DNA polymerase subunit gamma

Overview
NameDNA polymerase subunit gamma
Smed IDSMED30020035
Length (bp)3490
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA polymerase subunit gamma (SMED30020035) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA polymerase subunit gamma (SMED30020035) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA polymerase subunit gamma (SMED30020035) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA polymerase subunit gamma (SMED30020035) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020035

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020035SMESG000050799.1 SmedASXL_016611SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30020035SMESG000050799.1 dd_Smed_v4_13411_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020035SMESG000050799.1 dd_Smed_v4_13411_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020035SMESG000050799.1 dd_Smed_v4_13411_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30020035SMESG000050799.1 dd_Smed_v4_13411_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA polymerase subunit gamma vs. Ensembl Human
Match: POLG (DNA polymerase gamma, catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9179])

HSP 1 Score: 429.869 bits (1104), Expect = 5.077e-130
Identity = 230/489 (47.03%), Postives = 288/489 (58.90%), Query Frame = 3
Query: 2118 IPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV---RTS------------KENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKG---------------------KRSQGKWVD------------------------------GIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 3383
            IP  WF  LPH+ G    VGSPF+K FL  M+ G L +          +E  K   FWRN   R+ SQ +V   R++            +E    AI+PQV+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLGD+   G+HG T FGWM LQG K  GTDLHSKT+  +GISR  AK+ NY R+YGAG   +   L+++N  L  QEA  K + +   TKG                      R++G W+                               G ESE+F+KLE IA SD P TPVL   +S+ALE   V E+FMTS+ NWVVQSS VDYLH +L   K L + + ++ R CI IHDE+RYL  E+D+YR AL LQI NL TR +F+ KL L DLPQS+AFFS +DID CLRK  T DC TPSN  G+   Y I +GE+L+IYQI++ T G L+
Sbjct:  744 IPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLE 1232          

HSP 2 Score: 275.404 bits (703), Expect = 1.443e-75
Identity = 160/435 (36.78%), Postives = 232/435 (53.33%), Query Frame = 3
Query:  204 NSSDDKLRINMMNIQMINKKFQETIFGSKS--TAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKS--LASKEKEYINDPWLWDLDW 1475
            +S   +LR N ++IQM+++   E IFG       E          +   +  +      +V+  LPPL G+N++ H +  A+  + PY+     L   ++P  P  W++ EGWT+Y     +   V++PEE  L+FDVE          +AVA+  S WYSW S+ L++      S++   DLIPL      S P       + +VGH VSFDRA IR++Y I+G+  RF+DTMSM +AI G++S QRSL I+      + +        S +         I   D WL  +S+NSL +V++ Y     L   K+ RE F+KGT+ DI  +FQ LM YCA DV  T ++FQ+    +  R PHP +  GMLEMG  YLPVN N   Y+  A  TYE + ++ K+ LM+LA  +  L S E+ Y  DPWLWDL+W
Sbjct:   63 SSEGGQLRHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGP-EGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGP--AISSWD-WLDISSVNSLAEVHRLYVGGPPLE--KEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGER-YKEDPWLWDLEW 490          

HSP 3 Score: 56.6102 bits (135), Expect = 2.985e-7
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK-NENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L  + ++ + T  P L++ Q  +  K++ L WDG PLHY +++ WG L+PG
Sbjct:  568 GHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPG 626          
BLAST of DNA polymerase subunit gamma vs. Ensembl Human
Match: POLG (DNA polymerase gamma, catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9179])

HSP 1 Score: 429.869 bits (1104), Expect = 5.077e-130
Identity = 230/489 (47.03%), Postives = 288/489 (58.90%), Query Frame = 3
Query: 2118 IPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV---RTS------------KENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKG---------------------KRSQGKWVD------------------------------GIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 3383
            IP  WF  LPH+ G    VGSPF+K FL  M+ G L +          +E  K   FWRN   R+ SQ +V   R++            +E    AI+PQV+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLGD+   G+HG T FGWM LQG K  GTDLHSKT+  +GISR  AK+ NY R+YGAG   +   L+++N  L  QEA  K + +   TKG                      R++G W+                               G ESE+F+KLE IA SD P TPVL   +S+ALE   V E+FMTS+ NWVVQSS VDYLH +L   K L + + ++ R CI IHDE+RYL  E+D+YR AL LQI NL TR +F+ KL L DLPQS+AFFS +DID CLRK  T DC TPSN  G+   Y I +GE+L+IYQI++ T G L+
Sbjct:  744 IPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLE 1232          

HSP 2 Score: 275.404 bits (703), Expect = 1.443e-75
Identity = 160/435 (36.78%), Postives = 232/435 (53.33%), Query Frame = 3
Query:  204 NSSDDKLRINMMNIQMINKKFQETIFGSKS--TAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKS--LASKEKEYINDPWLWDLDW 1475
            +S   +LR N ++IQM+++   E IFG       E          +   +  +      +V+  LPPL G+N++ H +  A+  + PY+     L   ++P  P  W++ EGWT+Y     +   V++PEE  L+FDVE          +AVA+  S WYSW S+ L++      S++   DLIPL      S P       + +VGH VSFDRA IR++Y I+G+  RF+DTMSM +AI G++S QRSL I+      + +        S +         I   D WL  +S+NSL +V++ Y     L   K+ RE F+KGT+ DI  +FQ LM YCA DV  T ++FQ+    +  R PHP +  GMLEMG  YLPVN N   Y+  A  TYE + ++ K+ LM+LA  +  L S E+ Y  DPWLWDL+W
Sbjct:   63 SSEGGQLRHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGP-EGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGP--AISSWD-WLDISSVNSLAEVHRLYVGGPPLE--KEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGER-YKEDPWLWDLEW 490          

HSP 3 Score: 56.6102 bits (135), Expect = 2.985e-7
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK-NENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L  + ++ + T  P L++ Q  +  K++ L WDG PLHY +++ WG L+PG
Sbjct:  568 GHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPG 626          
BLAST of DNA polymerase subunit gamma vs. Ensembl Human
Match: POLG (DNA polymerase gamma, catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9179])

HSP 1 Score: 389.037 bits (998), Expect = 5.517e-118
Identity = 217/489 (44.38%), Postives = 272/489 (55.62%), Query Frame = 3
Query: 2118 IPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV---RTS------------KENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKG---------------------KRSQGKWVD------------------------------GIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 3383
            IP  WF  LPH+ G    VGSPF+K FL  M+ G L +          +E  K   FWRN   R+ SQ +V   R++            +E    AI+PQV+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLGD+   G+HG T FGWM LQG K  GTDLHSKT+  +GISR  AK+ NY R+YGAG   +   L+++N  L  QEA  K + +   TKG                      R++G W+                               G ESE+F+KLE IA SD P TPVL   +S+ALE   V E+FMTS+ NWVVQSS VDYLH +L   K L + + ++ R CI IHDE+RYL  E+D+YR AL LQI NL T                    S +DID CLRK  T DC TPSN  G+   Y I +GE+L+IYQI++ T G L+
Sbjct:  435 IPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLT--------------------SAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLE 903          

HSP 2 Score: 130.568 bits (327), Expect = 5.527e-30
Identity = 68/147 (46.26%), Postives = 91/147 (61.90%), Query Frame = 3
Query: 1041 WLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKS--LASKEKEYINDPWLWDLDW 1475
            WL  +S+NSL +V++ Y     L   K+ RE F+KGT+ DI  +FQ LM YCA DV  T ++FQ+    +  R PHP +  GMLEMG  YLPVN N   Y+  A  TYE + ++ K+ LM+LA  +  L S E+ Y  DPWLWDL+W
Sbjct:   38 WLDISSVNSLAEVHRLYVGGPPLE--KEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGER-YKEDPWLWDLEW 181          

HSP 3 Score: 56.225 bits (134), Expect = 4.233e-7
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK-NENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L  + ++ + T  P L++ Q  +  K++ L WDG PLHY +++ WG L+PG
Sbjct:  259 GHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPG 317          
BLAST of DNA polymerase subunit gamma vs. Ensembl Human
Match: POLG (DNA polymerase gamma, catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9179])

HSP 1 Score: 345.125 bits (884), Expect = 9.149e-101
Identity = 190/422 (45.02%), Postives = 238/422 (56.40%), Query Frame = 3
Query: 2118 IPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV---RTS------------KENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKG---------------------KRSQGKWVD------------------------------GIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFS 3182
            IP  WF  LPH+ G    VGSPF+K FL  M+ G L +          +E  K   FWRN   R+ SQ +V   R++            +E    AI+PQV+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLGD+   G+HG T FGWM LQG K  GTDLHSKT+  +GISR  AK+ NY R+YGAG   +   L+++N  L  QEA  K + +   TKG                      R++G W+                               G ESE+F+KLE IA SD P TPVL   +S+ALE   V E+FMTS+ NWVVQSS VDYLH +L   K L + + ++ R CI IHDE+RYL  E+D+YR AL LQI NL T  + S
Sbjct:  611 IPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTSKIPS 1032          

HSP 2 Score: 246.514 bits (628), Expect = 1.025e-66
Identity = 142/364 (39.01%), Postives = 201/364 (55.22%), Query Frame = 3
Query:  411 NIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKS--LASKEKEYINDPWLWDLDW 1475
            N++ H +  A+  + PY+     L   ++P  P  W++ EGWT+Y     +   V++PEE  L+FDVE          +AVA+  S WYSW S+ L++      S++   DLIPL      S P       + +VGH VSFDRA IR++Y I+G+  RF+DTMSM +AI G++S QRSL I+      + +        S +         I   D WL  +S+NSL +V++ Y     L   K+ RE F+KGT+ DI  +FQ LM YCA DV  T ++FQ+    +  R PHP +  GMLEMG  YLPVN N   Y+  A  TYE + ++ K+ LM+LA  +  L S E+ Y  DPWLWDL+W
Sbjct:    1 NLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGP-EGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGP--AISSWD-WLDISSVNSLAEVHRLYVGGPPLE--KEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGER-YKEDPWLWDLEW 357          

HSP 3 Score: 56.6102 bits (135), Expect = 3.054e-7
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK-NENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L  + ++ + T  P L++ Q  +  K++ L WDG PLHY +++ WG L+PG
Sbjct:  435 GHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPG 493          
BLAST of DNA polymerase subunit gamma vs. Ensembl Human
Match: POLG (DNA polymerase gamma, catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9179])

HSP 1 Score: 276.559 bits (706), Expect = 5.332e-77
Identity = 160/435 (36.78%), Postives = 232/435 (53.33%), Query Frame = 3
Query:  204 NSSDDKLRINMMNIQMINKKFQETIFGSKS--TAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKS--LASKEKEYINDPWLWDLDW 1475
            +S   +LR N ++IQM+++   E IFG       E          +   +  +      +V+  LPPL G+N++ H +  A+  + PY+     L   ++P  P  W++ EGWT+Y     +   V++PEE  L+FDVE          +AVA+  S WYSW S+ L++      S++   DLIPL      S P       + +VGH VSFDRA IR++Y I+G+  RF+DTMSM +AI G++S QRSL I+      + +        S +         I   D WL  +S+NSL +V++ Y     L   K+ RE F+KGT+ DI  +FQ LM YCA DV  T ++FQ+    +  R PHP +  GMLEMG  YLPVN N   Y+  A  TYE + ++ K+ LM+LA  +  L S E+ Y  DPWLWDL+W
Sbjct:   63 SSEGGQLRHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGP-EGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGP--AISSWD-WLDISSVNSLAEVHRLYVGGPPLE--KEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGER-YKEDPWLWDLEW 490          

HSP 2 Score: 232.646 bits (592), Expect = 2.526e-62
Identity = 123/250 (49.20%), Postives = 153/250 (61.20%), Query Frame = 3
Query: 2118 IPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV---RTS------------KENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR 2819
            IP  WF  LPH+ G    VGSPF+K FL  M+ G L +          +E  K   FWRN   R+ SQ +V   R++            +E    AI+PQV+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLGD+   G+HG T FGWM LQG K  GTDLHSKT+  +GISR  AK+ NY R+YGAG   +   L+++N  L  QEA  K + +   TKG R
Sbjct:  744 IPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLR 993          

HSP 3 Score: 56.6102 bits (135), Expect = 2.895e-7
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK-NENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L  + ++ + T  P L++ Q  +  K++ L WDG PLHY +++ WG L+PG
Sbjct:  568 GHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPG 626          
BLAST of DNA polymerase subunit gamma vs. Ensembl Celegans
Match: polg-1 (POLG (Mitochondrial DNA POLymerase Gamma) [Source:UniProtKB/TrEMBL;Acc:Q9U208])

HSP 1 Score: 201.83 bits (512), Expect = 1.326e-52
Identity = 145/476 (30.46%), Postives = 225/476 (47.27%), Query Frame = 3
Query:  390 LPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTM---------WSFQEGWTKYD-TINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEI----CKDDLIPLYSNDDKSKPKCIVGHFVSFDRARIRDEY-CIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFP----NCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILME---LAQKSLASKEKEY---INDPWLWDLDWSTTKKSSFPKWFRVLVSK----NENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPV---WYDEKFMDISNKL 1721
            LPPL+ +N+  H    AE     Y  LL+   ++ +     +         W ++ GWT+Y  + +     +  P +++L FD+E + +      +A+A+G+  WY W S  L+      +SEI     K DLIP+    +    K I+GH V FDRAR R+ Y  I G+  RF+DTMSM I + GM   Q+SL            ++ +  ++S  + MN           W    S NSLV V+ + +P    N    S K  R +F+K  I+ I  DFQ LM+YCA D I+ A+I+ +LW ++  RFPHPA+ +GML MG++YLP+NS    +  +   T E         ++E   L  K L  + +E     ND W+W  DW+  +K S  +WF  L       N + +  +   I  +  +   +    +   PL   +   WG L+P  + PV     D  F +I  K+
Sbjct:   60 LPPLVADNVVDHFGVLAEQQTRKYKELLEKACEFDLETAKNVLEHIDKTDGWHYKTGWTRYPFSTSEPPETIDFPRDSILFFDIELVVRDGTLPTLAIALGRDAWYGWCSDRLIY-----ESEIPEIPTKADLIPI---GEIGMEKVIIGHNVGFDRARCREAYQSINGSKIRFMDTMSMSIPMYGMADHQQSLY----------EMYDVETNDSHSDWMN----------AWKGRVSKNSLVAVHDHLYPDKAINAEGFSKKTMRASFVKDPIEQIREDFQPLMSYCARDNILCAEIYFRLWPEFIKRFPHPATLSGMLNMGNVYLPINSYWKMFYEKNVQTCEQKKTAATRKIIESARLVAKRLDDEGEEIGPEKNDVWMWHHDWTFNQKQSNFEWFNKLFKARSFVNLSLDEVDSHHIALKSHLIPAIFGFVFGPFPLFKTRSKGWGFLVPN-WKPVEKALQDPNFHEIDAKI 506          

HSP 2 Score: 166.392 bits (420), Expect = 1.974e-41
Identity = 108/296 (36.49%), Postives = 155/296 (52.36%), Query Frame = 3
Query: 2040 SLYNFQMNDFSSLFAKTKCLLTENPIIP-----------FVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV-------RTSK--ENNESAIIPQVIVAGTVTRRSVERLWLTATN-STNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDSVT--------GIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKRSQGKWVD 2840
            ++  F +  F         +L E PI P            V F  L H  GEGN VG P +K F   ++   L         +++++  ++  FW +Y +R  S+  +       RT++  E  + AI   V+ AGT++RRSV +LW+T TN ST   +G+ +KAMVQ P  + +VGADVDSQEQW+AA+ GD+           + G T F  M+L GSK D TDLHS  +  + ISRN AKVLNY+R+YG+G   +   L++    LK  EA +    L K TKG  ++   VD
Sbjct:  513 AVKKFPLRSFYETVQNNVYMLGELPISPDRKGFELDEAGLVRFYQLDHPSGEGN-VGDPLTKHFAKDLKELVLRPTRYEEYFDVVLDSIQTTQFWTSYSDRYCSEVAIWSPEATWRTAENLEMIDGAIAAAVVPAGTISRRSVHKLWVTLTNQSTGHVIGTGIKAMVQAPAGYRLVGADVDSQEQWLAALYGDASAEKRLPLEKRVAGKTAFSNMMLAGSKSDNTDLHSVVASQLKISRNHAKVLNYARLYGSGETHAGKHLMRVG-GLKQSEAESTASQLFKLTKGDVAKYMKVD 806          

HSP 3 Score: 134.42 bits (337), Expect = 1.474e-31
Identity = 72/192 (37.50%), Postives = 107/192 (55.73%), Query Frame = 3
Query: 2832 WVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEK--------RVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 3383
            +V G ES  F+ LE  A + +  TP+L  +++ +L K           + K+  S  NW+VQSS VD+LH LL   + L   Y ++AR  I IHDE+RY+C+E D  RLAL LQ++NL  R+  S ++ +  LP ++AFFS++D D  LRK    + I P       +   I  G +  +  +L  TGG+LD
Sbjct:  888 FVGGYESSTFNFLETSAAAHDLRTPILGCQIADSLGKLPEGTPDSAYFDRKYKRSVMNWIVQSSAVDFLHLLLVSMQWLCDTYKIDARFVISIHDEVRYMCKEPDAPRLALALQLSNLLVRAYISQRVGICQLPNTVAFFSQVDCDTVLRKEVDTESINP-------DGSKIADGVAWTVDDLLKLTGGKLD 1072          
BLAST of DNA polymerase subunit gamma vs. Ensembl Fly
Match: tam (gene:FBgn0004406 transcript:FBtr0080571)

HSP 1 Score: 350.517 bits (898), Expect = 2.415e-102
Identity = 194/475 (40.84%), Postives = 269/475 (56.63%), Query Frame = 3
Query: 2127 VWFLPLPHEKGEGNTVGSPFSKSFLN-----YMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSKEN--NE-----------SAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR-------------------------------------SQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNE---KFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGG 3374
             +FL LPH+ G    VG+P SK FLN      + SG  +  AA  +++I     +   +WRN ++R+  Q +V    +   NE            AI PQV+  GT+TRR++E  W+TA+NS  DR+GSEL++MVQ P  + +VGADVDSQE WIA+VLGD+   G HG TP GWM L GSK +G+D+HS T+K +GISR+ AKV+NY+R+YGAG   +   L ++NP     EA  K   +   TKGKR                                      +  W  G ES +F++LEEIA   +P TP L  RLS+ALE     E   +F+ ++ NWVVQS  VD+LH +L   + L+     + R C+  HDE+RYL +E+   + AL + I NL TRS    ++ L DLP S+AFFS +++D  LRK  T DC TPSN +GL   Y IQ G+SL++ + ++K GG
Sbjct:  666 CFFLKLPHKNGPSFRVGNPLSKDFLNKFAENVLSSGDPSCQAAARVIDIA----RMMSYWRNNRDRIMGQMVVWLDSQQLPNEFTGEKCQPIAYGAICPQVVACGTLTRRAMEPTWMTASNSRPDRLGSELRSMVQAPPGYRLVGADVDSQELWIASVLGDAYACGEHGATPLGWMTLSGSKSNGSDMHSITAKAVGISRDHAKVINYARIYGAGQLFAETLLRQFNPTFSASEAKAKAMKMFSITKGKRVYRLREEFHDELEDRAYSSYEASRLAIQRNRTLAEVFHRPNWQGGTESAMFNRLEEIATGSQPRTPFLGGRLSRALEADTGPEQEQRFLPTRINWVVQSGAVDFLHLMLVSMRWLM---GSHVRFCLSFHDELRYLVKEELSPKAALAMHITNLMTRSFCVSRIGLQDLPMSVAFFSSVEVDTVLRKECTMDCKTPSNPHGLRIGYGIQPGQSLSVAEAIEKAGG 1133          

HSP 2 Score: 271.166 bits (692), Expect = 7.294e-75
Identity = 178/559 (31.84%), Postives = 259/559 (46.33%), Query Frame = 3
Query:  231 NMMNIQMINKKFQETIF--GSKSTAELDFFEINSL---FKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDW-KIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYL---------LDGICKD-DSE---ICKDDLIPLYSNDDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDWSTTKKS-------------------------------------------------SFPKWFRVLVSK----------NENSNTFNPDL--ITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIP 1664
            N++ +QMI++     +F    +S +E             +   +D E +    +V   LP L G NIE H    A+    PY  LL  L    ++P+ P  W+F  GWT YD  +     V  P E  L+FDVE      Q  V+A AV    WYSW S  L         L+ +  D DSE      D+LIPL +    + P  +VGH VS+DRAR++++Y  + TGTRF+DTMS+ + + G+TS QR++                         + +  E   E   WL ++SLNSLV+V++ Y     LS  K+ R  F++GT++ +   FQ+L  YCA+DV  T +I + L+  Y  RFPHPAS  GMLEMGS YLPVNSN   YI  A  TYE +  + K  L   A+++ +   + +Y  + WLWD DWS  +                                                    +P W+R L  K           ++   ++P    I++   IA K+L L W+G PLHY+++  WG L+P
Sbjct:   54 NLVKVQMISRNLHAQLFPQAPRSISEQQVASAKVYKDELRRHGVDIESSAPVSDVQLKLPALRGANIEEHFHNIAKEQVQPYEELLLPLVQCEQLPKRPKRWAFHTGWTAYDPEDGTATPVDHPLEKGLVFDVEVCVSEGQAPVLATAVSTKRWYSWVSSKLTKHRLSVEKLEPLDVDTDSERPHYTTDELIPLGT----TGPGLVVGHNVSYDRARLKEQYLTEDTGTRFVDTMSLHMCVSGVTSYQRAM-------------------------LKSKKEPAAEDLGWLEQSSLNSLVEVHRLYCGGDTLS--KEPRNIFVEGTLEQVRQSFQSLTNYCASDVEATHRILRVLYPLYAERFPHPASLAGMLEMGSAYLPVNSNWERYIREAQLTYEDLSIEAKYHLGRRAEEACSLLLDDQYRQNLWLWDEDWSVQELKLKQPPKRKPLPTVELKDSGNTPEERRLQAKFQHLYDQQALLPARRPLLPGYPLWYRKLCRKPPAKRADEILEDDEEPWSPGASEISTGMQIAPKLLSLCWEGYPLHYEREQGWGFLVP 581          
BLAST of DNA polymerase subunit gamma vs. Ensembl Zebrafish
Match: polg (polymerase (DNA directed), gamma [Source:ZFIN;Acc:ZDB-GENE-060303-1])

