slc35a-1

Overview
Nameslc35a-1 (AKN21637.1)
Smed IDSMED30020026
Length (bp)1079
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc35a-1 (SMED30020026) t-SNE clustered cells

Violin plots show distribution of expression levels for slc35a-1 (SMED30020026) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc35a-1 (SMED30020026) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc35a-1 (SMED30020026) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020026

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30020026SMESG000022370.1 dd_Smed_v4_8844_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020026SMESG000022370.1 dd_Smed_v4_8844_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30020026SMESG000022370.1 dd_Smed_v4_8844_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020026SMESG000022370.1 dd_Smed_v4_8844_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc35a-1 vs. Ensembl Human
Match: SLC35A3 (solute carrier family 35 member A3 [Source:HGNC Symbol;Acc:HGNC:11023])

HSP 1 Score: 337.421 bits (864), Expect = 1.099e-114
Identity = 192/317 (60.57%), Postives = 246/317 (77.60%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            NLKYVSL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE++K+  CI ++   ++   +    ++  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL  +QW SLVILM GV+FVQWPS+S+  +  LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV + D   + K+GFFQGYN +TWIV++LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:    4 NLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAG 320          
BLAST of slc35a-1 vs. Ensembl Human
Match: SLC35A3 (solute carrier family 35 member A3 [Source:HGNC Symbol;Acc:HGNC:11023])

HSP 1 Score: 337.421 bits (864), Expect = 1.099e-114
Identity = 192/317 (60.57%), Postives = 246/317 (77.60%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            NLKYVSL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE++K+  CI ++   ++   +    ++  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL  +QW SLVILM GV+FVQWPS+S+  +  LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV + D   + K+GFFQGYN +TWIV++LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:    4 NLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAG 320          
BLAST of slc35a-1 vs. Ensembl Human
Match: SLC35A3 (solute carrier family 35 member A3 [Source:HGNC Symbol;Acc:HGNC:11023])

HSP 1 Score: 337.421 bits (864), Expect = 1.099e-114
Identity = 192/317 (60.57%), Postives = 246/317 (77.60%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            NLKYVSL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE++K+  CI ++   ++   +    ++  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL  +QW SLVILM GV+FVQWPS+S+  +  LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV + D   + K+GFFQGYN +TWIV++LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:    4 NLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAG 320          
BLAST of slc35a-1 vs. Ensembl Human
Match: SLC35A3 (solute carrier family 35 member A3 [Source:HGNC Symbol;Acc:HGNC:11023])

HSP 1 Score: 338.961 bits (868), Expect = 1.354e-114
Identity = 193/322 (59.94%), Postives = 248/322 (77.02%), Query Frame = 1
Query:   67 KIINMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            K +  NLKYVSL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE++K+  CI ++   ++   +    ++  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL  +QW SLVILM GV+FVQWPS+S+  +  LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV + D   + K+GFFQGYN +TWIV++LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:   41 KTMFANLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAG 362          
BLAST of slc35a-1 vs. Ensembl Human
Match: SLC35A3 (solute carrier family 35 member A3 [Source:HGNC Symbol;Acc:HGNC:11023])

HSP 1 Score: 312.768 bits (800), Expect = 2.220e-105
Identity = 167/271 (61.62%), Postives = 212/271 (78.23%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFAT 894
            NLKYVSL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE++K+  CI ++   ++   +    ++  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL  +QW SLVILM GV+FVQWPS+S+  +  LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV + D   + K+GFFQGYN +TWIV++LQA+GGLVIA VIKYADNILKGFAT
Sbjct:    4 NLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFAT 274          
BLAST of slc35a-1 vs. Ensembl Celegans
Match: nstp-4 (Nucleotide Sugar TransPorter family [Source:UniProtKB/TrEMBL;Acc:O16658])

HSP 1 Score: 295.434 bits (755), Expect = 2.188e-98
Identity = 174/323 (53.87%), Postives = 219/323 (67.80%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYE---DTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSN----SKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPS 1029
            NLK +SLV+LI QTTALVL +RYS+ +     +Y+SSTAV  AEIIKL TC  +I   N ++F    N +  EI  + +   D+LK++VP+ +Y IQNNLL+ AL  LDAATYQVTYQLKILTTA+FSV +L K L  + W +L++L  GV+ VQ+PS     SK        S  ++GL +VL AC SSGFAGVYFEKILK S  S+W+RNIQL  F     L    + DW  I   GF +GYN + WIV++LQA GGLVIA+V+KYADNILKGFA S+SIILSS  S+ +L D    T F IG T V+ ATFLYG+ PK +
Sbjct:   10 NLKLISLVVLIVQTTALVLTLRYSQTQKSEGPRYLSSTAVVCAEIIKLITCFFVIYRNNGYRFSGMLNELNREIFASPQTRADSLKVAVPAIMYVIQNNLLFFALKKLDAATYQVTYQLKILTTAIFSVTMLGKSLHRYNWMALILLTAGVALVQYPSGDSTTSKSTAAEHDASDNILGLGAVLAACFSSGFAGVYFEKILKTSKVSLWIRNIQLAFFSVFGALLVCWLYDWQAISDDGFLRGYNGVIWIVVLLQAYGGLVIALVVKYADNILKGFAVSLSIILSSFTSWLVLGDLTITTTFAIGATVVIFATFLYGHEPKST 332          
BLAST of slc35a-1 vs. Ensembl Celegans
Match: nstp-5 (Nucleotide Sugar TransPorter family [Source:UniProtKB/TrEMBL;Acc:E5QCI0])

