTTTAATGCATCATTTTTGTTTAATGTATTGTCATG
GCAGCTGGTGATGTTTCAGAATGTTTTTTAGTATCGACAAATGGTCAAAT
TGAATCAGCAGAATTTCCAGGTTTTGATTATATTTGGTGCAGATATTGTT
TTGAATATGGAAAAGACTGGAATGTTGTTGCGGGAGTTGAAGAAGCCCAT
ACTCAGACTGCTTTAAAAACTCCTGATGAAAGATCTTTGCATATTTTTAA
TTTTCCAATCGATATAACATTTAAATCTTGTTATCCATCTGGATGGCCAC
AGATTATTATTTATGCTTATGGTGTTGATGTGTTCGGCCAAGATGTAATC
AGAGGTTATGGTGCTTGTCATATCCCAATGCAGCCAGGAAAACATACCAG
AAAAATTGCAATGTTTGTTCCTGAATCATCTCAAGGTTTGGCTAAATTTA
ATGCCTGGCTTATGGGAAAACGGCCGGAATTCGTTAATCCTCGAGTTGTT
GCAACTGGAGAAAGCCGAGACGTAACCAAAGTGAGAACTCAAGGATTTGT
CACGTTGTCATTCAATGTCGTGCTGAAAAATATGAGAAAACTCGGATACG
AAGTTGTTTCACAAAATGCAATCAATTCCAATGAATAAATATTTCGTTAT
GTTTTGATTGGCTAATTAGATTTTTAATGATTTGCGAGATC
back to top

protein sequence of SMED30020039-orf-1

>SMED30020039-orf-1 ID=SMED30020039-orf-1|Name=SMED30020039-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=197bp
MAAGDVSECFLVSTNGQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEA
HTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDV
IRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRV
VATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVSQNAINSNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR010796B9_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005856cytoskeleton
GO:0035869ciliary transition zone
GO:0036038MKS complex
GO:0036064ciliary basal body
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0007224smoothened signaling pathway
GO:0030030cell projection organization
GO:0060271cilium morphogenesis
Vocabulary: molecular function
TermDefinition
GO:0008158hedgehog receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010796B9 domainPFAMPF07162B9-C2coord: 13..175
e-value: 3.8E-46
score: 157.4
IPR010796B9 domainPANTHERPTHR12968ENDOTHELIAL PROTEIN B9-RELATEDcoord: 6..188
IPR010796B9 domainPROSITEPS51381B9coord: 10..128
score: 36.111
NoneNo IPR availablePANTHERPTHR12968:SF1B9 DOMAIN-CONTAINING PROTEIN 1coord: 6..188