HSP 1 Score: 469.159 bits (1206), Expect = 4.359e-145
Identity = 275/701 (39.23%), Postives = 371/701 (52.92%), Query Frame = 3
Query: 1494 SFPKWFRVLVSKNENSNTFNP--DLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTKYNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSK---------------ENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR-----SQGKWV-------------------------------------------------DGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
            + P W+R L  K   +  ++P   LI+ Q  I  K++ L WDG PLHY  ++ WG L+PG           +DIS     P+ P   I   Y +Y +   ++  ++     VS      D  +     ++++  +F +  ++   P                  K IT + +  + + N E P    N   ND +               IP  WF  LPH+ G  N VGSPFSK FL+ M+SG L +          +E  K   FWRN Q R+ SQ +V   +               E    AI+PQVI AGTVTRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAA+LG++   G+HG T FGWM LQG K  GTDLHS+T+  +GISR  AKV NY R+YGAG   +   L+++N  L  QEA  K + +   TKG R      +G+W+                                                 DG ES +F+KLE IA+SD P+TPVLN R+S+ALE   V E+F+TS+ NWVVQSS VDYLH +L   + L + ++++ R CI IHDE+RYL   +D+YR AL LQI NL TR +F+ KL + DLPQS+AFFS +DID CLRK  T DC TPS+  G+   Y + +GE+L+IYQI++ T G L
Sbjct:  535 AHPSWYRKLCVKMSEAEDWSPGASLISLQMRITPKLMGLTWDGFPLHYTDQHGWGYLVPG-------RRDNLDISEDNEEPVCPYRAIESVYKEYCEQKGKEQPKY-PDSPVSDELMLTDTAVWQTVEEVSRLEMFDDEALSTAAPS-----------------KRITKKVNSVFKSLNGECPYHHGNGPYNDVN---------------IPGCWFFKLPHKDGNENNVGSPFSKDFLSKMESGTLQAGREGTNATRALEINKMISFWRNAQKRISSQMVVWLRRAELPRSVRLHQDYDEEGQYGAILPQVIPAGTVTRRAVEPTWLTASNARKDRVGSELKAMVQVPPAYHLVGADVDSQELWIAAMLGEAHFAGMHGCTAFGWMTLQGKKSQGTDLHSRTADAVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLSQQEAAGKARQMYALTKGLRRYHLSEEGEWLLQKLNVNVERAEDGSISLQDLRKISKVATQSTTRGSKKKWNLTAGRVWTDGTESYMFNKLESIAQSDRPATPVLNCRISRALEPSAVQEEFITSRVNWVVQSSAVDYLHLMLVSMRWLFEEHDIDGRFCISIHDEVRYLVTSEDRYRAALALQITNLLTRCMFAFKLGMMDLPQSVAFFSAVDIDKCLRKEVTMDCKTPSSPAGVERRYGLPQGEALDIYQIIEITKGSL 1195          

HSP 2 Score: 276.944 bits (707), Expect = 1.766e-76
Identity = 156/431 (36.19%), Postives = 242/431 (56.15%), Query Frame = 3
Query:  216 DKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSL--FKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKPK-------CIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIE-ESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDW 1475
            D+ R+N +NIQM+++  QE IF  ++    D     S+   ++  +  ++T+L  +V   LP + G NI+ H +  A+  + PY+     L   +IP+MP  W+++ GWT+Y   + +  KV+ P+EN L+FDVE          +AVA+  + WYSW S  L++      S++   DLIPL +  + S+P+        +VGH VSFDRA I+++Y +KG+  RF+DTMS+ +AI G+T  QRSL ++      +     L         +   PE  +  S +W+  +S+N+L DV+  Y     L  +K+ RE F+KG++ DI  +FQ LM YCA DV+ T ++F +    +  R PHP +  GMLEMG  YLPVN N   Y+  A  TYE + ++ K+ LM LA  +    ++  Y +DPWLWDLDW
Sbjct:   36 DQTRLNPLNIQMLSRNLQEQIFRGQTQEYTDEDVERSIRHLEHHGLWGKETSLLPDVQLRLPEMYGSNIDEHFRLLAQKQSLPYLEAASQLQKAQIPEMPQEWAWEVGWTRYGA-DGESQKVNFPDENALVFDVEVCMAEGHCPTLAVALSPTAWYSWCSHRLVEDRYAWSSDLSLADLIPLETLANSSQPRGGEWKERLVVGHNVSFDRAHIKEQYLLKGSKMRFLDTMSLHMAISGLTGFQRSLWMASKYGKRKG----LQEVKEHMKRLGRRPEGPKIGSWEWVNISSINNLADVHALYVGGDPL--MKESRELFVKGSMSDIRGNFQELMQYCALDVLATQEVFTQQLPLFMERCPHPVTLAGMLEMGVCYLPVNHNWRRYLEDAQATYEELQREMKKSLMILADDACQLLQDDRYKDDPWLWDLDW 459          
BLAST of DNA polymerase subunit gamma vs. Ensembl Xenopus
Match: tpst1 (tyrosylprotein sulfotransferase 1 [Source:Xenbase;Acc:XB-GENE-953306])

HSP 1 Score: 418.313 bits (1074), Expect = 1.341e-126
Identity = 222/482 (46.06%), Postives = 280/482 (58.09%), Query Frame = 3
Query: 2127 VWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSK---------------ENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR------------------------------------------------SQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
             WF  LPH+ G  N VGSPF+K FL  M+ G L +   ++     +E  K   FWRN   R+ SQ +V   K               EN    I+P V+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + ++GADVDSQE WIAA+LG++   GIHG T FGWM LQG K  GTDLHSKT+  +GISR  AKV NY R+YGAG   +   L+++N  L  ++A  K K +   TKG R                                                S+  W  G ES++F+KLE IA S  P TPVL   +S+ALE   V  +F+TS+ NWVVQSS VDYLH +L   K L + Y+++ R CI IHDE+RYL + KD+YR AL LQI NL TR +F+ +L + DLPQS+AFFS +DID CLRK  T DC TPSN  G+   Y I +GE+L+IYQIL  T G L
Sbjct:  670 CWFYKLPHKDGYANNVGSPFAKDFLPKMEDGTLQASIGDSSATRALEINKMISFWRNAHKRISSQMVVWMKKGELPRTITRDPEYDEENKYGCILPLVVSAGTITRRAVEPTWLTASNARADRVGSELKAMVQVPPGYHIIGADVDSQELWIAAILGEAHFAGIHGCTAFGWMTLQGKKSTGTDLHSKTASTVGISREHAKVFNYGRIYGAGQAFAERLLMQFNHRLTQEQAAEKAKQMYAVTKGIRRYILSKEGEWLVEELGIPVERGEENSVSLQDLRKIQKEASAKRKWNLVSRRIWTGGTESQMFNKLETIAMSPSPKTPVLGCHISRALEPAAVKGEFITSRINWVVQSSAVDYLHLMLVAMKWLFEAYDIDGRFCISIHDEVRYLVQSKDRYRAALALQITNLLTRCMFASRLGMQDLPQSVAFFSAVDIDKCLRKEVTMDCATPSNPTGMEKRYGIPQGEALDIYQILKVTKGVL 1151          

HSP 2 Score: 295.819 bits (756), Expect = 6.510e-83
Identity = 183/550 (33.27%), Postives = 273/550 (49.64%), Query Frame = 3
Query:  213 DDKLRINMMNIQMINKKFQETIFGSKST--AELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSN-------DDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLAS-KEKEYINDPWL----WDL-----------------------------------DWS---------------TTKKSSFPKWFRVLVSKNENSNTF-NPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
            D   R+N +NIQM++K     +F  K    AE D     +  K+ ++  ++T+   +++  LP L G +IE H Q  A+  + PY+     L + ++P MP  W++Q GWT+Y T   +   V  P+E  L+FDVE          +A AV   YWYSW S+ L++       E+   DLIPL ++        +    + +VGH +SFDRA I+++Y IKG+  RF+DTMSM +AI G+T  QR+L ++      +           +++  + SP  I   D W+  +S+N+L DV+  Y     L   K+ RE F+KG+I DI  +FQ LM YCA DV  T +IFQ+ +  +  R PHP + +GMLEMG  YLPVN N   Y++ A T+YE + K+ K+ LM LA  +     E  Y  DPWL    WD+                                   +W                +      P W+R L  K E+ +    P LI+ Q  +  K+++L WDG PLHY +K+ WG L+PG
Sbjct:   13 DVSRRMNPLNIQMLSKGLHAQVFRGKQVQHAEEDIQRSINHLKSHELWGQETSTVPDIELQLPKLYGNDIEEHFQILAQKQSLPYLEAANDLMNCQLPTMPQTWAWQSGWTRY-TATGETELVDFPDEKALVFDVEVCVSEGHCPTLAAAVSPQYWYSWCSRRLIEDRYTWSKELSLSDLIPLETSVNCNCITKNNWTERLVVGHNISFDRAHIKEQYLIKGSKMRFMDTMSMHMAISGLTGFQRTLWMASKYGKKKGLQEVKQHIKKTRSKFDGSP--ISSWD-WVNISSINNLADVHALYVGGPPLE--KEARELFVKGSISDIRTEFQELMRYCALDVQATHEIFQEQFPLFMERCPHPVTLSGMLEMGVSYLPVNQNWERYLDEAQTSYEELQKEMKKSLMNLANDACQLLTEDAYKEDPWLWDLEWDIQEFKQKKTKISKKQKRLKEAQESVGNKFIEDLNEGEWRIEDLKLKTLPLLPKRSQHLPGHPGWYRKLCPKLEDPDWLPGPSLISLQMRLTPKLMRLTWDGFPLHYSEKHGWGYLVPG 556          
BLAST of DNA polymerase subunit gamma vs. Ensembl Xenopus
Match: tpst1 (tyrosylprotein sulfotransferase 1 [Source:Xenbase;Acc:XB-GENE-953306])

HSP 1 Score: 418.698 bits (1075), Expect = 1.550e-126
Identity = 223/481 (46.36%), Postives = 282/481 (58.63%), Query Frame = 3
Query: 2127 VWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV--------RT-------SKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR-----------------------------------------------SQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
             WF  LPH+ G  N VGSPF+K FL  M+ G L +   ++     +E  K   FWRN   R+ SQ +V        RT        +EN    I+P V+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + ++GADVDSQE WIAA+LG++   GIHG T FGWM LQG K  GTDLHSKT+  +GISR  AKV NY R+YGAG   +   L+++N  L  ++A  K K +   TKG R                                               S+  W  G ES++F+KLE IA S  P TPVL   +S+ALE   V  +F+TS+ NWVVQSS VDYLH +L   K L + Y+++ R CI IHDE+RYL + KD+YR AL LQI NL TR +F+ +L + DLPQS+AFFS +DID CLRK  T DC TPSN  G+   Y I +GE+L+IYQIL  T G L
Sbjct:  696 CWFYKLPHKDGYANNVGSPFAKDFLPKMEDGTLQASIGDSSATRALEINKMISFWRNAHKRISSQMVVWMKKGELPRTITRDPEYDEENKYGCILPLVVSAGTITRRAVEPTWLTASNARADRVGSELKAMVQVPPGYHIIGADVDSQELWIAAILGEAHFAGIHGCTAFGWMTLQGKKSTGTDLHSKTASTVGISREHAKVFNYGRIYGAGQAFAERLLMQFNHRLTQEQAAEKAKQMYAVTKGIRRYILSKEGEWLVEELGIPVERGEENSVSLQDLRKIQKEASAKKWNLVSRRIWTGGTESQMFNKLETIAMSPSPKTPVLGCHISRALEPAAVKGEFITSRINWVVQSSAVDYLHLMLVAMKWLFEAYDIDGRFCISIHDEVRYLVQSKDRYRAALALQITNLLTRCMFASRLGMQDLPQSVAFFSAVDIDKCLRKEVTMDCATPSNPTGMEKRYGIPQGEALDIYQILKVTKGVL 1176          

HSP 2 Score: 276.559 bits (706), Expect = 2.947e-76
Identity = 158/427 (37.00%), Postives = 235/427 (55.04%), Query Frame = 3
Query:  225 RINMMNIQMINKKFQETIFGSKST--AELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSN-------DDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDW 1475
            R+N +NIQM++K     +F  K    AE D     +  K+ ++  ++T+   +++  LP L G +IE H Q  A+  + PY+     L + ++P MP  W++Q GWT+Y T   +   V  P+E  L+FDVE          +A AV   YWYSW S+ L++       E+   DLIPL ++        +    + +VGH +SFDRA I+++Y IKG+  RF+DTMSM +AI G+T  QR+L ++      +           +++  + SP  I   D W+  +S+N+L DV+  Y     L   K+ RE F+KG+I DI  +FQ LM YCA DV  T +IFQ+ +  +  R PHP + +GMLEMG  YLPVN N   Y++ A T+YE + K+ K+ LM LA  +     E  Y  DPWLWDL+W
Sbjct:   44 RMNPLNIQMLSKGLHAQVFRGKQVQHAEEDIQRSINHLKSHELWGQETSTVPDIELQLPKLYGNDIEEHFQILAQKQSLPYLEAANDLMNCQLPTMPQTWAWQSGWTRY-TATGETELVDFPDEKALVFDVEVCVSEGHCPTLAAAVSPQYWYSWCSRRLIEDRYTWSKELSLSDLIPLETSVNCNCITKNNWTERLVVGHNISFDRAHIKEQYLIKGSKMRFMDTMSMHMAISGLTGFQRTLWMASKYGKKKGLQEVKQHIKKTRSKFDGSP--ISSWD-WVNISSINNLADVHALYVGGPPLE--KEARELFVKGSISDIRTEFQELMRYCALDVQATHEIFQEQFPLFMERCPHPVTLSGMLEMGVSYLPVNQNWERYLDEAQTSYEELQKEMKKSLMNLANDACQLLTEDAYKEDPWLWDLEW 464          

HSP 3 Score: 60.077 bits (144), Expect = 2.604e-8
Identity = 25/59 (42.37%), Postives = 36/59 (61.02%), Query Frame = 3
Query: 1494 SFPKWFRVLVSKNENSNTF-NPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L  K E+ +    P LI+ Q  +  K+++L WDG PLHY +K+ WG L+PG
Sbjct:  528 GHPGWYRKLCPKLEDPDWLPGPSLISLQMRLTPKLMRLTWDGFPLHYSEKHGWGYLVPG 586          
BLAST of DNA polymerase subunit gamma vs. Ensembl Xenopus
Match: tpst1 (tyrosylprotein sulfotransferase 1 [Source:Xenbase;Acc:XB-GENE-953306])

HSP 1 Score: 417.542 bits (1072), Expect = 2.625e-126
Identity = 223/484 (46.07%), Postives = 282/484 (58.26%), Query Frame = 3
Query: 2127 VWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV--------RT-------SKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR--------------------------------------------------SQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
             WF  LPH+ G  N VGSPF+K FL  M+ G L +   ++     +E  K   FWRN   R+ SQ +V        RT        +EN    I+P V+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + ++GADVDSQE WIAA+LG++   GIHG T FGWM LQG K  GTDLHSKT+  +GISR  AKV NY R+YGAG   +   L+++N  L  ++A  K K +   TKG R                                                  S+  W  G ES++F+KLE IA S  P TPVL   +S+ALE   V  +F+TS+ NWVVQSS VDYLH +L   K L + Y+++ R CI IHDE+RYL + KD+YR AL LQI NL TR +F+ +L + DLPQS+AFFS +DID CLRK  T DC TPSN  G+   Y I +GE+L+IYQIL  T G L
Sbjct:  670 CWFYKLPHKDGYANNVGSPFAKDFLPKMEDGTLQASIGDSSATRALEINKMISFWRNAHKRISSQMVVWMKKGELPRTITRYPFYDEENKYGCILPLVVSAGTITRRAVEPTWLTASNARADRVGSELKAMVQVPPGYHIIGADVDSQELWIAAILGEAHFAGIHGCTAFGWMTLQGKKSTGTDLHSKTASTVGISREHAKVFNYGRIYGAGQAFAERLLMQFNHRLTQEQAAEKAKQMYAVTKGIRRYILSKEGEWLVEELGIPVERGEENSVSLQDLRKIQKEASAKSRRKWNLVSRRIWTGGTESQMFNKLETIAMSPSPKTPVLGCHISRALEPAAVKGEFITSRINWVVQSSAVDYLHLMLVAMKWLFEAYDIDGRFCISIHDEVRYLVQSKDRYRAALALQITNLLTRCMFASRLGMQDLPQSVAFFSAVDIDKCLRKEVTMDCATPSNPTGMEKRYGIPQGEALDIYQILKVTKGVL 1153          

HSP 2 Score: 276.559 bits (706), Expect = 2.689e-76
Identity = 158/427 (37.00%), Postives = 235/427 (55.04%), Query Frame = 3
Query:  225 RINMMNIQMINKKFQETIFGSKST--AELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSN-------DDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDW 1475
            R+N +NIQM++K     +F  K    AE D     +  K+ ++  ++T+   +++  LP L G +IE H Q  A+  + PY+     L + ++P MP  W++Q GWT+Y T   +   V  P+E  L+FDVE          +A AV   YWYSW S+ L++       E+   DLIPL ++        +    + +VGH +SFDRA I+++Y IKG+  RF+DTMSM +AI G+T  QR+L ++      +           +++  + SP  I   D W+  +S+N+L DV+  Y     L   K+ RE F+KG+I DI  +FQ LM YCA DV  T +IFQ+ +  +  R PHP + +GMLEMG  YLPVN N   Y++ A T+YE + K+ K+ LM LA  +     E  Y  DPWLWDL+W
Sbjct:   37 RMNPLNIQMLSKGLHAQVFRGKQVQHAEEDIQRSINHLKSHELWGQETSTVPDIELQLPKLYGNDIEEHFQILAQKQSLPYLEAANDLMNCQLPTMPQTWAWQSGWTRY-TATGETELVDFPDEKALVFDVEVCVSEGHCPTLAAAVSPQYWYSWCSRRLIEDRYTWSKELSLSDLIPLETSVNCNCITKNNWTERLVVGHNISFDRAHIKEQYLIKGSKMRFMDTMSMHMAISGLTGFQRTLWMASKYGKKKGLQEVKQHIKKTRSKFDGSP--ISSWD-WVNISSINNLADVHALYVGGPPLE--KEARELFVKGSISDIRTEFQELMRYCALDVQATHEIFQEQFPLFMERCPHPVTLSGMLEMGVSYLPVNQNWERYLDEAQTSYEELQKEMKKSLMNLANDACQLLTEDAYKEDPWLWDLEW 457          

HSP 3 Score: 60.077 bits (144), Expect = 2.612e-8
Identity = 25/59 (42.37%), Postives = 36/59 (61.02%), Query Frame = 3
Query: 1494 SFPKWFRVLVSKNENSNTF-NPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L  K E+ +    P LI+ Q  +  K+++L WDG PLHY +K+ WG L+PG
Sbjct:  521 GHPGWYRKLCPKLEDPDWLPGPSLISLQMRLTPKLMRLTWDGFPLHYSEKHGWGYLVPG 579          
BLAST of DNA polymerase subunit gamma vs. Ensembl Xenopus
Match: tpst1 (tyrosylprotein sulfotransferase 1 [Source:Xenbase;Acc:XB-GENE-953306])

HSP 1 Score: 417.542 bits (1072), Expect = 3.167e-126
Identity = 222/484 (45.87%), Postives = 280/484 (57.85%), Query Frame = 3
Query: 2127 VWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSK---------------ENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR--------------------------------------------------SQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
             WF  LPH+ G  N VGSPF+K FL  M+ G L +   ++     +E  K   FWRN   R+ SQ +V   K               EN    I+P V+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + ++GADVDSQE WIAA+LG++   GIHG T FGWM LQG K  GTDLHSKT+  +GISR  AKV NY R+YGAG   +   L+++N  L  ++A  K K +   TKG R                                                  S+  W  G ES++F+KLE IA S  P TPVL   +S+ALE   V  +F+TS+ NWVVQSS VDYLH +L   K L + Y+++ R CI IHDE+RYL + KD+YR AL LQI NL TR +F+ +L + DLPQS+AFFS +DID CLRK  T DC TPSN  G+   Y I +GE+L+IYQIL  T G L
Sbjct:  684 CWFYKLPHKDGYANNVGSPFAKDFLPKMEDGTLQASIGDSSATRALEINKMISFWRNAHKRISSQMVVWMKKGELPRTITRYPFYDEENKYGCILPLVVSAGTITRRAVEPTWLTASNARADRVGSELKAMVQVPPGYHIIGADVDSQELWIAAILGEAHFAGIHGCTAFGWMTLQGKKSTGTDLHSKTASTVGISREHAKVFNYGRIYGAGQAFAERLLMQFNHRLTQEQAAEKAKQMYAVTKGIRRYILSKEGEWLVEELGIPVERGEENSVSLQDLRKIQKEASAKSRRKWNLVSRRIWTGGTESQMFNKLETIAMSPSPKTPVLGCHISRALEPAAVKGEFITSRINWVVQSSAVDYLHLMLVAMKWLFEAYDIDGRFCISIHDEVRYLVQSKDRYRAALALQITNLLTRCMFASRLGMQDLPQSVAFFSAVDIDKCLRKEVTMDCATPSNPTGMEKRYGIPQGEALDIYQILKVTKGVL 1167          

HSP 2 Score: 275.789 bits (704), Expect = 5.309e-76
Identity = 157/427 (36.77%), Postives = 233/427 (54.57%), Query Frame = 3
Query:  225 RINMMNIQMINKKFQETIFGSKST--AELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSN-------DDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDW 1475
            R+N +NIQM++K     +F  K    AE D     +  K+ ++  ++T+   +++  LP L G +IE H Q  A+  + PY+     L + ++P MP  W++Q GWT+Y T   +   V  P+E  L+FDVE          +A AV   YWYSW S+ L++       E+   DLIPL ++        +    + +VGH +SFDRA I+++Y IKG+  RF+DTMSM +AI G+T  QR+L ++      + + +   F  SS +              W+  +S+N+L DV+  Y     L   K+ RE F+KG+I DI  +FQ LM YCA DV  T +IFQ+ +  +  R PHP + +GMLEMG  YLPVN N   Y++ A T+YE + K+ K+ LM LA  +     E  Y  DPWLWDL+W
Sbjct:   44 RMNPLNIQMLSKGLHAQVFRGKQVQHAEEDIQRSINHLKSHELWGQETSTVPDIELQLPKLYGNDIEEHFQILAQKQSLPYLEAANDLMNCQLPTMPQTWAWQSGWTRY-TATGETELVDFPDEKALVFDVEVCVSEGHCPTLAAAVSPQYWYSWCSRRLIEDRYTWSKELSLSDLIPLETSVNCNCITKNNWTERLVVGHNISFDRAHIKEQYLIKGSKMRFMDTMSMHMAISGLTGFQRTLWMASKYGKKKGQDFVRLFQISSWD--------------WVNISSINNLADVHALYVGGPPLE--KEARELFVKGSISDIRTEFQELMRYCALDVQATHEIFQEQFPLFMERCPHPVTLSGMLEMGVSYLPVNQNWERYLDEAQTSYEELQKEMKKSLMNLANDACQLLTEDAYKEDPWLWDLEW 453          

HSP 3 Score: 60.077 bits (144), Expect = 2.428e-8
Identity = 25/57 (43.86%), Postives = 36/57 (63.16%), Query Frame = 3
Query: 1500 PKWFRVLVSKNENSNTF-NPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
            P W+R L  K E+ +    P LI+ Q  +  K+++L WDG PLHY +K+ WG L+PG
Sbjct:  519 PGWYRKLCPKLEDPDWLPGPSLISLQMRLTPKLMRLTWDGFPLHYSEKHGWGYLVPG 575          
BLAST of DNA polymerase subunit gamma vs. Ensembl Xenopus
Match: tpst1 (tyrosylprotein sulfotransferase 1 [Source:Xenbase;Acc:XB-GENE-953306])