HSP 1 Score: 213.001 bits (541), Expect = 1.439e-65
Identity = 144/368 (39.13%), Postives = 198/368 (53.80%), Query Frame = 1
Query:   85 LKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWP---SNSKRGNINLSF-----------------------------------SGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSG---------FFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTP-KPSNE-LP 1041
            +KY SLV+L+ Q  +LVL MRY+  +     K++ +  V   EI K    + + C + +         I  E   N+ DTLK+ VPSA+YT+QN LLY+A+ NL AATY VTYQLKILTTA F+VL+L+++L   QW SL +L  GV  VQ+    SN +      +                                       ++G ++VL+ACV SGFAG+YFEKILKGS+ SIW+RNIQL             V D S + + G           QG++W  W+ + + A GGLV+AVVIKYADNILK FAT    I+ +  + Y L +F P+  FL+G + V+ A F Y   P K S++ LP
Sbjct:    9 IKYSSLVVLVVQNCSLVLFMRYAMTKD--RPKFLKTITVLFGEIFKCTVSLLLACIEEK-SIAKGLRKIHHEFFVNWRDTLKVLVPSAIYTVQNFLLYVAVDNLPAATYMVTYQLKILTTAAFTVLVLHRRLTIQQWISLFVLFAGVVVVQYDQKMSNEREKAAAAAVLSSTLAPTTTVSPFSNLTTTLTTVVTTASLASSKTENSVLGFIAVLIACVLSGFAGIYFEKILKGSNVSIWIRNIQLAFPSIFFAFLFASVKDNSSLYQDGPNPIEIWNNMLQGFDWAVWVTVAINAFGGLVVAVVIKYADNILKAFAT-SLAIVLNCIAAYFLFNFRPSILFLVGASGVIAAVFAYSMYPYKASHQALP 372          
BLAST of slc35a-1 vs. Ensembl Celegans
Match: nstp-3 (Nucleotide Sugar TransPorter family [Source:UniProtKB/TrEMBL;Acc:O01879])

HSP 1 Score: 199.519 bits (506), Expect = 5.171e-61
Identity = 123/323 (38.08%), Postives = 199/323 (61.61%), Query Frame = 1
Query:   76 NMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTP--KPSNEL 1038
            +   KY  ++LL  Q  ++ L+ RYSR     S  + ++  VFM EIIK+  C +I+ +  +   K   N +K  I  +  +TLK+ +P+ +YT+QNNL YIALS+L+A T+ ++YQ+KI TTA+F    L KKL + QW +LV+L+LGV+ +Q+  +    + ++     M G ++VL  C +S FAGVY EK+LK S+ SIW++NI+L L G  +    +   DW +I + G F+G++++   + +  ++GG++I+VVIKYADNILK +A     I+ +    +IL DF P   FL+GT  V+++  +Y   P  +P ++L
Sbjct:    7 DSKFKYFGILLLTIQQASMPLMARYSRARED-SNVFFTTVNVFMMEIIKVVVCSAIMIYTTKSVMK-YINELKLAIFEHRSETLKVCIPALIYTLQNNLYYIALSHLEATTFCISYQMKIFTTAIFMYFFLGKKLSTKQWWALVLLVLGVADIQYVYSPPPASEDVE-QNPMYGFMAVLTMCFTSAFAGVYLEKVLKSSNASIWVQNIRLALIGLPISFLSMWYYDWEKINEQGAFRGWDFVVVCLTVTNSVGGILISVVIKYADNILKAYAQ-SMAIIGAAVGSWILFDFAPGFMFLLGTFMVIVSIIIYTAFPYQEPESKL 325          
BLAST of slc35a-1 vs. Ensembl Celegans
Match: srf-3 (UDP-galactose/UDP-N-acetylglucosamine transporter srf-3 [Source:UniProtKB/Swiss-Prot;Acc:Q93890])