HSP 1 Score: 417.542 bits (1072), Expect = 6.616e-126
Identity = 223/484 (46.07%), Postives = 282/484 (58.26%), Query Frame = 3
Query: 2127 VWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV--------RT-------SKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR--------------------------------------------------SQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
             WF  LPH+ G  N VGSPF+K FL  M+ G L +   ++     +E  K   FWRN   R+ SQ +V        RT        +EN    I+P V+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + ++GADVDSQE WIAA+LG++   GIHG T FGWM LQG K  GTDLHSKT+  +GISR  AKV NY R+YGAG   +   L+++N  L  ++A  K K +   TKG R                                                  S+  W  G ES++F+KLE IA S  P TPVL   +S+ALE   V  +F+TS+ NWVVQSS VDYLH +L   K L + Y+++ R CI IHDE+RYL + KD+YR AL LQI NL TR +F+ +L + DLPQS+AFFS +DID CLRK  T DC TPSN  G+   Y I +GE+L+IYQIL  T G L
Sbjct:  714 CWFYKLPHKDGYANNVGSPFAKDFLPKMEDGTLQASIGDSSATRALEINKMISFWRNAHKRISSQMVVWMKKGELPRTITRDPEYDEENKYGCILPLVVSAGTITRRAVEPTWLTASNARADRVGSELKAMVQVPPGYHIIGADVDSQELWIAAILGEAHFAGIHGCTAFGWMTLQGKKSTGTDLHSKTASTVGISREHAKVFNYGRIYGAGQAFAERLLMQFNHRLTQEQAAEKAKQMYAVTKGIRRYILSKEGEWLVEELGIPVERGEENSVSLQDLRKIQKEASAKSRRKWNLVSRRIWTGGTESQMFNKLETIAMSPSPKTPVLGCHISRALEPAAVKGEFITSRINWVVQSSAVDYLHLMLVAMKWLFEAYDIDGRFCISIHDEVRYLVQSKDRYRAALALQITNLLTRCMFASRLGMQDLPQSVAFFSAVDIDKCLRKEVTMDCATPSNPTGMEKRYGIPQGEALDIYQILKVTKGVL 1197          

HSP 2 Score: 276.559 bits (706), Expect = 3.890e-76
Identity = 158/427 (37.00%), Postives = 235/427 (55.04%), Query Frame = 3
Query:  225 RINMMNIQMINKKFQETIFGSKST--AELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSN-------DDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDW 1475
            R+N +NIQM++K     +F  K    AE D     +  K+ ++  ++T+   +++  LP L G +IE H Q  A+  + PY+     L + ++P MP  W++Q GWT+Y T   +   V  P+E  L+FDVE          +A AV   YWYSW S+ L++       E+   DLIPL ++        +    + +VGH +SFDRA I+++Y IKG+  RF+DTMSM +AI G+T  QR+L ++      +           +++  + SP  I   D W+  +S+N+L DV+  Y     L   K+ RE F+KG+I DI  +FQ LM YCA DV  T +IFQ+ +  +  R PHP + +GMLEMG  YLPVN N   Y++ A T+YE + K+ K+ LM LA  +     E  Y  DPWLWDL+W
Sbjct:   44 RMNPLNIQMLSKGLHAQVFRGKQVQHAEEDIQRSINHLKSHELWGQETSTVPDIELQLPKLYGNDIEEHFQILAQKQSLPYLEAANDLMNCQLPTMPQTWAWQSGWTRY-TATGETELVDFPDEKALVFDVEVCVSEGHCPTLAAAVSPQYWYSWCSRRLIEDRYTWSKELSLSDLIPLETSVNCNCITKNNWTERLVVGHNISFDRAHIKEQYLIKGSKMRFMDTMSMHMAISGLTGFQRTLWMASKYGKKKGLQEVKQHIKKTRSKFDGSP--ISSWD-WVNISSINNLADVHALYVGGPPLE--KEARELFVKGSISDIRTEFQELMRYCALDVQATHEIFQEQFPLFMERCPHPVTLSGMLEMGVSYLPVNQNWERYLDEAQTSYEELQKEMKKSLMNLANDACQLLTEDAYKEDPWLWDLEW 464          

HSP 3 Score: 60.077 bits (144), Expect = 2.683e-8
Identity = 25/59 (42.37%), Postives = 36/59 (61.02%), Query Frame = 3
Query: 1494 SFPKWFRVLVSKNENSNTF-NPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L  K E+ +    P LI+ Q  +  K+++L WDG PLHY +K+ WG L+PG
Sbjct:  540 GHPGWYRKLCPKLEDPDWLPGPSLISLQMRLTPKLMRLTWDGFPLHYSEKHGWGYLVPG 598          
BLAST of DNA polymerase subunit gamma vs. Ensembl Mouse
Match: Polg (polymerase (DNA directed), gamma [Source:MGI Symbol;Acc:MGI:1196389])

HSP 1 Score: 454.136 bits (1167), Expect = 2.177e-139
Identity = 273/702 (38.89%), Postives = 364/702 (51.85%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK-NENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYID----YFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTKYNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV---RTS------------KENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR---------------------------------------------------SQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 3383
              P W+R L  + ++ +    P L++ Q  +  K++ L WDG PLHY   + WG L+PG         +  +++   + P +    ++  Y      Y +  L++  Q   P  V   E   +FLL+    D +     VE +  +        EN      L+         +   Y++ N  GP +  N                      IP  WF  LPH+ G    VGSPF+K FL  M+ G L +          +E  K   FWRN   R+ SQ +V   R++            +E +  AI+PQV+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  +V+VGADVDSQE WIAAVLGD+   G+HG T FGWM LQG K  GTDLHSKT+  +GISR  AK+ NY R+YGAG   +   L+++N  L  QEA  K + +   TKG R                                                   S+  W  G ESE+F+KLE IA SD P TPVL   +S+ALE  VV  +F+TS+ NWVVQSS VDYLH +L   K L + + ++ R CI IHDE+RYL  E+D+YR AL LQI NL TR +F+ KL L DLPQS+AFFS +DID CLRK  T DC TPSN  G+   Y I +GE+L+IYQI++ T G L+
Sbjct:  549 GHPGWYRKLCPRLDDPAWAPGPSLLSLQMRVTPKLMALTWDGFPLHYSDSHGWGYLVPG---------RRDNLTEPPVSPTVESAAVTCPYRAIESLYRKHCLEQGKQQLEPQEVDLAE---EFLLT----DSSAMWQTVEELGCLDVEAEAKMENSGLSQPLVLPAACAPKSSQPTYHHGN--GPYNDVN----------------------IPGCWFFKLPHKDGNNYNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRVVTRHPSFDEEGHYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYVLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTAATVGISREHAKIFNYGRIYGAGQSFAERLLMQFNHRLTRQEAAEKAQQMYAVTKGLRRYRLSADGEWLVKQLNLPVDRTEDGWVSLQDLRMIRREASRKSRWKKWEVASERAWTGGTESEMFNKLESIAMSDTPRTPVLGCCISRALEPSVVQGEFITSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDQCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLE 1210          

HSP 2 Score: 268.855 bits (686), Expect = 1.233e-73
Identity = 163/459 (35.51%), Postives = 243/459 (52.94%), Query Frame = 3
Query:  138 RFLSYSGYLPKPSNFGRLLNTANSSDDKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSL--FKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSN-------DDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISF--NNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKS--LASKEKEYINDPWLWDLDW 1475
            R++S S   P PS+        +S + +LR+N + IQM+++   E IFG       +     S+   +   +  +  T   +V+  LP L G N++ H +  A+  + PY+     L + ++P  P  W++ EGWT+Y     +   V++PEE  L+FDVE          +AVA+  S WYSW S+ L++      S++   DLIPL  +           + + +VGH VSFDRA IR++Y I+ +  RF+DTMSM +AI G++S QRSL +      + T+    +   S    NG   S  D      W+  +S N+L DV+  Y     L   K+ RE F+KG++ DI  +FQ LM YCA DV  T ++FQ+    +  R PHP +  GMLEMG  YLPVN N   Y+  A  TYE + ++ K+ LM+LA  +  L S E+ Y  DPWLWDL+W
Sbjct:   24 RWVSSSVLDPVPSDGRPPSQMPSSENGQLRLNPLLIQMLSRGLHEQIFGCGGEMPDEAAVQRSVEHLQKHGLWGQPATPLPDVELRLPRLFGGNLDQHFRLLAQKQSLPYLEAAASLLEAQLPPEPKSWAWAEGWTRYGP-EGEAEPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSRRLVEERYSWTSQLSPADLIPLGGSTSASSSTKQDGQEQLVVGHNVSFDRAHIREQYLIQDSRMRFLDTMSMHMAISGLSSFQRSLWMGAKQGKHKTQQSTKRGQKSPRKANGPAISSWD------WMDISSANNLADVHNLYVGGPPLE--KEPRELFVKGSMRDIRENFQDLMQYCARDVWATFEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLTEAQNTYEELQREMKKSLMDLANDACQLLSGER-YKEDPWLWDLEW 472          
BLAST of DNA polymerase subunit gamma vs. Ensembl Mouse
Match: Polg (polymerase (DNA directed), gamma [Source:MGI Symbol;Acc:MGI:1196389])

HSP 1 Score: 268.085 bits (684), Expect = 1.867e-78
Identity = 163/459 (35.51%), Postives = 243/459 (52.94%), Query Frame = 3
Query:  138 RFLSYSGYLPKPSNFGRLLNTANSSDDKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSL--FKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSN-------DDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISF--NNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKS--LASKEKEYINDPWLWDLDW 1475
            R++S S   P PS+        +S + +LR+N + IQM+++   E IFG       +     S+   +   +  +  T   +V+  LP L G N++ H +  A+  + PY+     L + ++P  P  W++ EGWT+Y     +   V++PEE  L+FDVE          +AVA+  S WYSW S+ L++      S++   DLIPL  +           + + +VGH VSFDRA IR++Y I+ +  RF+DTMSM +AI G++S QRSL +      + T+    +   S    NG   S  D      W+  +S N+L DV+  Y     L   K+ RE F+KG++ DI  +FQ LM YCA DV  T ++FQ+    +  R PHP +  GMLEMG  YLPVN N   Y+  A  TYE + ++ K+ LM+LA  +  L S E+ Y  DPWLWDL+W
Sbjct:   24 RWVSSSVLDPVPSDGRPPSQMPSSENGQLRLNPLLIQMLSRGLHEQIFGCGGEMPDEAAVQRSVEHLQKHGLWGQPATPLPDVELRLPRLFGGNLDQHFRLLAQKQSLPYLEAAASLLEAQLPPEPKSWAWAEGWTRYGP-EGEAEPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSRRLVEERYSWTSQLSPADLIPLGGSTSASSSTKQDGQEQLVVGHNVSFDRAHIREQYLIQDSRMRFLDTMSMHMAISGLSSFQRSLWMGAKQGKHKTQQSTKRGQKSPRKANGPAISSWD------WMDISSANNLADVHNLYVGGPPLE--KEPRELFVKGSMRDIRENFQDLMQYCARDVWATFEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLTEAQNTYEELQREMKKSLMDLANDACQLLSGER-YKEDPWLWDLEW 472          
BLAST of DNA polymerase subunit gamma vs. Ensembl Mouse
Match: Polg (polymerase (DNA directed), gamma [Source:MGI Symbol;Acc:MGI:1196389])

HSP 1 Score: 113.235 bits (282), Expect = 3.419e-29
Identity = 53/90 (58.89%), Postives = 63/90 (70.00%), Query Frame = 3
Query: 3078 ICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNI 3347
            I IHDE+RYL  E+D+YR AL LQI NL TR +F+ KL L DLPQS+AFFS +DID CLRK  T DC TPSN  G+   Y I +G  L +
Sbjct:    2 ISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDQCLRKEVTMDCKTPSNPTGMERRYGIPQGCDLEL 91          
BLAST of DNA polymerase subunit gamma vs. Ensembl Mouse
Match: Polg (polymerase (DNA directed), gamma [Source:MGI Symbol;Acc:MGI:1196389])

HSP 1 Score: 115.161 bits (287), Expect = 4.481e-29
Identity = 63/153 (41.18%), Postives = 81/153 (52.94%), Query Frame = 3
Query: 2742 KYNPELKPQEAFNKIKDLMKQTKGKR-------------------------------SQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYL 3107
            ++N  L  QEA  K + +   TKG R                               S+  W  G ESE+F+KLE IA SD P TPVL   +S+ALE  VV  +F+TS+ NWVVQSS VDYLH +L   K L + + ++ R CI IHDE+RYL
Sbjct:    2 QFNHRLTRQEAAEKAQQMYAVTKGLRRTEDGWVSLQDLRMIRREASRKSRWKKWEVASERAWTGGTESEMFNKLESIAMSDTPRTPVLGCCISRALEPSVVQGEFITSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYL 154          
BLAST of DNA polymerase subunit gamma vs. Ensembl Mouse
Match: Polg (polymerase (DNA directed), gamma [Source:MGI Symbol;Acc:MGI:1196389])

HSP 1 Score: 85.8853 bits (211), Expect = 6.787e-18
Identity = 52/181 (28.73%), Postives = 88/181 (48.62%), Query Frame = 3
Query:  138 RFLSYSGYLPKPSNFGRLLNTANSSDDKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSL--FKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYW 674
            R++S S   P PS+        +S + +LR+N + IQM+++   E IFG       +     S+   +   +  +  T   +V+  LP L G N++ H +  A+  + PY+     L + ++P  P  W++ EGWT+Y     +   V++PEE  L+FDVE          +AVA+  S W
Sbjct:   24 RWVSSSVLDPVPSDGRPPSQMPSSENGQLRLNPLLIQMLSRGLHEQIFGCGGEMPDEAAVQRSVEHLQKHGLWGQPATPLPDVELRLPRLFGGNLDQHFRLLAQKQSLPYLEAAASLLEAQLPPEPKSWAWAEGWTRYGP-EGEAEPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAW 203          
BLAST of DNA polymerase subunit gamma vs. UniProt/SwissProt
Match: sp|Q92076|DPOG1_CHICK (DNA polymerase subunit gamma-1 (Fragment) OS=Gallus gallus OX=9031 GN=POLG PE=2 SV=1)

HSP 1 Score: 457.988 bits (1177), Expect = 2.813e-146
Identity = 273/683 (39.97%), Postives = 363/683 (53.15%), Query Frame = 3
Query: 1551 NPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIP---VERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSL-GNSDLTKYNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV---------------RTSKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR-----SQGKWV-----------------------------------------------DGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 3383
             P LI+ Q  +  K+++L WDG PLHY +K+ WG L+PG        +     S +   P+ P   +ER+      Y Q  LQ+  +   P   + +E   D L+ L G+S   K     +  + +  P       +   + L   ++E    +   +++ N  GP +  N                      IP  WF  LPH+ G  N VGSPF+K FL  M+ G L +          +E  K   FWRN   RV SQ +V                 S+E +  AI+PQV+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLG++   G+HG T FGWM LQG K DGTDLHSKT+  +GISR  AKV NY R+YGAG   +   L+++N  L  Q+A  K + +   TKG R      +G+W+                                                G ESE+F+KLE IA S  P TPVL   +S+ALE  V   +F+TS+ NWVVQSS VDYLH +L   K L + Y++N R CI IHDE+RYL +E+D+YR AL LQI NL TR +F+ KL L DLPQS+AFFS +DID CLRK  T +C TPSN  G+   Y I +GE+L+IYQI++ T G L+
Sbjct:    7 GPSLISLQMRVTPKLMRLAWDGFPLHYSEKHGWGYLVPG------RQDNLPAASAEPEGPVCPHRAIERL------YRQHCLQRGQE--QPPEEAGVE---DELMVLEGSSMWQKVEELSQLELDMERPGRAEQSQMQDEDGLPELVEE---SSQPSFHHGN--GPYNDVN----------------------IPGCWFFKLPHKDGNENNVGSPFAKDFLPRMEDGTLRAAVGRTHGTRALEINKMVSFWRNAHKRVSSQVVVWLKKGELPRAVTRHPAYSEEEDYGAILPQVVTAGTITRRAVEPTWLTASNARADRVGSELKAMVQVPPGYSLVGADVDSQELWIAAVLGEAHFAGMHGCTAFGWMTLQGKKSDGTDLHSKTAATVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLTQQQAREKAQQMYAVTKGIRRFHLSEEGEWLVKELELAVDKAEDGTVSAQDVQKIQREAMRKSRRKKKWDVVAHRMWAGGTESEMFNKLESIALSASPQTPVLGCHISRALEPAVAKGEFLTSRVNWVVQSSAVDYLHLMLVSMKWLFEEYDINGRFCISIHDEVRYLVQEQDRYRAALALQITNLLTRCMFAYKLGLQDLPQSVAFFSAVDIDRCLRKEVTMNCATPSNPTGMEKKYGIPRGEALDIYQIIEITKGSLE 645          
BLAST of DNA polymerase subunit gamma vs. UniProt/SwissProt
Match: sp|Q91684|DPOG1_XENLA (DNA polymerase subunit gamma-1 OS=Xenopus laevis OX=8355 GN=polg PE=2 SV=1)

HSP 1 Score: 448.358 bits (1152), Expect = 1.396e-136
Identity = 277/700 (39.57%), Postives = 369/700 (52.71%), Query Frame = 3
Query: 1494 SFPKWFRVLVSKNENSNTF-NPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTKYNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNFQMNDFSSL----FAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV--------RT-------SKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKG------------------------------------------KRSQGK--------WVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
              P W+R L  K E+ +    P LI+ Q  +  K+++L WDG PLHY +K+ WG L+     P   + K  +   + I P  P   I   Y +Y +   +                  +F+L+  NS           M   VE ++ T  +L+          E+         N++ E P+ L   +M +F SL       + C    +  +   WF  LPH+ G  N VGSPF+K FL  M+ G L +   ++     +E  K   FWRN   R+ SQ +V        RT        +EN   AI+ QV+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + ++GADVDSQE WIAA+LG++   GIHG T FGWM LQG K  GTDLHSKT+  +GISR  AKV NY R+YGAG   +   L+++N  L  ++A  K K +   TKG                                          KRS+ K        W  G ES++F+KLE IA S  P TPVL  R+S+ALE   V  +F+TS+ NWVVQSS VDYLH +L   K L + Y+++ R CI IHDE+RYL   KD+YR AL LQI NL TR +F+ +L + D+PQS+AFFS +DID CLRK  T DC TPSN NG+   Y I +GE+L+IYQIL  T G L
Sbjct:  540 GHPGWYRKLCPKLEDPDWLPGPGLISLQMRLTPKLMRLTWDGYPLHYSEKHGWGYLV-----PGRKNNKLNNEEEEEIIPC-PYRAIEDIYAEYSKNKTKDGC------LSQHSTIPEEFMLTDDNS-----------MWQKVEELSRTEMDLSS---------EVPATAKAKKRNNSSEHPVKL---EM-EFDSLPDNHHGNSPC---GDVNVSGCWFYKLPHKDGNANNVGSPFAKDFLPKMEDGTLQASTGDSSATRALEINKMISFWRNAHKRISSQMVVWMKKNELHRTITRDPEFDEENKYGAILAQVVSAGTITRRAVEPTWLTASNARADRVGSELKAMVQVPPGYHLIGADVDSQELWIAAILGEAHFAGIHGCTAFGWMTLQGKKSSGTDLHSKTASTVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLTQEQAAEKAKQMYAVTKGIRRYILSKEGEWLVEELGISVERGEENSVNLQDLRKIQKDATKRSRRKWNLVSRRIWTGGTESQMFNKLETIAMSPSPKTPVLGCRISRALEPTAVKGEFITSRVNWVVQSSAVDYLHLMLVAMKWLFEAYDIDGRFCISIHDEVRYLVHSKDRYRAALALQITNLLTRCMFASRLGIQDVPQSVAFFSAVDIDKCLRKEVTMDCSTPSNPNGMEKRYGIPQGEALDIYQILKVTKGVL 1200          

HSP 2 Score: 284.263 bits (726), Expect = 5.567e-78
Identity = 162/427 (37.94%), Postives = 237/427 (55.50%), Query Frame = 3
Query:  225 RINMMNIQMINKKFQETIFGSKST--AELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPL-------YSNDDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLASKEKE-YINDPWLWDLDW 1475
            R+N +NIQM++K F E IF  K    AE D     +  KN ++  ++T+   +V+  LP + G NIE H Q  A+  + PY+     L + ++P MP  W++Q GWT+Y     K   V  P+E  ++FDVE          +AVA     WYSW S+ L++G      E+   DL PL       Y   +    + +VGH VSFDRA I+++Y IKG+ TRF+DTMSM +AI G+T  QR+L ++      +           +++  + SP  I   D W+  +S+N+L DV+  Y     L   K+ RE F+KG++ DI  +FQ LM YCA DV  T ++FQ+ +  +  R PHP + +GMLEMG  YLPVN N   Y++ A T+YE + K+ K+ LM+LA  +     K+ Y  DPWLWDL+W
Sbjct:   44 RMNPLNIQMLSKGFHEQIFRGKQVQHAEEDVQRSITHLKNHELWGQETSTVPDVELQLPKMYGNNIEEHFQILAQKQSLPYLEAANDLLNCQLPAMPQTWAWQSGWTRYTATGEKEL-VDFPDEKAMVFDVEVCVTEGCCPTLAVAASPQNWYSWCSRRLIEGRYTWSKELLLSDLFPLETSMNCNYMTKNNWTERLVVGHNVSFDRAHIKEQYLIKGSKTRFMDTMSMHMAISGLTGFQRTLWMASKYGKKKGLQEVKQHIKKTRSNFSGSP--ISSWD-WVNISSINNLADVHALYVGGPPLE--KEARELFVKGSMSDIRTEFQELMRYCALDVQATHEVFQEQFPLFMERCPHPVTLSGMLEMGVSYLPVNQNWERYLDEAQTSYEELQKEMKKSLMKLANDACQLLTKDAYKEDPWLWDLEW 464          
BLAST of DNA polymerase subunit gamma vs. UniProt/SwissProt
Match: sp|P54099|DPOG1_MOUSE (DNA polymerase subunit gamma-1 OS=Mus musculus OX=10090 GN=Polg PE=1 SV=3)

HSP 1 Score: 443.736 bits (1140), Expect = 1.325e-134
Identity = 272/702 (38.75%), Postives = 364/702 (51.85%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK-NENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYID----YFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTKYNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV---RTS------------KENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR---------------------------------------------------SQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 3383
              P W+R L  + ++ +    P L++ Q  +  K++ L WDG PLHY   + W     G  +P   D    +++   + P +    ++  Y      Y +  L++  Q   P  V   E   +FLL+  NS + +    VE +  +        EN      L+         +   Y++ N  GP +  N                      IP  WF  LPH+ G    VGSPF+K FL  M+ G L +          +E  K   FWRN   R+ SQ +V   R++            +E +  AI+PQV+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  +V+VGADVDSQE WIAAVLGD+   G+HG T FGWM LQG K  GTDLHSKT+  +GISR  AK+ NY R+YGAG   +   L+++N  L  QEA  K + +   TKG R                                                   ++  W  G ESE+F+KLE IA SD P TPVL   +S+ALE  VV  +F+TS+ NWVVQSS VDYLH +L   K L + + ++ R CI IHDE+RYL  E+D+YR AL LQI NL TR +F+ KL L DLPQS+AFFS +DID CLRK  T DC TPSN  G+   Y I +GE+L+IYQI++ T G L+
Sbjct:  550 GHPGWYRQLCPRLDDPAWAPGPSLLSLQMRVTPKLMALTWDGFPLHYSDSHGW-----GYLVPGRRD----NLTEPPVSPTVESAAVTCPYRAIESLYRKHCLEQGKQQLEPQEVDLAE---EFLLT-DNSAMWQT---VEELGCLDVEAEAKMENSGLSQPLVLPAACAPKSSQPTYHHGN--GPYNDVN----------------------IPGCWFFKLPHKDGNNYNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRVVTRHPAFDEEGHYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYVLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTAATVGISREHAKIFNYGRIYGAGQSFAERLLMQFNHRLTRQEAAEKAQQMYAVTKGLRRYRLSADGEWLVKQLNLPVDRTEDGWVSLQDLRMIRREASRKSRWKKWEVAAERAWTGGTESEMFNKLESIAMSDTPRTPVLGCCISRALEPSVVQGEFITSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDQCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLE 1211          

HSP 2 Score: 259.61 bits (662), Expect = 8.884e-70
Identity = 158/457 (34.57%), Postives = 240/457 (52.52%), Query Frame = 3
Query:  138 RFLSYSGYLPKPSNFGRLLNTANSSDDKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSL--FKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSN-------DDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKS--LASKEKEYINDPWLWDLDW 1475
            R+++ S   P PS+        +S + +LR+N + IQM+++   E IFG       +     S+   +   +  +  T   +V+  LP L G N++ H +  A+  + PY+     L + ++P  P  W++ EGWT+Y     +   V++PEE  L+FDVE          +AVA+  S WYSW S+ L++      S++   DLIPL  +           + + +VGH VSFDRA IR++Y I+ +  RF+DTMSM +AI G++S QRSL +       +N          ++    +       S  W+  +S N+L DV+  Y     L   K+ RE F+KG++ DI  +FQ LM YCA DV  T ++FQ+    +  R PHP +  GMLEMG  YLPVN N   Y+  A  TYE + ++ K+ LM+LA  +  L S E+ Y  DPWLWDL+W
Sbjct:   24 RWVASSVLDPVPSDGRPPSQMPSSENGQLRLNPLLIQMLSRGLHEQIFGCGGEMPDEAAVQRSVEHLQKHGLWGQPATPLPDVELRLPRLFGGNLDQHFRLLAQKQSLPYLEAAASLLEAQLPPEPKSWAWAEGWTRYGP-EGEAEPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSRRLVEERYSWTSQLSPADLIPLGGSTSASSSTKQDGQEQLVVGHNVSFDRAHIREQYLIQDSRMRFLDTMSMHMAISGLSSFQRSLWMGAKQGKHKN---PAAHKARAEVPEESQWSSESSSWDWMDISSANNLADVHNLYVGGPPLE--KEPRELFVKGSMRDIRENFQDLMQYCARDVWATFEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLTEAQNTYEELQREMKKSLMDLANDACQLLSGER-YKEDPWLWDLEW 473          
BLAST of DNA polymerase subunit gamma vs. UniProt/SwissProt
Match: sp|Q9QYV8|DPOG1_RAT (DNA polymerase subunit gamma-1 OS=Rattus norvegicus OX=10116 GN=Polg PE=2 SV=1)

HSP 1 Score: 432.18 bits (1110), Expect = 1.792e-130
Identity = 231/489 (47.24%), Postives = 290/489 (59.30%), Query Frame = 3
Query: 2118 IPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV---RTS------------KENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR---------------------------------------------------SQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 3383
            IP  WF  LPH+ G    VGSPF+K FL  M+ G L +          +E  K   FWRN   R+ SQ +V   R++            +E++  AI+PQV+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  +V+VGADVDSQE WIAAVLGD+   G+HG T FGWM LQG K  GTDLHSKT+  +GISR  AKV NY R+YGAG   +   L+++N  L  QEA +K + +   TKG R                                                   ++  W  G ESE+F+KLE IA SD P TPVL   +S+ALE  VV  +FMTS+ NWVVQSS VDYLH +L   K L + + ++ R CI IHDE+RYL  E+D+YR AL LQI NL TR +F+ KL L DLPQS+AFFS +DID CLRK  T DC TPSN  G+   Y I +GE+L+IYQI++ T G L+
Sbjct:  721 IPGCWFFKLPHKDGNNYNVGSPFAKDFLPKMEDGTLQAGPGGARGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVTRHPSFDEESHYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYVLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTAATVGISREHAKVFNYGRIYGAGQSFAERLLMQFNHRLSRQEAADKAQQMYAVTKGLRRYRLSDDGEWLVKQLNVPVDRTEDGWVSLQDLRKIRREASRKSRWKKWEVVTERAWTGGTESEMFNKLESIAMSDTPRTPVLGCCISRALEPSVVQGEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDQCLRKEVTMDCKTPSNPTGMERKYGIPQGEALDIYQIIELTKGSLE 1209          

HSP 2 Score: 280.026 bits (715), Expect = 1.551e-76
Identity = 168/457 (36.76%), Postives = 246/457 (53.83%), Query Frame = 3
Query:  138 RFLSYSGYLPKPSNFGRLLNTANSSDDKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSL--FKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPL-------YSNDDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKS--LASKEKEYINDPWLWDLDW 1475
            R++S S   P PS+        +S + +LR+N ++IQM+++   E IFG       +     S+   +   +  + TT   +V   LP L G N++ H +  A+  + PY+     L + ++P  P  W + EGWT+Y     +   V++PEE  L+FDVE          +AVA+  S WYSW S+ L++      S++   DLIPL        S     + + +VGH VSFDRA IR++Y I+G+  RF+DTMSM +AI G++S QRSL +       + +        S KN   N P  I   D W+  +S N+L DV+  Y     L+  K+ RE F+KG++ DI  +FQ LM YCA DV  T ++FQ+    +  R PHP +  GMLEMG  YLPVN N   Y+  A +TYE + ++ K+ LMELA  +  L S E+ Y  DPWLWDL+W
Sbjct:   24 RWVSSSVLDPVPSDGQPQSQMPSSENGQLRLNPLHIQMLSRGLHEQIFGCGGDVPDEAAVQRSIEHLRKHGLWGQPTTPLPDVQLRLPRLFGGNLDQHFRLLAQKQSLPYLEAAASLSEAQLPPQPRKWVWAEGWTRYGP-EGEAEPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSRRLVEERYSWTSQLSPADLIPLGVSASASSSTQQDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWMGAKQGKHKTQHPTKRGQKSQKNA--NGPA-ISSWD-WMDISSANNLADVHNLYVGGPRLA--KEPRELFVKGSMRDIRENFQDLMEYCARDVWATFEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLTEAQSTYEELQREMKKSLMELANDACQLLSGER-YKEDPWLWDLEW 472          

HSP 3 Score: 54.6842 bits (130), Expect = 6.279e-6
Identity = 22/59 (37.29%), Postives = 34/59 (57.63%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK-NENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L  + ++ + T  P L++ Q  +  K++ L WDG PLHY   + WG L+PG
Sbjct:  549 GHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSDSHGWGYLVPG 607          
BLAST of DNA polymerase subunit gamma vs. UniProt/SwissProt
Match: sp|P54098|DPOG1_HUMAN (DNA polymerase subunit gamma-1 OS=Homo sapiens OX=9606 GN=POLG PE=1 SV=1)

HSP 1 Score: 429.869 bits (1104), Expect = 2.438e-129
Identity = 230/489 (47.03%), Postives = 288/489 (58.90%), Query Frame = 3
Query: 2118 IPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV---RTS------------KENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKG---------------------KRSQGKWVD------------------------------GIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 3383
            IP  WF  LPH+ G    VGSPF+K FL  M+ G L +          +E  K   FWRN   R+ SQ +V   R++            +E    AI+PQV+ AGT+TRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLGD+   G+HG T FGWM LQG K  GTDLHSKT+  +GISR  AK+ NY R+YGAG   +   L+++N  L  QEA  K + +   TKG                      R++G W+                               G ESE+F+KLE IA SD P TPVL   +S+ALE   V E+FMTS+ NWVVQSS VDYLH +L   K L + + ++ R CI IHDE+RYL  E+D+YR AL LQI NL TR +F+ KL L DLPQS+AFFS +DID CLRK  T DC TPSN  G+   Y I +GE+L+IYQI++ T G L+
Sbjct:  744 IPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLE 1232          

HSP 2 Score: 275.404 bits (703), Expect = 6.931e-75
Identity = 160/435 (36.78%), Postives = 232/435 (53.33%), Query Frame = 3
Query:  204 NSSDDKLRINMMNIQMINKKFQETIFGSKS--TAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKS--LASKEKEYINDPWLWDLDW 1475
            +S   +LR N ++IQM+++   E IFG       E          +   +  +      +V+  LPPL G+N++ H +  A+  + PY+     L   ++P  P  W++ EGWT+Y     +   V++PEE  L+FDVE          +AVA+  S WYSW S+ L++      S++   DLIPL      S P       + +VGH VSFDRA IR++Y I+G+  RF+DTMSM +AI G++S QRSL I+      + +        S +         I   D WL  +S+NSL +V++ Y     L   K+ RE F+KGT+ DI  +FQ LM YCA DV  T ++FQ+    +  R PHP +  GMLEMG  YLPVN N   Y+  A  TYE + ++ K+ LM+LA  +  L S E+ Y  DPWLWDL+W
Sbjct:   63 SSEGGQLRHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGP-EGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGP--AISSWD-WLDISSVNSLAEVHRLYVGGPPLE--KEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGER-YKEDPWLWDLEW 490          

HSP 3 Score: 56.6102 bits (135), Expect = 1.433e-6
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK-NENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L  + ++ + T  P L++ Q  +  K++ L WDG PLHY +++ WG L+PG
Sbjct:  568 GHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPG 626          
BLAST of DNA polymerase subunit gamma vs. TrEMBL
Match: A0A068WP15 (DNA polymerase subunit gamma OS=Echinococcus granulosus OX=6210 GN=EgrG_000243450 PE=4 SV=1)

HSP 1 Score: 841.647 bits (2173), Expect = 0.000e+0
Identity = 472/1155 (40.87%), Postives = 682/1155 (59.05%), Query Frame = 3
Query:  219 KLRINMMNIQMINKKFQETIFGSK---------STAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDK-SKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDK--RETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA---SKEKEYINDPWLWDLDWSTTKK-----------SSFPKWFRVLVSKNENSN-TFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYL-----PVWYDEKFMDISNK-LIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAF--RDFLLSLGNSDLTKYNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNF-QMNDFSSLF------------------AKTKCLL-----TENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTS---------HAANNLLEIMIEGKKSGVFWRNYQNRVQSQF-----------MVRTSKENNE-------SAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDSVTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR---SQGK-----------WVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 3383
            +L  N +NIQMI+++ Q+ +F  +         +  +L    IN+      ID  +   +  VD  LPP LG NI+ H +  A  L+ PY+ L+  L    +P++P  W    GWT Y    + +++VS P +++L+FD E L       V+AVA   ++WY W S  LL  + +  + +  DDLI  YS+    S PKCI+GHFVS+DRARI +EY I+ TG RF+DTMS+ I + G+TS QR+LK++ + +   N++WK + +  +    +N PE ++    W+ +ASLNSL+DV+++Y   C     ++K  R  F KG+  D++++FQAL TYCA DV MT + F+ LW  Y+ RFPHPA+F G+LEMGS+YLP+NS+   +  RA+ +Y+ +  K+K +L  LA+ +L      +K Y  DPWLWDLDWS  KK           ++ PKW+R L+ K    N    P LIT+Q  IA K+L+L W GLPLHYD+  KWG LIPG        P +Y++K  D S +  I P+  V ++S +  D   FP ++Y+++W      RL     R    +  N D  + ++ ++ +   VE     P +L  VN L+  +K+I+  +      S    P    N  ++    +LF                  ++ K L      T NP IP  WF PLP+E G G  VGSP SK F  ++ SGRL S         H+A+ +L   I       FW++Y  RV SQ             V+T+  N +        AI+PQVI AGT++RR+VE LWLTA+N+  +R+GSE+KA+VQ P  + +VGADVDSQE WIA+++GDSV G  GGTP+GWM L+GSK  GTDLH+KT+ +IGI RN AK+LNY+R+YG+G++ +   L K+   L+P+EA  K + LM+ TKG R     GK           W DG ES VF+ LE IA+S EP TPVL A++++ L   VV + F+ S+ NWVVQSS VDYLHCLL F   LI+ Y++ ARLCI IHDE+RYLC+++   ++AL LQI+NL TR++F+ +L + DLP+S+A+FS +++D CLRK P++DC TPSN +GL   YNI KG S  I +I+++TGG ++
Sbjct:   26 ELVFNEVNIQMIDRRLQQLLFAKRIYSYELSKEACEKLRSHGINA------IDRREGETSHYVD--LPPFLGSNIKEHFELIASDLSKPYLQLIGRLS--LLPEIPKNWKLLSGWTAY--TKDSYFRVSCPPDDILVFDTEVLVNEGHAPVIAVAASPNFWYLWVSPRLLSSM-RSTNSVTIDDLIRFYSDGSALSSPKCIIGHFVSYDRARIFEEYLIEPTGLRFLDTMSLHICVSGLTSTQRNLKLASDKHLYNNKLWKDFVAEHNAKRGSNDPESLD----WIKDASLNSLLDVFKFY---CQKEPYQNKELRAVFEKGSRGDVIDNFQALATYCANDVKMTFETFRNLWKLYQERFPHPATFYGLLEMGSMYLPINSSWIDFQERANQSYDDLNTKQKVLLQRLAEDALQKHNGSDKSYEKDPWLWDLDWSKPKKPANKSESAQILANLPKWYRELIPKPIKDNYKSGPALITAQMKIAPKLLRLCWKGLPLHYDQILKWGTLIPGRVPKPVGDPRYYEQKQSDESTRSQILPVFKVTKMSATGPDELIFPYREYLKYWTKEMEERLCGVNSRRAFETRANPD-ARDDLLLDELRRSVE---VMPLDLDTVNHLVSSLKKISDNDRGEQVKSKNSLPPVYENLGELQAKGALFWGNKDRYETDHSVKWISASRRKKLRRSATDTINPEIPTCWFCPLPNEAGTGLPVGSPLSKPFQVHIASGRLYSSPTAGGGEDHSADQILRDRIRAS----FWQSYSKRVMSQMYVFLETNLLPPTVQTALRNGKVPFGRRYGAILPQVIAAGTISRRAVEPLWLTASNAERERLGSEIKALVQAPPGFCLVGADVDSQEMWIASLIGDSVVGFQGGTPYGWMTLEGSKAKGTDLHTKTANLIGIKRNEAKILNYARLYGSGLEFTKHLLSKFQSNLRPEEASLKAEKLMRATKGHRVPVHMGKGCKEEAETRYIWKDGTESCVFNALEAIARSPEPRTPVLGAQITKTLTPTVVKDDFLPSRINWVVQSSAVDYLHCLLVFMAWLIKKYSLRARLCISIHDEVRYLCDQRCADQMALALQISNLLTRALFAFQLGMHDLPESVAYFSSVEVDTCLRKDPSNDCKTPSNPDGLEITYNIPKGRSFTITEIIERTGGAME 1152          
BLAST of DNA polymerase subunit gamma vs. TrEMBL
Match: A0A087W245 (POLAc domain-containing protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000243450 PE=4 SV=1)

HSP 1 Score: 838.951 bits (2166), Expect = 0.000e+0
Identity = 469/1163 (40.33%), Postives = 681/1163 (58.56%), Query Frame = 3
Query:  180 FGRLLNTA---NSSDDKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSLFKNFKIDTEKTTLNKNVDF-DLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDK-SKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDK--RETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA---SKEKEYINDPWLWDLDWSTTKK-----------SSFPKWFRVLVSKNENSN-TFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYL-----PVWYDEKFMDISNK-LIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEA--FRDFLLSLGNSDLTKYNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNF-QMNDFSSLF------------------AKTKCLL-----TENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTS---------HAANNLLEIMIEGKKSGVFWRNYQNRVQSQF-----------MVRTSKENNE-------SAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDSVTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR---SQGK-----------WVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 3383
            F R L +A     +  +L  N +NIQMI+++ Q+ +F  +  +     E     +N  I+       +   + DLPP LG NI+ H +  A  L+ PY+ L++ L    +P++P  W    GWT Y    + +++VS P + +L+FD E L        +AVA   ++WY W S  LL  + +  + +  DDLI  YS+    S PKCI+GHFVS+DRARI +EY ++ TG RF+DTMS+ I + G+TS QR+LK++ + +   N++WK + +  +    +N PE ++    W+  ASLNSL+DV+++Y   C     ++K  R  F KG+  D++++FQAL TYCA DV MT + F+ LW  Y+ RFPHPA+F G+LEMGS+YLP+NS+   +  RA+ +Y+ +  K+K +L  LA+ +L      +K Y  DPWLWDLDWS  KK           ++ PKW+R L+ K    N    P LIT+Q  IA K+L+L W GLPLHYD+  KWG LIPG        P +Y++   D S +  I P+  V ++S + +D   FP ++Y+ +W      RL     R    +  N D  + ++ ++ +   VE     P +L  VN L+  +K+I+  +      S    P    N  ++    +LF                  ++ K L      T NP IP  WF PLP+E G G  VGSP SK F  ++ SGRL S         H+A+ +L   I       FW++Y  RV SQ             V+T+  N +        AI+PQVI AGT++RR+VE LWLTA+N+  +R+GSE+KA+VQ P  + +VGADVDSQE WIA+++GDSV G  GGTP+GWM L+GSK  GTDLH+KT+ +IGI RN AK+LNY+R+YG+G++ +   L K+   L+P+EA  K + LM+ TKG R     GK           W DG ES VF+ LE IA+S EP TPVL A++++ L   +V + F+ S+ NWVVQSS VDYLHCLL F   LI+ Y + ARLCI IHDE+RYLC+++   ++AL LQI+NL TR++F+ +L + DLP+S+A+FS +++D CLRK P++DC TPSN +GL   YNI KG S  I +I+++TGG ++
Sbjct:   10 FVRQLASAKVIRCNKQELVFNEVNIQMIDRRLQQLLFAKRIYSYELSKEACEKLRNHGINAIDRREGETSHYVDLPPFLGSNIKEHFELIASDLSKPYLQLIRRLS--LLPEIPKNWKLLSGWTAY--TKDSYFRVSCPPDEILVFDTEVLVNEGHAPTIAVAASPNFWYLWVSPRLLSSM-RSTNSVTIDDLIRFYSDGSPLSSPKCIIGHFVSYDRARIFEEYLVEPTGLRFLDTMSLHICVSGLTSTQRNLKLASDKHLYNNKLWKDFVAEHNAKRGSNDPESLD----WIKGASLNSLLDVFKFY---CQKEPYQNKELRAVFEKGSRGDVIDNFQALATYCANDVKMTFETFRNLWKLYQERFPHPATFYGLLEMGSMYLPINSSWIDFQERANQSYDDLNTKQKVLLQRLAEDALQKHNGSDKSYEKDPWLWDLDWSKPKKPANKSESAQVLANLPKWYRELIPKPIKDNYKSGPSLITAQMKIAPKLLRLCWKGLPLHYDQILKWGTLIPGRVPKPIGDPRYYEQTQSDESPRSQILPVFKVTKMSATGLDELIFPYREYLHYWTKEMEERLCGVNLRRAFETRANPD-ARDDLLLDELCRSVE---VMPLDLDTVNRLVSSLKKISDNDRGEQVKSKNSLPPVHENLGELQAKGALFWGNKDRYETDHSVKWIPTSRRKKLRRSATDTINPEIPTCWFCPLPNEAGTGLPVGSPLSKPFQVHIASGRLYSSPTAGGGEDHSADQILRDRIRAS----FWQSYSKRVMSQMYVFLETNLLPPTVQTALRNGKVPFGRRYGAILPQVIAAGTISRRAVEPLWLTASNAERERLGSEIKALVQAPPGFCLVGADVDSQEMWIASLIGDSVVGFQGGTPYGWMTLEGSKAKGTDLHTKTANLIGIKRNEAKILNYARLYGSGLEFTKHLLSKFQSNLRPEEASLKAEKLMRATKGHRVPVHMGKGCKEEAETRYIWKDGTESCVFNALEAIARSPEPRTPVLGAQITKTLTPTIVKDDFLPSRINWVVQSSAVDYLHCLLVFMAWLIKKYRLRARLCISIHDEVRYLCDQRCADQMALALQISNLLTRALFAFQLGMHDLPESVAYFSSVEVDTCLRKDPSNDCKTPSNPDGLEITYNIPKGRSFTITEIIERTGGAME 1152          
BLAST of DNA polymerase subunit gamma vs. TrEMBL
Match: A0A158QIB6 (POLAc domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9091 PE=4 SV=1)

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 461/1108 (41.61%), Postives = 650/1108 (58.66%), Query Frame = 3
Query:  354 EKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYS-NDDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSN-SSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLS--SLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA---SKEKEYINDPWLWDLDWSTTKK-----------SSFPKWFRVLVSKN-ENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYL-----PVWYDEKFMDIS-NKLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPL-------------FVSRLEA-FRDFLLSLGNSDLTKYNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNF-QMNDFSSLFAKTK-----------------------CLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHA------ANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV----------------RTSKENN---ESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDSVTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR---------SQGK--WVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
            E+  + ++   DLPPL G NI+ H    A  L+ PY+  +  L    +P+MPT W    GWT Y  +N  F+KV VP E++ +FD E L   +   V+ VA   + WY W S  L+    K    +   DL+P YS N   S PKC++GHFVS+DRARI +EY  + +G RF+DTMS+ I + G+TS QR+LK++ + +   N++WK + +  +S+ G  ++     ES  W+ +ASLNSL+DV++ Y   C       KD R TF KGT  D++ DFQ L++YCA DV+MT ++FQ LW  Y  RFPHPA+F G+LEMGS+YLP+N++   +  RA+ TY+ +   +K +L +LA+ +L      +K Y  DPWLWDLDWS  K+           S+ PKW+R L+ K  ++     P LIT+Q  IA K+L+L W GLPLHYD   KWG LIPG        P +Y +K +D S  + I P   V + + +  +   FP ++++ +W  +             F SR+E   RD LL      L +    VE M          P +L  V  L+  IKEIT   SK      +   L   N  ++    +LF + +                          T NP+IP  WF PLP+E G G  VGSP SK F  ++ +GRL S +       +N  + ++  +    FW++Y  RV +Q  V                  S   N     AI+PQVI AGT++RR+VE LWLTA+N+  +R+GSE+KAMVQ P  + +VGADVDSQE WIA+++GDSV G  GGTP+GWM L+GSK  GTDLH+KT+ +IGI RN AKVLNY+R+YG+G++ +   L K+   L+P+EA  K + LM+ TKG+R         S+ K  W DG ES VF+ LE IA+S EP TPVL+A++++AL  + V   F+ S+ NWVVQSS VDYLHC+L F   LI+ YN+ ARLCI IHDE+RYLC+++   ++AL LQI+NL TR++F+ +L + DLP+S+A+FS ++ID CLRK P +DC TPSN +GL   Y I KGESL + +I+++TGG +
Sbjct:  827 ERRQVEESQYIDLPPLYGTNIKQHFDSIAADLSKPYLDSIGQLK--SLPEMPTKWQMIPGWTAY--VNGSFFKVDVPLEDVFVFDTEVLVTESCAPVIGVAASSNAWYLWVSPRLI-STSKPMKTVSMYDLVPFYSSNGQYSNPKCVIGHFVSYDRARIMEEYLTEPSGIRFVDTMSLHICVSGLTSTQRNLKLASDKHLYNNKLWKDFVAEYNSRKGSGDA-----ESLDWIKDASLNSLLDVFKLY---CQKEPYQTKDLRSTFEKGTRRDVIGDFQNLVSYCAYDVLMTFEVFQNLWKLYIERFPHPATFYGLLEMGSMYLPINTSWIDFQERANKTYDELNNGQKTLLQKLAEDALNRHNGPDKSYQMDPWLWDLDWSKPKRPANKSESALVLSNLPKWYRDLIPKPMKDHYKTGPSLITAQMKIAPKLLRLCWKGLPLHYDNTLKWGTLIPGRVPKPVGDPYYYVQKVVDDSPRRQIRPSFMVTKTTAAGNEELVFPYREHLLYWEKVIEKLLWGLDPKSAFESRVEPDPRDDLL------LDELRRSVEVM----------PLDLDTVKRLIDSIKEITGDQSKEQVKVVKPSQLIYENLGELQAKGALFWQNRDRYDSDNRSKWIPPSRKKKIRRTATDTVNPVIPTCWFCPLPNEAGTGLPVGSPLSKPFQVHIAAGRLHSASWDAEGGPDNTADQILRDRIRASFWQSYSKRVCAQMYVFLENNMLPPSVQVALDEVSSNGNLRRYGAIVPQVIAAGTISRRAVEPLWLTASNAEAERLGSEIKAMVQAPPGFCLVGADVDSQEMWIASLIGDSVIGFQGGTPYGWMTLEGSKSKGTDLHTKTANLIGIKRNEAKVLNYARLYGSGLEFTKHLLSKFQSNLRPEEASIKAEKLMRATKGQRVPIQSPESNSEMKYMWKDGTESYVFNALEAIARSPEPRTPVLSAQITRALTPQAVKGDFLPSRINWVVQSSAVDYLHCILVFMAWLIRKYNLRARLCISIHDEVRYLCDQRCADQVALALQISNLLTRALFAFQLGMHDLPESVAYFSSVEIDTCLRKDPLNDCKTPSNPDGLEITYGIPKGESLTVSEIIERTGGSM 1905          
BLAST of DNA polymerase subunit gamma vs. TrEMBL
Match: A0A5K3EXL1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 463/1147 (40.37%), Postives = 656/1147 (57.19%), Query Frame = 3
Query:  231 NMMNIQMINKKFQETIFGSKSTAELDFFEINSLFKNFKIDT-EKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDK-SKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFS--NSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDK--RETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA---SKEKEYINDPWLWDLDWSTTKK-----------SSFPKWFRVLVSKN-ENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKL-----------------IWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTKYNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNF--QMNDFSSLFAKTK-------CLL-------------TENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTS-----HAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV----------RTSKENNESA--------IIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDSVTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR--------SQGK------WVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
            N +NIQMI++K QE +F  +  +     E         I+  E++  +  +  +LPPLLG +++ H +  A  L+ PY   ++ L   K+P+ PT W F  GWT Y   N     V  P E  L+FD E L K +   ++AVA   + WY W S  L +   +  + +   DLIPLYS     S PKCIVGHFVS+DRARI +EY    TG RF+DTMS+ I + G+TS QR +K++ + +   N+++K + +  N+ +   N S  D+E S +W+ EASLNSLV+VY+ Y   C     +DK  R  F KG+  D++ +FQ L+TYCA DV MT  IFQ LW  +  RFPHP +F G+LEMGS+YLPVN +   +  RA+  Y  +  K+K +L +LA+ +L      +K Y  DPWLWDLDWS  KK           +S PKW+R L+ K  ++     P L+T+Q  IA K+L+L W+GLPLH+D+  KWG LIPG       D +F   ++ L                 I P I V + + +     QFP ++Y+Q+W      RL      +      D T  + F+  +  +   +   P +   ++ L+   K+++    K    + E+  L +Y +  ++    +LF + K       C +             T NP I   WF PLP+E G+G  VGSP SK F  ++ SGRL S        N   + ++  +    FW++Y  RV SQ  V            S  N E+A        I+PQVI AGT++RR+VE LWLTA+N+  +R+GSE+KAMVQ P  + +VGADVDSQE WIA+++GDS  G  GGTP+GWM L+GSK  GTDLH+KT+ +IGI RN AKVLNY+R+YG+G++ +   L K+   ++P+EA  K + LM+ TKG R        S+GK      W  G ES VF+ LE IA+S EP TPVL A++++AL  + V + F+ S+ NWVVQSS VDYLHCLL     LI+ +N+ ARLCI IHDE+RYLC ++    +AL LQI+NL TRS F+ +L + DLP+S A+FS +++D CLRK P +DC TPSN +GL   Y I KG+S  I +I+++TGG L
Sbjct:   30 NEVNIQMIDRKLQEVLFSKRIPSYTVSKEACDKLSEHGINAYERSGGDAAMYINLPPLLGPDVKHHFEGIASELSKPYFNCIRSLS--KLPKPPTHWKFIPGWTSY--ANGTAISVDCPSEEGLVFDTEVLVKESNAPIIAVAASVNGWYLWVSPRLFEPPVEPTNMVTLADLIPLYSPGTSLSSPKCIVGHFVSYDRARITEEYLTDPTGLRFLDTMSLHICVSGLTSTQRHIKMASDKHLYNNKLFKDFVAELNAKRGSTNQS--DVE-SLEWIKEASLNSLVEVYKLY---CKKDPPQDKSLRVIFEKGSRKDVIKNFQKLVTYCALDVHMTFDIFQCLWKLFTERFPHPLTFYGLLEMGSMYLPVNRSWVDFQERANQAYADLNTKQKTMLQKLAEDALKRHNGNDKSYERDPWLWDLDWSKPKKPASKSEDAQYIASLPKWYRELIPKPIKDHYKEGPTLVTAQMKIAPKLLRLCWNGLPLHFDQTLKWGTLIPGRVPKPVGDPQFYKQNSNLKENRSSHALSIQSPQSQILPSITVVKTAAAGPRLLQFPYREYLQYWEKEIEKRLFDLNSRVAFKNRVDPTPRDKFL--LDELRRSVEVMPLDFDVMHRLIASFKQVS-EECKVEQFATEKLTLPIYEYLGELQVKGALFWQNKHRYDTRRCGMVGRQKIHRRTTTDTINPEIATCWFCPLPNEGGQGLPVGSPLSKPFQVHIASGRLHSAQTSGEGENQAADQILRDRIRASFWQSYSKRVMSQMYVFLPTRLLPPTVQSSLNEEAAPRGQLYGAILPQVIAAGTISRRAVEPLWLTASNAEPERLGSEIKAMVQAPPGYCIVGADVDSQEMWIASLIGDSKVGFQGGTPYGWMTLEGSKAKGTDLHTKTANLIGIKRNEAKVLNYARLYGSGVEFTKHLLSKFQSNIRPEEASLKAEKLMRATKGYRVSVPSQNNSEGKVEYKSIWRGGTESHVFNALEAIARSPEPRTPVLGAQITRALTPKAVQDDFLPSRINWVVQSSAVDYLHCLLVSMAWLIKKFNLRARLCISIHDEVRYLCYKRCADEVALALQISNLLTRSFFAYQLGMHDLPESAAYFSSVEVDSCLRKDPLNDCKTPSNPDGLEATYKIPKGKSFTIAEIIERTGGVL 1163          
BLAST of DNA polymerase subunit gamma vs. TrEMBL
Match: A0A5K4EUB4 (Putative DNA polymerase gamma OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 803.897 bits (2075), Expect = 0.000e+0
Identity = 471/1210 (38.93%), Postives = 664/1210 (54.88%), Query Frame = 3
Query:  198 TANSSDDKLRINMMNIQMINKKFQETIFG-SKSTAELDFFEINSLFKNFKIDTEKTTLNKN-VDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLL---DGICKDDSEICKDDLIPLYSNDDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKN---GMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDK--RETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA--SKEKEYINDPWLWDLDWSTTKK----------SSFPKWFRVLVSKNENSN-TFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYL-----PVWYDEKFMDISN-----------------------KLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTKYN--VFVEYMMAI----------------VEPINFTPENLTKVNSLLCEIK-------------------------------EITLRNSKGYYNSN--EEGPLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAAN------------------NLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSKEN---------------NESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDSVTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR--------------SQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
            ++N  +     N +NI MI++  Q+ +F   K   +   FE+   F    ID       K+ + F +P L G N++ HL   A+ L+ PYM LL+       P++P +W    GWTKY+   +K Y V  P E+ LIFD E L K      MAVA+    WYSWTSK L    D    D +    + LIP+Y + +K   KC++GHFVS+DRARI +EY + GTG RF+DT+S+ +A+ G+TS QR LK S + +   N+ W+ +    +     G   S E +     WL+E SLNSL D+Y+ Y   C     +DK  R  F  GTI+D+  +FQ L  YCA DV+MT +I Q LW  ++ RFPHPA+F G+LEM S+YLP+N N   +  +A ++Y   I ++K++LM+LA ++LA  S  +EY NDPWLWDLDWS  K           S  PKW+R L+ K    N    P L+T+Q  IA K+LKL W GLPLHYD+  KWGVLIPG        P +Y E F +  N                         I PIIPV + + +  +   FP   Y+ +W+     RL A  DF L+   S    ++  + V Y   I                +E +    E   ++ S +  I+                               E+  + S  + NSN  ++   +  N++  +     A    + T NP+IP  WF  LPHE G G  VGSP S+SF +++ S RL S   N                   L + ++  +    FW++Y  R++SQ  +    +                N  AI+PQVI  GTV+RR+VE LWLTA+N+  +R+GSE+KAMVQ+P  +V VGADVDSQE WIAA++GD+  G  G TP+GWM LQG+K+DGTDLH+K +K +GI R+ +KVLNYSR+YG+GI+ ++  L K+   + P++A  K K L + TKG+R              S  KW  G ES VF++LE IA+S EP TP LNA+L++AL  ++V + F+ S+ NWVVQSS VDYLHC+L   + LI  + + ARLCI IHDE+RY+C +   Y++AL LQI+NL TR+ F  +L + DLP+S+AFFS +++D C+RK   DDC+TPSN +GL N Y +  G+SL +  ILDKTGG +
Sbjct:   24 SSNHPNQSPTYNEVNILMIDRNLQKALFNCQKYDYQKASFEVLQEFCRLGIDITSNRHYKDPLYFSIPDLSGSNVKEHLDSVAKELSHPYMKLLESFG--SPPELPKIWESSSGWTKYN--GDKTYSVEAPLEDALIFDTEVLVKEGHVPTMAVALTSDGWYSWTSKRLSVYDDNYSNDINAF--NSLIPIYGSKNKDISKCVIGHFVSYDRARILEEYLLDGTGLRFVDTLSLHVAVSGLTSTQRFLKTSADKHLFNNKTWQEFIGRKNDKQPLGGKPSTEALVMDLDWLSETSLNSLPDIYRLY---CKKEPPQDKQLRSIFESGTIEDVRTNFQELFNYCAVDVLMTYEIIQVLWPIFKERFPHPATFCGLLEMSSMYLPINDNWIKFQEKAESSYTENILRQKKLLMQLADQALAKYSNSQEYKNDPWLWDLDWSKPKVKCKTEVDEKVSRLPKWYRDLIPKPVKDNLDSGPALLTAQMRIAPKLLKLCWQGLPLHYDQVLKWGVLIPGRIPQPYGDPRYYIESFKNTENTECIDSNDAENFSTNSNVVCHYDSSIRPIIPVVKSTAAGDETLDFPYGAYLNYWLADVKRRLLA--DFQLNESTSSCDNFSDSLAVAYSHRIKPDIRDANLLDELKRSIEIMPLEKEERQRLASTISTIRKLGEQKRFQMDSKLQKIKNNNHNELIFEKVGELQAQGSAFWLNSNRFDQNSSNYSNYRRRN-----AVRYAVDTVNPVIPTCWFKHLPHESGTGLPVGSPLSRSFQSHIASHRLHSADFNPNDTISANTDTIKLKPVMGLADRLLHDRVHATFWQSYSKRIKSQMAIWLPHDQLPKNVLNDQSYNCKANYGAILPQVITCGTVSRRAVEPLWLTASNADENRLGSEIKAMVQSPPGYVFVGADVDSQEMWIAALIGDAGVGFQGSTPYGWMTLQGNKLDGTDLHTKIAKEMGIKRSESKVLNYSRLYGSGIEFASHLLAKFC-NITPEQASLKAKQLFQITKGRRTIVDSFPSDDGTSISTSKWQGGSESAVFNQLESIARSPEPRTPFLNAQLTRALNPKLVKDDFLPSRVNWVVQSSAVDYLHCMLVLMRWLINKFKIPARLCISIHDELRYICPKSHMYQVALALQISNLLTRTFFVYQLGMRDLPESVAFFSSVEVDTCIRKEAKDDCVTPSNSSGLQNGYGVSPGQSLTMQDILDKTGGSM 1216          
BLAST of DNA polymerase subunit gamma vs. Ensembl Cavefish
Match: polg (DNA polymerase gamma, catalytic subunit [Source:NCBI gene;Acc:103040749])

HSP 1 Score: 484.182 bits (1245), Expect = 3.795e-151
Identity = 277/661 (41.91%), Postives = 372/661 (56.28%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK--NENSNTFNP--DLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTKYNVFVEY-MMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV--------RT-------SKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKRS-----------QGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
              P W+R L ++   +    ++P   LIT Q  +  K++ L WDG PLHY  K+ WG L+PG           +D +     P+ P   I   Y +Y +   +       PL +   ++  D +L+    D + +    E  M+ +V      P  +    +    ++     +   Y++ N  GP +  N                      IP VWF  LPH+ G  N VGSPFSK FL+ M+ G L S          +E  K   FWRN Q R+ SQ +V        RT        +E    AI+PQV+ AGTVTRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLG+S   G+HG T FGWM LQG K  GTDLHS+T+  +GISR  AKV NY R+YGAG   +   L+++N  L   EA +K K +   TKG RS           +  W  G ESE+F+KLE IA S++P+TPVL  R+S+ALE   V ++F+TS+ NWVVQSS VDYLH +L   + L++ ++++ R CI IHDE+RYL + +D+YR AL LQI NL TR +F+ KL + DLPQS+AFFS +DID CLRK  T DC TPSN  GL   + I +GE+L+IYQI++KT G L
Sbjct:  538 GHPGWYRKLCARMSEKEDEAWSPGASLITLQMRLTPKLMGLTWDGFPLHYTDKHGWGYLVPG-------HRDNLDTTEDSEGPVCPHRAIEAIYREYCEEKGKGK-----PLCLDNQQS-DDLMLT----DSSVWQTVEELSMLEVVSDDEAVPRTVRPKKAQRSSLELDAGESECPYHHGN--GPYNDVN----------------------IPGVWFFKLPHKDGNENNVGSPFSKDFLSKMEDGTLHSGRGETNATRALEINKMMSFWRNAQKRISSQMVVWLRKGELPRTVSRHEDYDEEGQYGAILPQVVTAGTVTRRAVEPTWLTASNARRDRVGSELKAMVQVPPGYHLVGADVDSQELWIAAVLGESHFAGMHGCTAFGWMTLQGKKSQGTDLHSRTANAVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLSQPEAADKAKQMYALTKGLRSFRNKKRWDLVGRRVWAGGTESEMFNKLESIAHSEQPATPVLGCRISRALEPAAVKDEFITSRVNWVVQSSAVDYLHLMLVAMRWLLEEFDIDGRFCISIHDEVRYLVKSEDRYRAALALQITNLLTRCMFAYKLGMKDLPQSVAFFSAVDIDQCLRKEVTMDCATPSNPIGLEGRFGIPQGEALDIYQIIEKTKGSL 1157          

HSP 2 Score: 282.722 bits (722), Expect = 1.311e-78
Identity = 166/476 (34.87%), Postives = 262/476 (55.04%), Query Frame = 3
Query:  135 LRFLSYSGYLPKPSNFGRLLNTANS------SDDKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSLFKNFKIDT---EKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPED-IEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDWSTT--KKSSFP 1502
            LR +S+  +   P+   R   TA +      +  + R N +NIQM+++  +E IF S S  E    +I+   ++ +  +   ++  L   V+  LP + G++I+ H +  A+  + PY+     L    +PQMP  W+++ GWT+Y  ++ +  KV+ PEEN ++FDVE      +   +AVAV  + WYSW SK L++      S++   DLIPL +  + S+P       + ++GH VSFDRA I+++Y +KG+  RF+DTMS+ +AI G+T  QRSL ++  +         L         +   PE  +  S +W+  +S+N+L DV+  Y     L   K+ R+ F+KG+++D+ N+FQ LM YCATDV+ T ++F +  + +  R PHP +F GMLEMG  YLPVN +   YI  A  TYE + ++ K+ LM LA  +    ++  Y  DPWLWDLDW     KK   P
Sbjct:    2 LRLVSHQPWRCSPAAVWRRRCTAAAEAKHQQNSKETRTNPLNIQMLSRNLREQIFRS-SVQEYADEDIDRSIRHLEKHSLWGKEAVLLPEVELKLPQMYGDDIDEHFRILAQKQSLPYLEAASQLQQAHLPQMPQKWAWEVGWTRYG-LDGQCKKVNFPEENAVVFDVEVCMAEGRCPTLAVAVSPTAWYSWCSKRLVEERYTWSSQLTLADLIPLETPSNSSRPPGGQWKERLVIGHNVSFDRAHIKEQYLLKGSKMRFLDTMSLHMAISGLTGFQRSLWMASRHGKRRG----LQEVKEHIKKLGRRPEGPMIGSWEWVNISSINNLTDVHALYVGGEPLK--KEPRDIFVKGSMNDVRNNFQELMQYCATDVLATHEVFTQQLSLFMERCPHPVTFAGMLEMGVSYLPVNESWGRYIEDAQDTYEELQREMKKSLMILADDACQLLQDDRYKEDPWLWDLDWDVQEFKKKKMP 469          
BLAST of DNA polymerase subunit gamma vs. Ensembl Cavefish
Match: polg (DNA polymerase gamma, catalytic subunit [Source:NCBI gene;Acc:103040749])

HSP 1 Score: 467.233 bits (1201), Expect = 1.683e-144
Identity = 277/702 (39.46%), Postives = 374/702 (53.28%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK--NENSNTFNP--DLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTKYNVFVEY-MMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV--------RT-------SKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR-----SQGKWV-----------------------------------------------DGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
              P W+R L ++   +    ++P   LIT Q  +  K++ L WDG PLHY  K+ WG L+PG           +D +     P+ P   I   Y +Y +   +       PL +   ++  D +L+    D + +    E  M+ +V      P  +    +    ++     +   Y++ N  GP +  N                      IP VWF  LPH+ G  N VGSPFSK FL+ M+ G L S          +E  K   FWRN Q R+ SQ +V        RT        +E    AI+PQV+ AGTVTRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLG+S   G+HG T FGWM LQG K  GTDLHS+T+  +GISR  AKV NY R+YGAG   +   L+++N  L   EA +K K +   TKG R      +G+W+                                                G ESE+F+KLE IA S++P+TPVL  R+S+ALE   V ++F+TS+ NWVVQSS VDYLH +L   + L++ ++++ R CI IHDE+RYL + +D+YR AL LQI NL TR +F+ KL + DLPQS+AFFS +DID CLRK  T DC TPSN  GL   + I +GE+L+IYQI++KT G L
Sbjct:  538 GHPGWYRKLCARMSEKEDEAWSPGASLITLQMRLTPKLMGLTWDGFPLHYTDKHGWGYLVPG-------HRDNLDTTEDSEGPVCPHRAIEAIYREYCEEKGKGK-----PLCLDNQQS-DDLMLT----DSSVWQTVEELSMLEVVSDDEAVPRTVRPKKAQRSSLELDAGESECPYHHGN--GPYNDVN----------------------IPGVWFFKLPHKDGNENNVGSPFSKDFLSKMEDGTLHSGRGETNATRALEINKMMSFWRNAQKRISSQMVVWLRKGELPRTVSRHEDYDEEGQYGAILPQVVTAGTVTRRAVEPTWLTASNARRDRVGSELKAMVQVPPGYHLVGADVDSQELWIAAVLGESHFAGMHGCTAFGWMTLQGKKSQGTDLHSRTANAVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLSQPEAADKAKQMYALTKGLRRYHLSEEGEWLVNELGVDVNWDEYGTVSREELRRISKLAGTSFRNKKRWDLVGRRVWAGGTESEMFNKLESIAHSEQPATPVLGCRISRALEPAAVKDEFITSRVNWVVQSSAVDYLHLMLVAMRWLLEEFDIDGRFCISIHDEVRYLVKSEDRYRAALALQITNLLTRCMFAYKLGMKDLPQSVAFFSAVDIDQCLRKEVTMDCATPSNPIGLEGRFGIPQGEALDIYQIIEKTKGSL 1198          

HSP 2 Score: 282.337 bits (721), Expect = 2.591e-78
Identity = 166/476 (34.87%), Postives = 262/476 (55.04%), Query Frame = 3
Query:  135 LRFLSYSGYLPKPSNFGRLLNTANS------SDDKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSLFKNFKIDT---EKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPED-IEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDWSTT--KKSSFP 1502
            LR +S+  +   P+   R   TA +      +  + R N +NIQM+++  +E IF S S  E    +I+   ++ +  +   ++  L   V+  LP + G++I+ H +  A+  + PY+     L    +PQMP  W+++ GWT+Y  ++ +  KV+ PEEN ++FDVE      +   +AVAV  + WYSW SK L++      S++   DLIPL +  + S+P       + ++GH VSFDRA I+++Y +KG+  RF+DTMS+ +AI G+T  QRSL ++  +         L         +   PE  +  S +W+  +S+N+L DV+  Y     L   K+ R+ F+KG+++D+ N+FQ LM YCATDV+ T ++F +  + +  R PHP +F GMLEMG  YLPVN +   YI  A  TYE + ++ K+ LM LA  +    ++  Y  DPWLWDLDW     KK   P
Sbjct:    2 LRLVSHQPWRCSPAAVWRRRCTAAAEAKHQQNSKETRTNPLNIQMLSRNLREQIFRS-SVQEYADEDIDRSIRHLEKHSLWGKEAVLLPEVELKLPQMYGDDIDEHFRILAQKQSLPYLEAASQLQQAHLPQMPQKWAWEVGWTRYG-LDGQCKKVNFPEENAVVFDVEVCMAEGRCPTLAVAVSPTAWYSWCSKRLVEERYTWSSQLTLADLIPLETPSNSSRPPGGQWKERLVIGHNVSFDRAHIKEQYLLKGSKMRFLDTMSLHMAISGLTGFQRSLWMASRHGKRRG----LQEVKEHIKKLGRRPEGPMIGSWEWVNISSINNLTDVHALYVGGEPLK--KEPRDIFVKGSMNDVRNNFQELMQYCATDVLATHEVFTQQLSLFMERCPHPVTFAGMLEMGVSYLPVNESWGRYIEDAQDTYEELQREMKKSLMILADDACQLLQDDRYKEDPWLWDLDWDVQEFKKKKMP 469          
BLAST of DNA polymerase subunit gamma vs. Ensembl Cavefish
Match: polg (DNA polymerase gamma, catalytic subunit [Source:NCBI gene;Acc:103040749])

HSP 1 Score: 467.233 bits (1201), Expect = 1.683e-144
Identity = 277/702 (39.46%), Postives = 374/702 (53.28%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK--NENSNTFNP--DLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTKYNVFVEY-MMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV--------RT-------SKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR-----SQGKWV-----------------------------------------------DGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
              P W+R L ++   +    ++P   LIT Q  +  K++ L WDG PLHY  K+ WG L+PG           +D +     P+ P   I   Y +Y +   +       PL +   ++  D +L+    D + +    E  M+ +V      P  +    +    ++     +   Y++ N  GP +  N                      IP VWF  LPH+ G  N VGSPFSK FL+ M+ G L S          +E  K   FWRN Q R+ SQ +V        RT        +E    AI+PQV+ AGTVTRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLG+S   G+HG T FGWM LQG K  GTDLHS+T+  +GISR  AKV NY R+YGAG   +   L+++N  L   EA +K K +   TKG R      +G+W+                                                G ESE+F+KLE IA S++P+TPVL  R+S+ALE   V ++F+TS+ NWVVQSS VDYLH +L   + L++ ++++ R CI IHDE+RYL + +D+YR AL LQI NL TR +F+ KL + DLPQS+AFFS +DID CLRK  T DC TPSN  GL   + I +GE+L+IYQI++KT G L
Sbjct:  538 GHPGWYRKLCARMSEKEDEAWSPGASLITLQMRLTPKLMGLTWDGFPLHYTDKHGWGYLVPG-------HRDNLDTTEDSEGPVCPHRAIEAIYREYCEEKGKGK-----PLCLDNQQS-DDLMLT----DSSVWQTVEELSMLEVVSDDEAVPRTVRPKKAQRSSLELDAGESECPYHHGN--GPYNDVN----------------------IPGVWFFKLPHKDGNENNVGSPFSKDFLSKMEDGTLHSGRGETNATRALEINKMMSFWRNAQKRISSQMVVWLRKGELPRTVSRHEDYDEEGQYGAILPQVVTAGTVTRRAVEPTWLTASNARRDRVGSELKAMVQVPPGYHLVGADVDSQELWIAAVLGESHFAGMHGCTAFGWMTLQGKKSQGTDLHSRTANAVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLSQPEAADKAKQMYALTKGLRRYHLSEEGEWLVNELGVDVNWDEYGTVSREELRRISKLAGTSFRNKKRWDLVGRRVWAGGTESEMFNKLESIAHSEQPATPVLGCRISRALEPAAVKDEFITSRVNWVVQSSAVDYLHLMLVAMRWLLEEFDIDGRFCISIHDEVRYLVKSEDRYRAALALQITNLLTRCMFAYKLGMKDLPQSVAFFSAVDIDQCLRKEVTMDCATPSNPIGLEGRFGIPQGEALDIYQIIEKTKGSL 1198          

HSP 2 Score: 282.337 bits (721), Expect = 2.591e-78
Identity = 166/476 (34.87%), Postives = 262/476 (55.04%), Query Frame = 3
Query:  135 LRFLSYSGYLPKPSNFGRLLNTANS------SDDKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSLFKNFKIDT---EKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPED-IEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDWSTT--KKSSFP 1502
            LR +S+  +   P+   R   TA +      +  + R N +NIQM+++  +E IF S S  E    +I+   ++ +  +   ++  L   V+  LP + G++I+ H +  A+  + PY+     L    +PQMP  W+++ GWT+Y  ++ +  KV+ PEEN ++FDVE      +   +AVAV  + WYSW SK L++      S++   DLIPL +  + S+P       + ++GH VSFDRA I+++Y +KG+  RF+DTMS+ +AI G+T  QRSL ++  +         L         +   PE  +  S +W+  +S+N+L DV+  Y     L   K+ R+ F+KG+++D+ N+FQ LM YCATDV+ T ++F +  + +  R PHP +F GMLEMG  YLPVN +   YI  A  TYE + ++ K+ LM LA  +    ++  Y  DPWLWDLDW     KK   P
Sbjct:    2 LRLVSHQPWRCSPAAVWRRRCTAAAEAKHQQNSKETRTNPLNIQMLSRNLREQIFRS-SVQEYADEDIDRSIRHLEKHSLWGKEAVLLPEVELKLPQMYGDDIDEHFRILAQKQSLPYLEAASQLQQAHLPQMPQKWAWEVGWTRYG-LDGQCKKVNFPEENAVVFDVEVCMAEGRCPTLAVAVSPTAWYSWCSKRLVEERYTWSSQLTLADLIPLETPSNSSRPPGGQWKERLVIGHNVSFDRAHIKEQYLLKGSKMRFLDTMSLHMAISGLTGFQRSLWMASRHGKRRG----LQEVKEHIKKLGRRPEGPMIGSWEWVNISSINNLTDVHALYVGGEPLK--KEPRDIFVKGSMNDVRNNFQELMQYCATDVLATHEVFTQQLSLFMERCPHPVTFAGMLEMGVSYLPVNESWGRYIEDAQDTYEELQREMKKSLMILADDACQLLQDDRYKEDPWLWDLDWDVQEFKKKKMP 469          
BLAST of DNA polymerase subunit gamma vs. Ensembl Cavefish
Match: polg (DNA polymerase gamma, catalytic subunit [Source:NCBI gene;Acc:103040749])

HSP 1 Score: 419.083 bits (1076), Expect = 2.867e-127
Identity = 233/523 (44.55%), Postives = 297/523 (56.79%), Query Frame = 3
Query: 1971 CEIKEITLRNSKGYYNSNEEGPLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMV--------RT-------SKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR-----SQGKWV-----------------------------------------------DGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGE 3335
            C + ++ LR+S        E P    N   ND +               IP VWF  LPH+ G  N VGSPFSK FL+ M+ G L S          +E  K   FWRN Q R+ SQ +V        RT        +E    AI+PQV+ AGTVTRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLG+S   G+HG T FGWM LQG K  GTDLHS+T+  +GISR  AKV NY R+YGAG   +   L+++N  L   EA +K K +   TKG R      +G+W+                                                G ESE+F+KLE IA S++P+TPVL  R+S+ALE   V ++F+TS+ NWVVQSS VDYLH +L   + L++ ++++ R CI IHDE+RYL + +D+YR AL LQI NL TR +F+ KL + DLPQS+AFFS +DID CLRK  T DC TPSN  GL   + I +GE
Sbjct:  615 CLLVKLDLRSSLELDAGESECPYHHGNGPYNDVN---------------IPGVWFFKLPHKDGNENNVGSPFSKDFLSKMEDGTLHSGRGETNATRALEINKMMSFWRNAQKRISSQMVVWLRKGELPRTVSRHEDYDEEGQYGAILPQVVTAGTVTRRAVEPTWLTASNARRDRVGSELKAMVQVPPGYHLVGADVDSQELWIAAVLGESHFAGMHGCTAFGWMTLQGKKSQGTDLHSRTANAVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLSQPEAADKAKQMYALTKGLRRYHLSEEGEWLVNELGVDVNWDEYGTVSREELRRISKLAGTSFRNKKRWDLVGRRVWAGGTESEMFNKLESIAHSEQPATPVLGCRISRALEPAAVKDEFITSRVNWVVQSSAVDYLHLMLVAMRWLLEEFDIDGRFCISIHDEVRYLVKSEDRYRAALALQITNLLTRCMFAYKLGMKDLPQSVAFFSAVDIDQCLRKEVTMDCATPSNPIGLEGRFGIPQGE 1122          

HSP 2 Score: 279.256 bits (713), Expect = 1.419e-77
Identity = 159/440 (36.14%), Postives = 248/440 (56.36%), Query Frame = 3
Query:  225 RINMMNIQMINKKFQETIFGSKSTAELDFFEINSLFKNFKIDT---EKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPED-IEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDWSTT--KKSSFP 1502
            R N +NIQM+++  +E IF S S  E    +I+   ++ +  +   ++  L   V+  LP + G++I+ H +  A+  + PY+     L    +PQMP  W+++ GWT+Y  ++ +  KV+ PEEN ++FDVE      +   +AVAV  + WYSW SK L++      S++   DLIPL +  + S+P       + ++GH VSFDRA I+++Y +KG+  RF+DTMS+ +AI G+T  QRSL ++  +         L         +   PE  +  S +W+  +S+N+L DV+  Y     L   K+ R+ F+KG+++D+ N+FQ LM YCATDV+ T ++F +  + +  R PHP +F GMLEMG  YLPVN +   YI  A  TYE + ++ K+ LM LA  +    ++  Y  DPWLWDLDW     KK   P
Sbjct:   33 RTNPLNIQMLSRNLREQIFRS-SVQEYADEDIDRSIRHLEKHSLWGKEAVLLPEVELKLPQMYGDDIDEHFRILAQKQSLPYLEAASQLQQAHLPQMPQKWAWEVGWTRYG-LDGQCKKVNFPEENAVVFDVEVCMAEGRCPTLAVAVSPTAWYSWCSKRLVEERYTWSSQLTLADLIPLETPSNSSRPPGGQWKERLVIGHNVSFDRAHIKEQYLLKGSKMRFLDTMSLHMAISGLTGFQRSLWMASRHGKRRG----LQEVKEHIKKLGRRPEGPMIGSWEWVNISSINNLTDVHALYVGGEPLK--KEPRDIFVKGSMNDVRNNFQELMQYCATDVLATHEVFTQQLSLFMERCPHPVTFAGMLEMGVSYLPVNESWGRYIEDAQDTYEELQREMKKSLMILADDACQLLQDDRYKEDPWLWDLDWDVQEFKKKKMP 464          

HSP 3 Score: 53.5286 bits (127), Expect = 1.522e-6
Identity = 24/62 (38.71%), Postives = 35/62 (56.45%), Query Frame = 3
Query: 1494 SFPKWFRVLVSK--NENSNTFNP--DLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L ++   +    ++P   LIT Q  +  K++ L WDG PLHY  K+ WG L+PG
Sbjct:  533 GHPGWYRKLCARMSEKEDEAWSPGASLITLQMRLTPKLMGLTWDGFPLHYTDKHGWGYLVPG 594          
BLAST of DNA polymerase subunit gamma vs. Ensembl Sea Lamprey
Match: polg (polymerase (DNA directed), gamma [Source:ZFIN;Acc:ZDB-GENE-060303-1])

HSP 1 Score: 246.514 bits (628), Expect = 1.356e-69
Identity = 146/461 (31.67%), Postives = 234/461 (50.76%), Query Frame = 3
Query:  207 SSDDKLRINMMNIQMINKKFQETIF-GSKSTAELDFFEIN-SLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDW-KIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPL-------------------YSNDDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDK-----------WLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLASKEKE-YINDPWLWDLDWSTTK 1487
            S  D+ R+N +NIQM+++   E IF G +S+   +  +++        +      L K+V   LPPLLG++++ H +  A   +  Y+    GL     +P +P  W ++ GWT+Y   +     V  P+E  L+FDVE          +AVA   + WYSW S+ L++       ++   DLIP+                    S+   S  + +VGH VSFDRA +R++Y +  T  RF+DTMS+ +AI G+T  QRSL ++  +                + G+    E +  + +           W+  +S+N+LVDV+  Y     L   K++R+ F+KG+++D+   FQ LM+YCA DV  T ++F +    +  R PHP +  GMLEMG  YLPVN N   Y++ +  TY+ + ++ K+ LM LA ++    + E Y +DPW WD DWST +
Sbjct:    1 SERDETRMNPLNIQMLSRNLHEQIFKGVESSHPEESVQLSKEHLSQHGLWGRDGALLKDVHLRLPPLLGDSVDGHFRALATRQSLGYVRAACGLVACSALPALPREWRYEAGWTRYGP-DGHVEAVPFPDEPGLVFDVEVCVTEGHCPTLAVACSPAAWYSWCSRRLVERRFSWPQQLSLQDLIPMESGSGSRSSASSSSTSSSSSSSQGDSTERLVVGHNVSFDRAHVREQYQLATTRLRFLDTMSLHMAISGLTGFQRSLWMASRHGK--------------RRGLQEVQEHMARTRQKFDGPAMGAWDWVDVSSINNLVDVHGLYVGGQALQ--KEERDVFVKGSMEDVRGSFQELMSYCARDVKATHEVFCQQLPLFMKRCPHPVTLAGMLEMGQCYLPVNHNWERYVSESHDTYQELQREMKQSLMSLANEACGLLQGERYKDDPWFWDQDWSTQE 444          

HSP 2 Score: 51.6026 bits (122), Expect = 9.701e-7
Identity = 21/59 (35.59%), Postives = 32/59 (54.24%), Query Frame = 3
Query: 1494 SFPKWFRVLVSKNENSN-TFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L     +   +  P L++ Q  +  K+L+L WDG PLH+   + WG L+PG
Sbjct:  520 GHPAWYRKLCPPPSDPEWSPGPSLLSLQMRLTPKLLRLSWDGFPLHHTTPHGWGYLVPG 578          
BLAST of DNA polymerase subunit gamma vs. Ensembl Yeast
Match: MIP1 (Mitochondrial DNA polymerase gamma; single subunit of mitochondrial DNA polymerase in yeast, in contrast to metazoan complex of catalytic and accessory subunits; polymorphic in yeast, petites occur more frequently in some lab strains; human ortholog POLG complements yeast mip1 mutant; mutations in human POLG associated with Alpers-Huttenlocher syndrome (AHS), progressive external ophthalmoplegia (PEO), parkinsonism, other mitochondrial diseases [Source:SGD;Acc:S000005857])

HSP 1 Score: 373.629 bits (958), Expect = 9.232e-111
Identity = 189/437 (43.25%), Postives = 278/437 (63.62%), Query Frame = 3
Query: 2142 LPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSKENNE------------------SAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDSVTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKRSQGK-----WVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNE-KFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
            +PH  G      +  +KS+ ++ + G L S +   L    ++   SG +W + + R+QSQF+V + K  NE                  + IIP+++  GT+TRR+VE  WLTA+N+  +R+GSELK  V+ P  +  VGADVDS+E WIA+++GDS+  +HGGT  GWM L+G+K +GTDLH+KT++++G SRN AK+ NY R+YGAG K ++  L ++NP L  +E       L + TKGK  + K     W  G ES +F+KLE IA+ + P TPVL   ++ +L K+ +    F+ S+ NW +QSSGVDYLH L    +++I+ YN+ ARLCI IHDEIR+L  EKDKYR A+ LQI+N++TR++F  ++ + +LPQ+ AFFS++DID  +RK    DCITPSN+        I  GE+L+I Q+LDK+  +L
Sbjct:  554 VPHPNGPTFNCTNLLTKSYNHFFEKGVLKSES--ELAHQALQINSSGSYWMSARERIQSQFVVPSCKFPNEFQSLSAKSSLNNEKTNDLAIIIPKIVPMGTITRRAVENAWLTASNAKANRIGSELKTQVKAPPGYCFVGADVDSEELWIASLVGDSIFNVHGGTAIGWMCLEGTKNEGTDLHTKTAQILGCSRNEAKIFNYGRIYGAGAKFASQLLKRFNPSLTDEETKKIANKLYENTKGKTKRSKLFKKFWYGGSESILFNKLESIAEQETPKTPVLGCGITYSLMKKNLRANSFLPSRINWAIQSSGVDYLHLLCCSMEYIIKKYNLEARLCISIHDEIRFLVSEKDKYRAAMALQISNIWTRAMFCQQMGINELPQNCAFFSQVDIDSVIRKEVNMDCITPSNKTA------IPHGEALDINQLLDKSNSKL 982          

HSP 2 Score: 212.616 bits (540), Expect = 1.617e-56
Identity = 156/521 (29.94%), Postives = 257/521 (49.33%), Query Frame = 3
Query:  183 GRLLNTANSSDDKLRINMMNIQMINKKFQETIFGS-------KSTAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQM---PTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSN-LNTYINRASTTY-ESMIKKEKEILMELAQKSLASKEKE-YINDPWLWDLDWST-----TKKS---------SFPKWFRVLVSKNENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIP 1664
             R  +T  ++ +  RIN + IQ + +  Q  +FGS       + + +L      SL K+  +  +KT +   + F LPPL G +++ H QK     ++PY +  +     K  +M   P  W  + GW KY        +V+ P+E L++FDVETL   +    +A A+  + WY W S ++  G   DD       LIPL   +  +K + I+GH V++DRAR+ +EY  + +   F+DT S+ IA  G+ S QR + +  NN   E  +        S+     S ED +  D WL  ++LNSL DV +++   C +   K  R+ F       I+ +FQ L+ YCATDV  T+++F +++  +  + PHP SF G+  +    LP   N  N Y+N + + Y +S ++ E +I+  +    L   + + Y+ DPWL  LDW+T     TKK           FP+W+R L     + +T  P +    + I + + KL W+  P+ + K++ W   +P
Sbjct:   26 ARWFSTKKNTAEAPRINPVGIQYLGESLQRQVFGSCGGKDEVEQSDKLMELSKKSL-KDHGLWGKKTLITDPISFPLPPLQGRSLDEHFQKIGRFNSEPYKSFCED----KFTEMVARPAEWLRKPGWVKY-VPGMAPVEVAYPDEELVVFDVETLYNVSDYPTLATALSSTAWYLWCSPFICGG---DDPAA----LIPL---NTLNKEQVIIGHNVAYDRARVLEEYNFRDSKAFFLDTQSLHIASFGLCSRQRPMFMK-NNKKKEAEV-------ESEVHPEISIEDYD--DPWLNVSALNSLKDVAKFH---CKIDLDKTDRDFFASTDKSTIIENFQKLVNYCATDVTATSQVFDEIFPVFLKKCPHPVSFAGLKSLSKCILPTKLNDWNDYLNSSESLYQQSKVQIESKIVQIIKDIVLLKDKPDFYLKDPWLSQLDWTTKPLRLTKKGVPAKCQKLPGFPEWYRQLFP---SKDTVEPKITIKSRIIPI-LFKLSWENSPVIWSKESGWCFNVP 513          
BLAST of DNA polymerase subunit gamma vs. Ensembl Nematostella
Match: EDO28790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5H3])

HSP 1 Score: 74.7146 bits (182), Expect = 8.905e-16
Identity = 44/136 (32.35%), Postives = 69/136 (50.74%), Query Frame = 3
Query:  225 RINMMNIQMINKKFQETIFG--SKSTAELDFFE--INSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKY--DTINNKFYKVSVPEENLLIFDVE 614
            R N +NIQM++    E +F     +T   D  +  I  L  +      K+   ++VD  LPPLLGENI+ H +  A   ++ Y  + + +    +P +P MW F+ GW +Y  DT      +V  P ++ L+FDVE
Sbjct:    1 RYNPVNIQMLSASLHEQLFPDTPANTQSTDVIQKCIEHLSAHGLWGKAKSAA-RDVDMTLPPLLGENIDDHFRTIARQQSNAYYDMSQDIASSSLPSVPDMWEFRAGWCRYTEDTDGLHVTQVECPPDDALVFDVE 135          
BLAST of DNA polymerase subunit gamma vs. Ensembl Medaka
Match: polg (DNA polymerase gamma, catalytic subunit [Source:NCBI gene;Acc:101156890])

HSP 1 Score: 457.988 bits (1177), Expect = 6.232e-142
Identity = 278/705 (39.43%), Postives = 369/705 (52.34%), Query Frame = 3
Query: 1494 SFPKWFRVLVSKNENSNTFNP--DLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSD---LTKYNVF--VEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLY--NFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSK---------------ENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR-----SQGKWV----------------------------------------------DGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
              P W+R L  K    + ++P   LI+ Q  +  K++ L WDG PLHY +K+ WG L+PG        +  +  + +   P+ P   I   Y +Y +    + VQ                 L  G+SD    T  +V+  VE M ++        ENL+  N +     +   R S       EE     +  N   ND +               IP  WF  LPH+ G  N VGSPFSK FL  M+ G L +        + +E  K   FWRN   R+ SQ +V   K               E    AI+PQV+ AGTVTRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLG++   G+HG T FGWM LQG K  GTDLHS+T+  +GISR  AKV NY R+YGAG   +   L+++N  L   EA +K + +   TKG R      +G+W+                                               G ES++F+KLE IA+S +P+TPVL+ R+S+ALE + V  +F+TS+ NWVVQSS VDYLH +L   K L + +N++ R CI IHDE+RYL   +D+YR AL LQI NL TRSVF+  L L DLPQS+AFFS +D+D CLRK    DC+TPSN  GL   Y +  GE+L+IYQI++ T G L
Sbjct:  438 GHPGWYRKLCEKMSQEDGWSPGASLISLQMRLTPKLMGLMWDGFPLHYTEKHGWGYLVPG-------RKDNLSPAGENTDPVCPHRSIERIYKEYCE--QNRKVQ--------------PKSLDSGDSDDLIWTDSSVWEKVEEMSSL--------ENLSDENGIGTVQSDTKRRKSPDPLLFPEESHCHYHHGNGPYNDIN---------------IPGCWFFKLPHKDGNHNNVGSPFSKDFLVKMEDGTLRAGRGGTNATLALEINKMMSFWRNAHKRISSQMVVWLRKGELPRNVSRHKDFDEEGQYGAILPQVVTAGTVTRRAVEPTWLTASNARRDRVGSELKAMVQVPPGYHLVGADVDSQELWIAAVLGEAHFAGMHGCTAFGWMTLQGKKSQGTDLHSRTADAVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLNQMEAASKARQMYALTKGIRRYHLSEEGEWLVNELGIDVQREEDGSVSLQELRRISKVASHSSRRKKWDIVGKRVWAGGTESDMFNKLESIAQSAQPATPVLHCRISRALEPKAVRNEFITSRVNWVVQSSAVDYLHLMLVAMKWLFEEHNIDGRFCISIHDEVRYLVRSEDRYRAALALQITNLLTRSVFAHALGLQDLPQSVAFFSSVDVDQCLRKEVIMDCVTPSNPTGLERRYGLPPGEALDIYQIINITDGSL 1096          

HSP 2 Score: 206.838 bits (525), Expect = 6.263e-54
Identity = 135/420 (32.14%), Postives = 214/420 (50.95%), Query Frame = 3
Query:  249 MINKKFQETIFGS---KSTAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDW 1475
            M++K   E IF     + + E     I  L K+ ++  ++T+L  +V+  LP + G+NI+ H +  AE  + PY+  +  L   ++P MP  WS++ GWT+Y   N    KV  P+E+ L+FDVE      +   +AVA+  + WYSW SK LL+      +++   +LIPL +  + S+P       + IVGH VSFDR+ I+++Y +KG+  RF+DTMS+ +AI G+T  QR+L ++       N++ K       K G+    E I+++ +                            KR+  ++            LM YCA DV  T ++F +    +  R PHP +F GMLEMG  YLPVN N + Y+      Y+ + ++ K+ LM LA  +    ++  Y  DPWLWDL+W
Sbjct:    1 MLSKNLHEQIFRGVVPEYSEEAVERSIKHLQKH-QLWGKETSLLPDVELKLPQMYGKNIDEHFRILAEKQSLPYLEAVTKLLQAELPSMPQEWSWEVGWTRYGP-NGGTQKVDFPDESALVFDVEVCMTEGRCPTLAVALSPTNWYSWCSKRLLEERYSWSNQLSLAELIPLETPLNSSRPPGGQWKERLIVGHNVSFDRSHIKEQYLLKGSIVRFLDTMSLHMAISGLTGFQRTLWMA-------NKLGK-------KRGLQEVKEHIKKTGQ----------------------------KRDGPVE------------LMQYCALDVEATHQVFTEQMPLFMERCPHPVTFAGMLEMGVSYLPVNQNWHRYLEDCQDVYDDLQREMKKSLMTLADDACQLLQDARYKEDPWLWDLEW 364          
BLAST of DNA polymerase subunit gamma vs. Ensembl Medaka
Match: polg (DNA polymerase gamma, catalytic subunit [Source:NCBI gene;Acc:101156890])

HSP 1 Score: 457.603 bits (1176), Expect = 7.247e-141
Identity = 278/705 (39.43%), Postives = 369/705 (52.34%), Query Frame = 3
Query: 1494 SFPKWFRVLVSKNENSNTFNP--DLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSD---LTKYNVF--VEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLY--NFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSK---------------ENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR-----SQGKWV----------------------------------------------DGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
              P W+R L  K    + ++P   LI+ Q  +  K++ L WDG PLHY +K+ WG L+PG        +  +  + +   P+ P   I   Y +Y +    + VQ                 L  G+SD    T  +V+  VE M ++        ENL+  N +     +   R S       EE     +  N   ND +               IP  WF  LPH+ G  N VGSPFSK FL  M+ G L +        + +E  K   FWRN   R+ SQ +V   K               E    AI+PQV+ AGTVTRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLG++   G+HG T FGWM LQG K  GTDLHS+T+  +GISR  AKV NY R+YGAG   +   L+++N  L   EA +K + +   TKG R      +G+W+                                               G ES++F+KLE IA+S +P+TPVL+ R+S+ALE + V  +F+TS+ NWVVQSS VDYLH +L   K L + +N++ R CI IHDE+RYL   +D+YR AL LQI NL TRSVF+  L L DLPQS+AFFS +D+D CLRK    DC+TPSN  GL   Y +  GE+L+IYQI++ T G L
Sbjct:  536 GHPGWYRKLCEKMSQEDGWSPGASLISLQMRLTPKLMGLMWDGFPLHYTEKHGWGYLVPG-------RKDNLSPAGENTDPVCPHRSIERIYKEYCE--QNRKVQ--------------PKSLDSGDSDDLIWTDSSVWEKVEEMSSL--------ENLSDENGIGTVQSDTKRRKSPDPLLFPEESHCHYHHGNGPYNDIN---------------IPGCWFFKLPHKDGNHNNVGSPFSKDFLVKMEDGTLRAGRGGTNATLALEINKMMSFWRNAHKRISSQMVVWLRKGELPRNVSRHKDFDEEGQYGAILPQVVTAGTVTRRAVEPTWLTASNARRDRVGSELKAMVQVPPGYHLVGADVDSQELWIAAVLGEAHFAGMHGCTAFGWMTLQGKKSQGTDLHSRTADAVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLNQMEAASKARQMYALTKGIRRYHLSEEGEWLVNELGIDVQREEDGSVSLQELRRISKVASHSSRRKKWDIVGKRVWAGGTESDMFNKLESIAQSAQPATPVLHCRISRALEPKAVRNEFITSRVNWVVQSSAVDYLHLMLVAMKWLFEEHNIDGRFCISIHDEVRYLVRSEDRYRAALALQITNLLTRSVFAHALGLQDLPQSVAFFSSVDVDQCLRKEVIMDCVTPSNPTGLERRYGLPPGEALDIYQIINITDGSL 1194          

HSP 2 Score: 263.462 bits (672), Expect = 4.387e-72
Identity = 157/428 (36.68%), Postives = 239/428 (55.84%), Query Frame = 3
Query:  225 RINMMNIQMINKKFQETIFGS---KSTAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDW 1475
            R+N + IQM++K   E IF     + + E     I  L K+ ++  ++T+L  +V+  LP + G+NI+ H +  AE  + PY+  +  L   ++P MP  WS++ GWT+Y   N    KV  P+E+ L+FDVE      +   +AVA+  + WYSW SK LL+      +++   +LIPL +  + S+P       + IVGH VSFDR+ I+++Y +KG+  RF+DTMS+ +AI G+T  QR+L ++  N   + R  +    +  K G       I   D W+  +S+N+L DVY  Y     L   K+ RE FIKG + D+ N+FQ LM YCA DV  T ++F +    +  R PHP +F GMLEMG  YLPVN N + Y+      Y+ + ++ K+ LM LA  +    ++  Y  DPWLWDL+W
Sbjct:   42 RLNPLKIQMLSKNLHEQIFRGVVPEYSEEAVERSIKHLQKH-QLWGKETSLLPDVELKLPQMYGKNIDEHFRILAEKQSLPYLEAVTKLLQAELPSMPQEWSWEVGWTRYGP-NGGTQKVDFPDESALVFDVEVCMTEGRCPTLAVALSPTNWYSWCSKRLLEERYSWSNQLSLAELIPLETPLNSSRPPGGQWKERLIVGHNVSFDRSHIKEQYLLKGSIVRFLDTMSLHMAISGLTGFQRTLWMA--NKLGKKRGLQEVKEHIKKTGQKRDGPVIGSWD-WVNISSINNLADVYDLYVGGPPLQ--KEAREIFIKGNMTDVRNNFQELMQYCALDVEATHQVFTEQMPLFMERCPHPVTFAGMLEMGVSYLPVNQNWHRYLEDCQDVYDDLQREMKKSLMTLADDACQLLQDARYKEDPWLWDLEW 462          
BLAST of DNA polymerase subunit gamma vs. Ensembl Medaka
Match: polg (DNA polymerase gamma, catalytic subunit [Source:NCBI gene;Acc:101156890])

HSP 1 Score: 457.603 bits (1176), Expect = 7.247e-141
Identity = 278/705 (39.43%), Postives = 369/705 (52.34%), Query Frame = 3
Query: 1494 SFPKWFRVLVSKNENSNTFNP--DLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSD---LTKYNVF--VEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLY--NFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSK---------------ENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR-----SQGKWV----------------------------------------------DGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
              P W+R L  K    + ++P   LI+ Q  +  K++ L WDG PLHY +K+ WG L+PG        +  +  + +   P+ P   I   Y +Y +    + VQ                 L  G+SD    T  +V+  VE M ++        ENL+  N +     +   R S       EE     +  N   ND +               IP  WF  LPH+ G  N VGSPFSK FL  M+ G L +        + +E  K   FWRN   R+ SQ +V   K               E    AI+PQV+ AGTVTRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLG++   G+HG T FGWM LQG K  GTDLHS+T+  +GISR  AKV NY R+YGAG   +   L+++N  L   EA +K + +   TKG R      +G+W+                                               G ES++F+KLE IA+S +P+TPVL+ R+S+ALE + V  +F+TS+ NWVVQSS VDYLH +L   K L + +N++ R CI IHDE+RYL   +D+YR AL LQI NL TRSVF+  L L DLPQS+AFFS +D+D CLRK    DC+TPSN  GL   Y +  GE+L+IYQI++ T G L
Sbjct:  536 GHPGWYRKLCEKMSQEDGWSPGASLISLQMRLTPKLMGLMWDGFPLHYTEKHGWGYLVPG-------RKDNLSPAGENTDPVCPHRSIERIYKEYCE--QNRKVQ--------------PKSLDSGDSDDLIWTDSSVWEKVEEMSSL--------ENLSDENGIGTVQSDTKRRKSPDPLLFPEESHCHYHHGNGPYNDIN---------------IPGCWFFKLPHKDGNHNNVGSPFSKDFLVKMEDGTLRAGRGGTNATLALEINKMMSFWRNAHKRISSQMVVWLRKGELPRNVSRHKDFDEEGQYGAILPQVVTAGTVTRRAVEPTWLTASNARRDRVGSELKAMVQVPPGYHLVGADVDSQELWIAAVLGEAHFAGMHGCTAFGWMTLQGKKSQGTDLHSRTADAVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLNQMEAASKARQMYALTKGIRRYHLSEEGEWLVNELGIDVQREEDGSVSLQELRRISKVASHSSRRKKWDIVGKRVWAGGTESDMFNKLESIAQSAQPATPVLHCRISRALEPKAVRNEFITSRVNWVVQSSAVDYLHLMLVAMKWLFEEHNIDGRFCISIHDEVRYLVRSEDRYRAALALQITNLLTRSVFAHALGLQDLPQSVAFFSSVDVDQCLRKEVIMDCVTPSNPTGLERRYGLPPGEALDIYQIINITDGSL 1194          

HSP 2 Score: 263.462 bits (672), Expect = 4.387e-72
Identity = 157/428 (36.68%), Postives = 239/428 (55.84%), Query Frame = 3
Query:  225 RINMMNIQMINKKFQETIFGS---KSTAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDW 1475
            R+N + IQM++K   E IF     + + E     I  L K+ ++  ++T+L  +V+  LP + G+NI+ H +  AE  + PY+  +  L   ++P MP  WS++ GWT+Y   N    KV  P+E+ L+FDVE      +   +AVA+  + WYSW SK LL+      +++   +LIPL +  + S+P       + IVGH VSFDR+ I+++Y +KG+  RF+DTMS+ +AI G+T  QR+L ++  N   + R  +    +  K G       I   D W+  +S+N+L DVY  Y     L   K+ RE FIKG + D+ N+FQ LM YCA DV  T ++F +    +  R PHP +F GMLEMG  YLPVN N + Y+      Y+ + ++ K+ LM LA  +    ++  Y  DPWLWDL+W
Sbjct:   42 RLNPLKIQMLSKNLHEQIFRGVVPEYSEEAVERSIKHLQKH-QLWGKETSLLPDVELKLPQMYGKNIDEHFRILAEKQSLPYLEAVTKLLQAELPSMPQEWSWEVGWTRYGP-NGGTQKVDFPDESALVFDVEVCMTEGRCPTLAVALSPTNWYSWCSKRLLEERYSWSNQLSLAELIPLETPLNSSRPPGGQWKERLIVGHNVSFDRSHIKEQYLLKGSIVRFLDTMSLHMAISGLTGFQRTLWMA--NKLGKKRGLQEVKEHIKKTGQKRDGPVIGSWD-WVNISSINNLADVYDLYVGGPPLQ--KEAREIFIKGNMTDVRNNFQELMQYCALDVEATHQVFTEQMPLFMERCPHPVTFAGMLEMGVSYLPVNQNWHRYLEDCQDVYDDLQREMKKSLMTLADDACQLLQDARYKEDPWLWDLEW 462          
BLAST of DNA polymerase subunit gamma vs. Ensembl Medaka
Match: polg (DNA polymerase gamma, catalytic subunit [Source:NCBI gene;Acc:101156890])

HSP 1 Score: 412.92 bits (1060), Expect = 8.953e-125
Identity = 220/475 (46.32%), Postives = 281/475 (59.16%), Query Frame = 3
Query: 2157 GEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSK---------------ENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR-----SQGKWV----------------------------------------------DGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRL 3380
            G  N VGSPFSK FL  M+ G L +        + +E  K   FWRN   R+ SQ +V   K               E    AI+PQV+ AGTVTRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLG++   G+HG T FGWM LQG K  GTDLHS+T+  +GISR  AKV NY R+YGAG   +   L+++N  L   EA +K + +   TKG R      +G+W+                                               G ES++F+KLE IA+S +P+TPVL+ R+S+ALE + V  +F+TS+ NWVVQSS VDYLH +L   K L + +N++ R CI IHDE+RYL   +D+YR AL LQI NL TRSVF+  L L DLPQS+AFFS +D+D CLRK    DC+TPSN  GL   Y +  GE+L+IYQI++ T G L
Sbjct:  682 GNHNNVGSPFSKDFLVKMEDGTLRAGRGGTNATLALEINKMMSFWRNAHKRISSQMVVWLRKGELPRNVSRHKDFDEEGQYGAILPQVVTAGTVTRRAVEPTWLTASNARRDRVGSELKAMVQVPPGYHLVGADVDSQELWIAAVLGEAHFAGMHGCTAFGWMTLQGKKSQGTDLHSRTADAVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLNQMEAASKARQMYALTKGIRRYHLSEEGEWLVNELGIDVQREEDGSVSLQELRRISKVASHSSRRKKWDIVGKRVWAGGTESDMFNKLESIAQSAQPATPVLHCRISRALEPKAVRNEFITSRVNWVVQSSAVDYLHLMLVAMKWLFEEHNIDGRFCISIHDEVRYLVRSEDRYRAALALQITNLLTRSVFAHALGLQDLPQSVAFFSSVDVDQCLRKEVIMDCVTPSNPTGLERRYGLPPGEALDIYQIINITDGSL 1156          

HSP 2 Score: 263.462 bits (672), Expect = 3.596e-72
Identity = 157/428 (36.68%), Postives = 239/428 (55.84%), Query Frame = 3
Query:  225 RINMMNIQMINKKFQETIFGS---KSTAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDW 1475
            R+N + IQM++K   E IF     + + E     I  L K+ ++  ++T+L  +V+  LP + G+NI+ H +  AE  + PY+  +  L   ++P MP  WS++ GWT+Y   N    KV  P+E+ L+FDVE      +   +AVA+  + WYSW SK LL+      +++   +LIPL +  + S+P       + IVGH VSFDR+ I+++Y +KG+  RF+DTMS+ +AI G+T  QR+L ++  N   + R  +    +  K G       I   D W+  +S+N+L DVY  Y     L   K+ RE FIKG + D+ N+FQ LM YCA DV  T ++F +    +  R PHP +F GMLEMG  YLPVN N + Y+      Y+ + ++ K+ LM LA  +    ++  Y  DPWLWDL+W
Sbjct:   42 RLNPLKIQMLSKNLHEQIFRGVVPEYSEEAVERSIKHLQKH-QLWGKETSLLPDVELKLPQMYGKNIDEHFRILAEKQSLPYLEAVTKLLQAELPSMPQEWSWEVGWTRYGP-NGGTQKVDFPDESALVFDVEVCMTEGRCPTLAVALSPTNWYSWCSKRLLEERYSWSNQLSLAELIPLETPLNSSRPPGGQWKERLIVGHNVSFDRSHIKEQYLLKGSIVRFLDTMSLHMAISGLTGFQRTLWMA--NKLGKKRGLQEVKEHIKKTGQKRDGPVIGSWD-WVNISSINNLADVYDLYVGGPPLQ--KEAREIFIKGNMTDVRNNFQELMQYCALDVEATHQVFTEQMPLFMERCPHPVTFAGMLEMGVSYLPVNQNWHRYLEDCQDVYDDLQREMKKSLMTLADDACQLLQDARYKEDPWLWDLEW 462          

HSP 3 Score: 56.6102 bits (135), Expect = 1.700e-7
Identity = 24/60 (40.00%), Postives = 35/60 (58.33%), Query Frame = 3
Query: 1494 SFPKWFRVLVSKNENSNTFNP--DLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L  K    + ++P   LI+ Q  +  K++ L WDG PLHY +K+ WG L+PG
Sbjct:  536 GHPGWYRKLCEKMSQEDGWSPGASLISLQMRLTPKLMGLMWDGFPLHYTEKHGWGYLVPG 595          
BLAST of DNA polymerase subunit gamma vs. Ensembl Medaka
Match: polg (DNA polymerase gamma, catalytic subunit [Source:NCBI gene;Acc:101156890])

HSP 1 Score: 413.305 bits (1061), Expect = 1.529e-124
Identity = 222/487 (45.59%), Postives = 285/487 (58.52%), Query Frame = 3
Query: 2118 IPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQS-------QFMVRTSKENNE----SAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDS-VTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKR-----SQGKWV----------------------------------------------DGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGE----------SLNIYQIL 3359
            IP  WF  LPH+ G  N VGSPFSK FL  M+ G L +        + +E  K   FWRN   R++S        F+    K+ +E     AI+PQV+ AGTVTRR+VE  WLTA+N+  DRVGSELKAMVQ P  + +VGADVDSQE WIAAVLG++   G+HG T FGWM LQG K  GTDLHS+T+  +GISR  AKV NY R+YGAG   +   L+++N  L   EA +K + +   TKG R      +G+W+                                               G ES++F+KLE IA+S +P+TPVL+ R+S+ALE + V  +F+TS+ NWVVQSS VDYLH +L   K L + +N++ R CI IHDE+RYL   +D+YR AL LQI NL TRSVF+  L L DLPQS+AFFS +D+D CLRK    DC+TPSN  GL   Y +  GE           LN++ IL
Sbjct:  701 IPGCWFFKLPHKDGNHNNVGSPFSKDFLVKMEDGTLRAGRGGTNATLALEINKMMSFWRNAHKRIRSVTSTLPDDFVSHRHKDFDEEGQYGAILPQVVTAGTVTRRAVEPTWLTASNARRDRVGSELKAMVQVPPGYHLVGADVDSQELWIAAVLGEAHFAGMHGCTAFGWMTLQGKKSQGTDLHSRTADAVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLNQMEAASKARQMYALTKGIRRYHLSEEGEWLVNELGIDVQREEDGSVSLQELRRISKVASHSSRRKKWDIVGKRVWAGGTESDMFNKLESIAQSAQPATPVLHCRISRALEPKAVRNEFITSRVNWVVQSSAVDYLHLMLVAMKWLFEEHNIDGRFCISIHDEVRYLVRSEDRYRAALALQITNLLTRSVFAHALGLQDLPQSVAFFSSVDVDQCLRKEVIMDCVTPSNPTGLERRYGLPPGEFWVLFFQSRAGLNLFAIL 1187          

HSP 2 Score: 263.462 bits (672), Expect = 4.789e-72
Identity = 157/428 (36.68%), Postives = 239/428 (55.84%), Query Frame = 3
Query:  225 RINMMNIQMINKKFQETIFGS---KSTAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKP-------KCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDW 1475
            R+N + IQM++K   E IF     + + E     I  L K+ ++  ++T+L  +V+  LP + G+NI+ H +  AE  + PY+  +  L   ++P MP  WS++ GWT+Y   N    KV  P+E+ L+FDVE      +   +AVA+  + WYSW SK LL+      +++   +LIPL +  + S+P       + IVGH VSFDR+ I+++Y +KG+  RF+DTMS+ +AI G+T  QR+L ++  N   + R  +    +  K G       I   D W+  +S+N+L DVY  Y     L   K+ RE FIKG + D+ N+FQ LM YCA DV  T ++F +    +  R PHP +F GMLEMG  YLPVN N + Y+      Y+ + ++ K+ LM LA  +    ++  Y  DPWLWDL+W
Sbjct:   53 RLNPLKIQMLSKNLHEQIFRGVVPEYSEEAVERSIKHLQKH-QLWGKETSLLPDVELKLPQMYGKNIDEHFRILAEKQSLPYLEAVTKLLQAELPSMPQEWSWEVGWTRYGP-NGGTQKVDFPDESALVFDVEVCMTEGRCPTLAVALSPTNWYSWCSKRLLEERYSWSNQLSLAELIPLETPLNSSRPPGGQWKERLIVGHNVSFDRSHIKEQYLLKGSIVRFLDTMSLHMAISGLTGFQRTLWMA--NKLGKKRGLQEVKEHIKKTGQKRDGPVIGSWD-WVNISSINNLADVYDLYVGGPPLQ--KEAREIFIKGNMTDVRNNFQELMQYCALDVEATHQVFTEQMPLFMERCPHPVTFAGMLEMGVSYLPVNQNWHRYLEDCQDVYDDLQREMKKSLMTLADDACQLLQDARYKEDPWLWDLEW 473          

HSP 3 Score: 56.6102 bits (135), Expect = 1.946e-7
Identity = 24/60 (40.00%), Postives = 35/60 (58.33%), Query Frame = 3
Query: 1494 SFPKWFRVLVSKNENSNTFNP--DLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPG 1667
              P W+R L  K    + ++P   LI+ Q  +  K++ L WDG PLHY +K+ WG L+PG
Sbjct:  547 GHPGWYRKLCEKMSQEDGWSPGASLISLQMRLTPKLMGLMWDGFPLHYTEKHGWGYLVPG 606          
BLAST of DNA polymerase subunit gamma vs. Planmine SMEST
Match: SMESG000050799.1 (SMESG000050799.1)

HSP 1 Score: 2227.59 bits (5771), Expect = 0.000e+0
Identity = 1076/1077 (99.91%), Postives = 1077/1077 (100.00%), Query Frame = 3
Query:  153 SGYLPKPSNFGRLLNTANSSDDKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLASKEKEYINDPWLWDLDWSTTKKSSFPKWFRVLVSKNENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTKYNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDSVTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKRSQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 3383
            +GYLPKPSNFGRLLNTANSSDDKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLASKEKEYINDPWLWDLDWSTTKKSSFPKWFRVLVSKNENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTKYNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDSVTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKRSQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD
Sbjct:    9 NGYLPKPSNFGRLLNTANSSDDKLRINMMNIQMINKKFQETIFGSKSTAELDFFEINSLFKNFKIDTEKTTLNKNVDFDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLASKEKEYINDPWLWDLDWSTTKKSSFPKWFRVLVSKNENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPIIPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTKYNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEGPLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDSVTGIHGGTPFGWMVLQGSKVDGTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKRSQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD 1085          
BLAST of DNA polymerase subunit gamma vs. Planmine SMEST
Match: SMESG000050769.1 (SMESG000050769.1)

HSP 1 Score: 309.301 bits (791), Expect = 2.714e-90
Identity = 167/395 (42.28%), Postives = 235/395 (59.49%), Query Frame = 3
Query:  504 MPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKPKCIVGHFVSFDRARIRDEYCIKGTGTRFIDTMSMQIAIRGMT-SLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESM-IKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDWSTTKKSSFPKWFRVLVSKNENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLP 1679
            MP  + + EGWTKYD   N F KV  P+E ++IFD+E +        +AV +G+  WYSW S  L+     +   +  D+LI L+ N D++  +C++GHFVS+DRAR+ +EY  + + TR++DTMSM IAI GMT SL++  K S                               E  KW T  S N L+DVY  YFPN      KDKR  F+ G+  D++N+FQALM YCA DV+MTA+IFQKL+  ++ RFPH +   GMLE+ SLYLP N+    +I +++  + ++    +K IL + A   LA  K+  Y  DPWLWDL W+       P+W++ L+ K +++N+  P L+TS   IAVK+L+L+WDGLPL+YDKK KWGVL P C +P
Sbjct:    1 MPEKFCYCEGWTKYDKKANSFSKVPFPDEKVMIFDIEVIVNEGNWPSIAVCLGQDSWYSWVSNRLIKSNNTNRDIVYSDELIELFDNKDRNIFRCVIGHFVSYDRARVANEYVNQSSNTRYVDTMSMHIAISGMTASLRQRYKTS-------------------------------EKFKWKTVTSGNGLLDVYSLYFPNKEPPQNKDKRNIFVTGSSTDVINNFQALMKYCANDVLMTAEIFQKLFPIFQKRFPHKSVLYGMLELNSLYLPTNNKWFQFIEQSNKDFYTIGSNHQKIILKKAANIGLALGKDDNYKKDPWLWDLKWT----KPLPRWYKDLIPK-DSANSCEPSLLTSSMGIAVKLLRLRWDGLPLYYDKKYKWGVLKP-CKMP 358          

HSP 2 Score: 170.244 bits (430), Expect = 3.795e-43
Identity = 121/410 (29.51%), Postives = 208/410 (50.73%), Query Frame = 3
Query: 2133 FLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSKEN--NESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDSVTGIHGGTPFGWMVLQGSKVD----GTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKRSQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLN 3344
            F P+ H+ G    V    S   ++ +   RLTS+   ++ +  ++   S +FW++  N +++Q +V+ ++ +  NE AIIP VI      R+   +LW      TN ++G E K+M+  P ++V VG  + +   WI  +  DS+ G  G + FG  VL     +     T L+S  + M  I +N  + L    +YG G K      L  N      +A         + KGK+ +  W +G+ S+ F+ +  + KS +  TP L+++ S+ L   +++      +C   ++SS  DY+ CL+ + K LI    +N+RL IC  +EIR+LC E D+Y++A  L  A+  T+  F+  L+L ++P    F   +DID C R +P +D  + + + G+  NY I+ G SL+
Sbjct:  394 FKPMVHKDGFDKYVSRVLSDDSISNLALNRLTSNL--DIGKEFLQSIGSCLFWKSSGNLIKNQMIVKLNRNSTSNEMAIIPPVIPISNPYRKIDAKLWFDNFYLTN-QIGVEYKSMIMAPQHYVFVGHTLHNIVDWIIGICCDSIHGELGASQFGKEVLNAGLNNLMGFNTTLYSNLANMTNIDKNIFRRLALILIYG-GNKEDIVHFLWKNVSYNMIDAKKYADKYYLKLKGKKIERIWQNGVLSDFFNVMYNVIKSKDLKTPFLSSKFSKPL---IISGNRELMQC--FLKSSVSDYICCLIVYAKALIVEMKLNSRLSICNKNEIRFLCHENDRYKMAYALHCADSATKIAFASFLSLRNVPSEFRFLDSVDIDECWRMNPMNDFCSETGR-GIYYNYGIKPGFSLH 793          
BLAST of DNA polymerase subunit gamma vs. Planmine SMEST
Match: SMESG000050769.1 (SMESG000050769.1)

HSP 1 Score: 303.523 bits (776), Expect = 3.516e-88
Identity = 167/399 (41.85%), Postives = 235/399 (58.90%), Query Frame = 3
Query:  504 MPTMWSFQEGWTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSWTSKYLLDGICKDDSEICKDDLIPLYSNDDKSKPKCIVGHFVSFDRARIRDEYCIK----GTGTRFIDTMSMQIAIRGMT-SLQRSLKISFNNNNTENRIWKLYFSNSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRETFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFTGMLEMGSLYLPVNSNLNTYINRASTTYESM-IKKEKEILMELAQKSLA-SKEKEYINDPWLWDLDWSTTKKSSFPKWFRVLVSKNENSNTFNPDLITSQKSIAVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLP 1679
            MP  + + EGWTKYD   N F KV  P+E ++IFD+E +        +AV +G+  WYSW S  L+     +   +  D+LI L+ N D++  +C++GHFVS+DRAR+ +EY  +     + TR++DTMSM IAI GMT SL++  K S                               E  KW T  S N L+DVY  YFPN      KDKR  F+ G+  D++N+FQALM YCA DV+MTA+IFQKL+  ++ RFPH +   GMLE+ SLYLP N+    +I +++  + ++    +K IL + A   LA  K+  Y  DPWLWDL W+       P+W++ L+ K +++N+  P L+TS   IAVK+L+L+WDGLPL+YDKK KWGVL P C +P
Sbjct:    1 MPEKFCYCEGWTKYDKKANSFSKVPFPDEKVMIFDIEVIVNEGNWPSIAVCLGQDSWYSWVSNRLIKSNNTNRDIVYSDELIELFDNKDRNIFRCVIGHFVSYDRARVANEYVNQWLDESSNTRYVDTMSMHIAISGMTASLRQRYKTS-------------------------------EKFKWKTVTSGNGLLDVYSLYFPNKEPPQNKDKRNIFVTGSSTDVINNFQALMKYCANDVLMTAEIFQKLFPIFQKRFPHKSVLYGMLELNSLYLPTNNKWFQFIEQSNKDFYTIGSNHQKIILKKAANIGLALGKDDNYKKDPWLWDLKWT----KPLPRWYKDLIPK-DSANSCEPSLLTSSMGIAVKLLRLRWDGLPLYYDKKYKWGVLKP-CKMP 362          

HSP 2 Score: 170.629 bits (431), Expect = 3.536e-43
Identity = 121/410 (29.51%), Postives = 208/410 (50.73%), Query Frame = 3
Query: 2133 FLPLPHEKGEGNTVGSPFSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVRTSKEN--NESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQTPTNWVMVGADVDSQEQWIAAVLGDSVTGIHGGTPFGWMVLQGSKVD----GTDLHSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNKIKDLMKQTKGKRSQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQALEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCICIHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSEIDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLN 3344
            F P+ H+ G    V    S   ++ +   RLTS+   ++ +  ++   S +FW++  N +++Q +V+ ++ +  NE AIIP VI      R+   +LW      TN ++G E K+M+  P ++V VG  + +   WI  +  DS+ G  G + FG  VL     +     T L+S  + M  I +N  + L    +YG G K      L  N      +A         + KGK+ +  W +G+ S+ F+ +  + KS +  TP L+++ S+ L   +++      +C   ++SS  DY+ CL+ + K LI    +N+RL IC  +EIR+LC E D+Y++A  L  A+  T+  F+  L+L ++P    F   +DID C R +P +D  + + + G+  NY I+ G SL+
Sbjct:  398 FKPMVHKDGFDKYVSRVLSDDSISNLALNRLTSNL--DIGKEFLQSIGSCLFWKSSGNLIKNQMIVKLNRNSTSNEMAIIPPVIPISNPYRKIDAKLWFDNFYLTN-QIGVEYKSMIMAPQHYVFVGHTLHNIVDWIIGICCDSIHGELGASQFGKEVLNAGLNNLMGFNTTLYSNLANMTNIDKNIFRRLALILIYG-GNKEDIVHFLWKNVSYNMIDAKKYADKYYLKLKGKKIERIWQNGVLSDFFNVMYNVIKSKDLKTPFLSSKFSKPL---IISGNRELMQC--FLKSSVSDYICCLIVYAKALIVEMKLNSRLSICNKNEIRFLCHENDRYKMAYALHCADSATKIAFASFLSLRNVPSEFRFLDSVDIDECWRMNPMNDFCSETGR-GIYYNYGIKPGFSLH 797          
The following BLAST results are available for this feature:
BLAST of DNA polymerase subunit gamma vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POLG5.077e-13047.03DNA polymerase gamma, catalytic subunit [Source:HG... [more]
POLG5.077e-13047.03DNA polymerase gamma, catalytic subunit [Source:HG... [more]
POLG5.517e-11844.38DNA polymerase gamma, catalytic subunit [Source:HG... [more]
POLG9.149e-10145.02DNA polymerase gamma, catalytic subunit [Source:HG... [more]
POLG5.332e-7736.78DNA polymerase gamma, catalytic subunit [Source:HG... [more]
back to top
BLAST of DNA polymerase subunit gamma vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
polg-11.326e-5230.46POLG (Mitochondrial DNA POLymerase Gamma) [Source... [more]
back to top
BLAST of DNA polymerase subunit gamma vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tam2.415e-10240.84gene:FBgn0004406 transcript:FBtr0080571[more]
back to top
BLAST of DNA polymerase subunit gamma vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
polg4.359e-14539.23polymerase (DNA directed), gamma [Source:ZFIN;Acc:... [more]
back to top
BLAST of DNA polymerase subunit gamma vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpst11.341e-12646.06tyrosylprotein sulfotransferase 1 [Source:Xenbase;... [more]
tpst11.550e-12646.36tyrosylprotein sulfotransferase 1 [Source:Xenbase;... [more]
tpst12.625e-12646.07tyrosylprotein sulfotransferase 1 [Source:Xenbase;... [more]
tpst13.167e-12645.87tyrosylprotein sulfotransferase 1 [Source:Xenbase;... [more]
tpst16.616e-12646.07tyrosylprotein sulfotransferase 1 [Source:Xenbase;... [more]
back to top
BLAST of DNA polymerase subunit gamma vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Polg2.177e-13938.89polymerase (DNA directed), gamma [Source:MGI Symbo... [more]
Polg1.867e-7835.51polymerase (DNA directed), gamma [Source:MGI Symbo... [more]
Polg3.419e-2958.89polymerase (DNA directed), gamma [Source:MGI Symbo... [more]
Polg4.481e-2941.18polymerase (DNA directed), gamma [Source:MGI Symbo... [more]
Polg6.787e-1828.73polymerase (DNA directed), gamma [Source:MGI Symbo... [more]
back to top
BLAST of DNA polymerase subunit gamma vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92076|DPOG1_CHICK2.813e-14639.97DNA polymerase subunit gamma-1 (Fragment) OS=Gallu... [more]
sp|Q91684|DPOG1_XENLA1.396e-13639.57DNA polymerase subunit gamma-1 OS=Xenopus laevis O... [more]
sp|P54099|DPOG1_MOUSE1.325e-13438.75DNA polymerase subunit gamma-1 OS=Mus musculus OX=... [more]
sp|Q9QYV8|DPOG1_RAT1.792e-13047.24DNA polymerase subunit gamma-1 OS=Rattus norvegicu... [more]
sp|P54098|DPOG1_HUMAN2.438e-12947.03DNA polymerase subunit gamma-1 OS=Homo sapiens OX=... [more]
back to top
BLAST of DNA polymerase subunit gamma vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WP150.000e+040.87DNA polymerase subunit gamma OS=Echinococcus granu... [more]
A0A087W2450.000e+040.33POLAc domain-containing protein OS=Echinococcus mu... [more]
A0A158QIB60.000e+041.61POLAc domain-containing protein OS=Rodentolepis na... [more]
A0A5K3EXL10.000e+040.37Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K4EUB40.000e+038.93Putative DNA polymerase gamma OS=Schistosoma manso... [more]
back to top
BLAST of DNA polymerase subunit gamma vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
polg3.795e-15141.91DNA polymerase gamma, catalytic subunit [Source:NC... [more]
polg1.683e-14439.46DNA polymerase gamma, catalytic subunit [Source:NC... [more]
polg1.683e-14439.46DNA polymerase gamma, catalytic subunit [Source:NC... [more]
polg2.867e-12744.55DNA polymerase gamma, catalytic subunit [Source:NC... [more]
back to top
BLAST of DNA polymerase subunit gamma vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
polg1.356e-6931.67polymerase (DNA directed), gamma [Source:ZFIN;Acc:... [more]
back to top
BLAST of DNA polymerase subunit gamma vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MIP19.232e-11143.25Mitochondrial DNA polymerase gamma; single subunit... [more]
back to top
BLAST of DNA polymerase subunit gamma vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO287908.905e-1632.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA polymerase subunit gamma vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polg6.232e-14239.43DNA polymerase gamma, catalytic subunit [Source:NC... [more]
polg7.247e-14139.43DNA polymerase gamma, catalytic subunit [Source:NC... [more]
polg7.247e-14139.43DNA polymerase gamma, catalytic subunit [Source:NC... [more]
polg8.953e-12546.32DNA polymerase gamma, catalytic subunit [Source:NC... [more]
polg1.529e-12445.59DNA polymerase gamma, catalytic subunit [Source:NC... [more]
back to top
BLAST of DNA polymerase subunit gamma vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000050799.10.000e+099.91SMESG000050799.1[more]
SMESG000050769.12.714e-9042.28SMESG000050769.1[more]
SMESG000050769.13.516e-8841.85SMESG000050769.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020035 ID=SMED30020035|Name=DNA polymerase subunit gamma|organism=Schmidtea mediterranea sexual|type=transcript|length=3490bp
AGCTGCATTGATTGTAAAATGCTAAATTTGATTCGAACTATAAAGTAATA
GTCAATTATTATTTTTGTATATTTAATGTTAAGTAATTTTAATACTAAAA
TTATCGAAAAATTTAAAAATATCTCAATAATAATTTACGATTTTTATCAT
ATAGTGGATATTTGCCGAAACCTTCAAATTTTGGACGACTACTTAATACA
GCTAATTCTTCAGATGATAAGTTAAGAATAAATATGATGAATATTCAAAT
GATAAACAAAAAGTTTCAAGAGACTATATTTGGGAGTAAATCCACTGCAG
AATTAGATTTTTTTGAAATTAATTCATTATTTAAAAACTTTAAAATAGAT
ACTGAAAAAACTACATTAAATAAAAACGTTGATTTTGACTTACCACCATT
ATTGGGTGAAAATATTGAAATTCACTTGCAAAAAGCTGCAGAAACTTTAA
ATGATCCATATATGGCATTGTTAAAAGGTTTAGATGATTGGAAGATTCCA
CAAATGCCAACAATGTGGTCGTTTCAAGAAGGATGGACAAAATATGACAC
AATCAATAATAAATTCTATAAAGTTTCAGTACCAGAAGAAAATTTATTAA
TTTTTGATGTTGAAACCCTTCCAAAATATACACAGCGAGCAGTTATGGCA
GTGGCTGTTGGGAAGAGTTATTGGTATTCTTGGACAAGCAAATATCTGTT
AGATGGAATCTGTAAAGACGATTCAGAAATATGCAAAGACGATTTAATAC
CATTATATTCCAACGACGATAAATCTAAACCGAAATGTATTGTTGGACAT
TTTGTTAGTTTTGACAGAGCGAGAATTCGCGATGAATATTGCATAAAAGG
AACCGGCACTCGATTCATTGATACTATGTCAATGCAAATCGCAATACGAG
GAATGACATCATTGCAAAGGAGTCTGAAGATTTCATTTAACAATAATAAT
ACGGAAAATAGAATCTGGAAGCTCTATTTCAGTAATTCTTCAAAAAATGG
CATGAATAATTCCCCGGAAGACATTGAGGAATCGGATAAGTGGTTGACTG
AAGCAAGTCTAAATAGTTTAGTAGACGTCTATCAATACTATTTTCCAAAT
TGCAATCTTTCTTCATTGAAAGATAAAAGAGAAACCTTTATAAAAGGTAC
AATAGATGATATTGTAAATGATTTTCAAGCGCTGATGACATATTGCGCTA
CTGATGTAATAATGACTGCGAAAATTTTTCAAAAATTGTGGACAGATTAT
CGAGTTCGATTTCCTCATCCTGCTTCATTTACCGGCATGTTAGAAATGGG
ATCACTATATTTACCTGTAAATTCAAATCTAAATACCTATATAAATCGAG
CTTCTACTACATACGAATCAATGATAAAAAAAGAAAAAGAAATTTTGATG
GAATTAGCTCAAAAATCTTTGGCTTCTAAAGAAAAAGAATATATTAACGA
TCCTTGGTTGTGGGATTTAGATTGGTCAACTACAAAGAAGTCATCATTTC
CAAAATGGTTTAGAGTATTAGTTAGTAAGAATGAGAATTCCAACACTTTT
AATCCAGATCTGATAACATCACAAAAAAGTATAGCTGTAAAAATGTTAAA
ATTGAAATGGGACGGTCTTCCTTTACATTACGATAAGAAGAACAAATGGG
GAGTCTTAATTCCTGGTTGTTATTTACCAGTTTGGTACGACGAAAAGTTT
ATGGATATTTCCAATAAACTCATTTGGCCAATTATACCCGTAGAAAGGAT
CAGTCCTTCATACATAGATTATTTTCAATTTCCATTGCAAAAATACGTAC
AATTTTGGGTTCCATTGTTTGTCAGCAGATTGGAAGCGTTTCGTGATTTT
CTTTTATCATTGGGCAATAGTGATTTGACAAAATATAACGTTTTTGTTGA
ATATATGATGGCAATAGTGGAACCTATAAATTTTACGCCAGAAAATCTCA
CAAAAGTTAACTCATTGCTTTGCGAGATCAAGGAAATCACATTGCGAAAT
AGCAAGGGTTACTACAATTCAAATGAAGAAGGCCCATTAAGTTTATATAA
TTTCCAAATGAATGATTTCAGTTCATTGTTCGCAAAAACAAAATGTCTCT
TAACTGAAAACCCCATTATACCTTTTGTTTGGTTTTTACCATTACCTCAT
GAGAAAGGAGAAGGAAACACTGTCGGGTCACCTTTCTCTAAGTCATTTCT
CAACTACATGCAATCTGGGCGCCTGACCAGTCACGCAGCTAATAATTTAT
TGGAAATAATGATTGAAGGGAAAAAAAGTGGAGTTTTTTGGCGAAATTAT
CAAAATCGTGTCCAGTCACAGTTCATGGTTCGAACATCTAAAGAAAACAA
CGAATCAGCTATCATTCCACAAGTTATAGTAGCAGGAACAGTGACAAGAA
GGTCTGTAGAAAGGTTGTGGCTAACCGCGACTAACTCCACAAATGACAGA
GTAGGTAGTGAACTTAAAGCGATGGTTCAAACACCCACAAATTGGGTGAT
GGTAGGTGCGGATGTTGATTCTCAAGAGCAGTGGATTGCCGCTGTACTCG
GAGATTCTGTAACTGGTATTCACGGTGGAACTCCATTTGGTTGGATGGTT
TTGCAGGGTTCAAAAGTTGATGGAACCGATCTTCATTCTAAAACATCAAA
AATGATCGGTATAAGTCGAAATGCAGCCAAAGTTTTAAATTATTCCAGAA
TGTACGGCGCTGGAATTAAATCATCTACCGATACATTGCTAAAGTATAAT
CCCGAACTCAAGCCACAAGAAGCTTTTAATAAAATAAAGGATTTAATGAA
ACAAACCAAAGGTAAAAGATCTCAAGGCAAATGGGTTGATGGAATAGAAT
CGGAGGTGTTTTCTAAATTAGAAGAAATAGCAAAATCAGACGAACCTTCT
ACTCCGGTTCTTAATGCGAGACTCAGTCAAGCTTTGGAGAAACGTGTTGT
GAATGAAAAATTTATGACAAGCAAATGTAACTGGGTGGTTCAGAGCAGTG
GTGTTGATTACCTCCATTGTCTGCTAACTTTCACGAAACATCTTATCCAG
CTGTATAACGTCAATGCTAGACTCTGCATTTGCATCCATGACGAGATTCG
TTATCTTTGTGAAGAAAAAGACAAATATAGATTAGCTTTAATACTCCAAA
TCGCCAACCTTTATACAAGAAGCGTGTTTTCAATGAAGCTCAACTTATTT
GATTTGCCACAGTCTATCGCGTTTTTCAGTGAAATCGACATAGACTATTG
TTTGAGGAAAAGCCCCACAGATGATTGCATCACTCCTTCAAACCAAAATG
GATTACTGAATAATTATAATATACAGAAAGGAGAAAGTTTGAATATTTAC
CAGATATTAGACAAAACCGGCGGCAGATTAGATTAAATTTAAATTTATAT
TTAACCACACTATGACCCAGAGATAATATTTAAACATTTGTAAAAATTAT
TTTTCTGGATTTATGCATTTAATGAAAAAATTTTGTCATT
back to top

protein sequence of SMED30020035-orf-1

>SMED30020035-orf-1 ID=SMED30020035-orf-1|Name=SMED30020035-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1051bp
MMNIQMINKKFQETIFGSKSTAELDFFEINSLFKNFKIDTEKTTLNKNVD
FDLPPLLGENIEIHLQKAAETLNDPYMALLKGLDDWKIPQMPTMWSFQEG
WTKYDTINNKFYKVSVPEENLLIFDVETLPKYTQRAVMAVAVGKSYWYSW
TSKYLLDGICKDDSEICKDDLIPLYSNDDKSKPKCIVGHFVSFDRARIRD
EYCIKGTGTRFIDTMSMQIAIRGMTSLQRSLKISFNNNNTENRIWKLYFS
NSSKNGMNNSPEDIEESDKWLTEASLNSLVDVYQYYFPNCNLSSLKDKRE
TFIKGTIDDIVNDFQALMTYCATDVIMTAKIFQKLWTDYRVRFPHPASFT
GMLEMGSLYLPVNSNLNTYINRASTTYESMIKKEKEILMELAQKSLASKE
KEYINDPWLWDLDWSTTKKSSFPKWFRVLVSKNENSNTFNPDLITSQKSI
AVKMLKLKWDGLPLHYDKKNKWGVLIPGCYLPVWYDEKFMDISNKLIWPI
IPVERISPSYIDYFQFPLQKYVQFWVPLFVSRLEAFRDFLLSLGNSDLTK
YNVFVEYMMAIVEPINFTPENLTKVNSLLCEIKEITLRNSKGYYNSNEEG
PLSLYNFQMNDFSSLFAKTKCLLTENPIIPFVWFLPLPHEKGEGNTVGSP
FSKSFLNYMQSGRLTSHAANNLLEIMIEGKKSGVFWRNYQNRVQSQFMVR
TSKENNESAIIPQVIVAGTVTRRSVERLWLTATNSTNDRVGSELKAMVQT
PTNWVMVGADVDSQEQWIAAVLGDSVTGIHGGTPFGWMVLQGSKVDGTDL
HSKTSKMIGISRNAAKVLNYSRMYGAGIKSSTDTLLKYNPELKPQEAFNK
IKDLMKQTKGKRSQGKWVDGIESEVFSKLEEIAKSDEPSTPVLNARLSQA
LEKRVVNEKFMTSKCNWVVQSSGVDYLHCLLTFTKHLIQLYNVNARLCIC
IHDEIRYLCEEKDKYRLALILQIANLYTRSVFSMKLNLFDLPQSIAFFSE
IDIDYCLRKSPTDDCITPSNQNGLLNNYNIQKGESLNIYQILDKTGGRLD
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041336DNApol_Exo
IPR002297DNA-dir_DNA_pol_A_mt
IPR001098DNA-dir_DNA_pol_A_palm_dom
IPR012337RNaseH-like_sf
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0071897DNA biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003887DNA-directed DNA polymerase activity
GO:0003676nucleic acid binding
Vocabulary: cellular component
TermDefinition
GO:0005760gamma DNA polymerase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 382..402
NoneNo IPR availableGENE3DG3DSA:3.30.70.370coord: 738..971
e-value: 4.9E-13
score: 51.1
NoneNo IPR availableGENE3DG3DSA:1.10.150.20coord: 764..923
e-value: 4.9E-13
score: 51.1
NoneNo IPR availableGENE3DG3DSA:3.30.420.390coord: 60..268
e-value: 4.5E-59
score: 201.9
coord: 269..362
e-value: 8.2E-24
score: 86.4
NoneNo IPR availableSUPERFAMILYSSF56672DNA/RNA polymerasescoord: 633..1009
IPR002297DNA-directed DNA-polymerase, family A, mitochondriaPRINTSPR00867DNAPOLGcoord: 718..744
score: 67.2
coord: 337..346
score: 38.57
coord: 819..827
score: 77.78
coord: 188..202
score: 68.57
coord: 982..998
score: 54.62
coord: 966..981
score: 57.14
coord: 913..929
score: 70.59
coord: 53..65
score: 50.55
coord: 867..880
score: 58.16
IPR002297DNA-directed DNA-polymerase, family A, mitochondriaPANTHERPTHR10267DNA POLYMERASE SUBUNIT GAMMA-1coord: 2..1047
IPR001098DNA-directed DNA polymerase, family A, palm domainSMARTSM00482polaultra3coord: 741..963
e-value: 1.9E-52
score: 190.2
IPR001098DNA-directed DNA polymerase, family A, palm domainPFAMPF00476DNA_pol_Acoord: 649..998
e-value: 2.3E-43
score: 148.7
IPR041336DNA mitochondrial polymerase, exonuclease domainPFAMPF18136DNApol_Exocoord: 48..339
e-value: 1.1E-86
score: 290.5
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 107..337