HSP 1 Score: 192.971 bits (489), Expect = 4.452e-58
Identity = 119/310 (38.39%), Postives = 188/310 (60.65%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSP-SIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLY 1008
            N+K   L+ L  Q +   L++RYSR        ++S+ AV++ E+IK F C+ ++    +   +   + ++++I+    DTLK+ +P+ +Y +QNNL Y+A S+LDAAT+ +T QLKI T A+F+V++L + L   QW +L +L +GVS VQ      + +   S     +G ++V++AC  SGFAG+YFEKILKGS+P S+WMRN+Q+ +F        + + D   + + G   G++ I W+ ++   +GGL +AV IKYADNI K FAT    I+ S      L DFIP+  FL+G + V+ + FLY
Sbjct:   40 NMKTAILIWLTLQNSIHTLLIRYSRARE-VDAMFVSTVAVWLTEVIKCFICLFLVA--QEETPRRFIHALRTQILEQPYDTLKVCIPAMIYIVQNNLFYVAASHLDAATFMITSQLKIFTAAIFTVIILRRSLNRTQWFALAVLFVGVSLVQLQGTKAKES---SGESPFVGFVAVVVACCLSGFAGIYFEKILKGSAPVSLWMRNVQMAVFSIPASFSAIYMQDSKTVNEYGLLYGFDSIVWLTVLWYGVGGLSVAVCIKYADNIAKNFAT-SVAIILSTIGSIFLFDFIPSFTFLLGASLVIFSIFLY 342          
BLAST of slc35a-1 vs. Ensembl Celegans
Match: srf-3 (UDP-galactose/UDP-N-acetylglucosamine transporter srf-3 [Source:UniProtKB/Swiss-Prot;Acc:Q93890])

HSP 1 Score: 190.66 bits (483), Expect = 1.074e-57
Identity = 118/309 (38.19%), Postives = 187/309 (60.52%), Query Frame = 1
Query:   85 LKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSP-SIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLY 1008
            +K   L+ L  Q +   L++RYSR        ++S+ AV++ E+IK F C+ ++    +   +   + ++++I+    DTLK+ +P+ +Y +QNNL Y+A S+LDAAT+ +T QLKI T A+F+V++L + L   QW +L +L +GVS VQ      + +   S     +G ++V++AC  SGFAG+YFEKILKGS+P S+WMRN+Q+ +F        + + D   + + G   G++ I W+ ++   +GGL +AV IKYADNI K FAT    I+ S      L DFIP+  FL+G + V+ + FLY
Sbjct:    1 MKTAILIWLTLQNSIHTLLIRYSRARE-VDAMFVSTVAVWLTEVIKCFICLFLVA--QEETPRRFIHALRTQILEQPYDTLKVCIPAMIYIVQNNLFYVAASHLDAATFMITSQLKIFTAAIFTVIILRRSLNRTQWFALAVLFVGVSLVQLQGTKAKES---SGESPFVGFVAVVVACCLSGFAGIYFEKILKGSAPVSLWMRNVQMAVFSIPASFSAIYMQDSKTVNEYGLLYGFDSIVWLTVLWYGVGGLSVAVCIKYADNIAKNFAT-SVAIILSTIGSIFLFDFIPSFTFLLGASLVIFSIFLY 302          
BLAST of slc35a-1 vs. Ensembl Fly
Match: Ugalt (gene:FBgn0024994 transcript:FBtr0273276)

HSP 1 Score: 242.662 bits (618), Expect = 2.884e-77
Identity = 157/347 (45.24%), Postives = 214/347 (61.67%), Query Frame = 1
Query:   52 FNHLIKIINMN-LKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTF-NIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSF---------------SGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSNELP 1041
            ++H  + +N N LKY+SL+ L  Q   L L MRY+R   G    ++SSTAV MAE  KL TC+ ++ F  + K    F   +   I+ N  DTLK+ VPS +Y +QNNLLY++ S+LDAATYQVTYQLKILTTA+F+V++L +KL + QW +L++L++G+  VQ        + +                    +M+GL + L AC  SGFAG+YFEKILKG+  S+WMRN+QL L     GL    V D S I   GFF+GY+   W +++LQA GGL++AVV+KYADNILKGFATS++II+S + S YI    +    F  G   V+ + FLYGY P  S   P
Sbjct:   12 YSH--RTVNANTLKYISLLTLTLQNAILGLSMRYARTRPG--DIFLSSTAVLMAEFAKLITCLFLV-FNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNL-TLQFSFGAGLVIASIFLYGYDPARSAPKP 352          
BLAST of slc35a-1 vs. Ensembl Fly
Match: Ugalt (gene:FBgn0024994 transcript:FBtr0345710)

HSP 1 Score: 242.276 bits (617), Expect = 3.113e-77
Identity = 157/342 (45.91%), Postives = 211/342 (61.70%), Query Frame = 1
Query:   73 INMN---LKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTF-NIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSF---------------SGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSNELP 1041
            I+MN   LKY+SL+ L  Q   L L MRY+R   G    ++SSTAV MAE  KL TC+ ++ F  + K    F   +   I+ N  DTLK+ VPS +Y +QNNLLY++ S+LDAATYQVTYQLKILTTA+F+V++L +KL + QW +L++L++G+  VQ        + +                    +M+GL + L AC  SGFAG+YFEKILKG+  S+WMRN+QL L     GL    V D S I   GFF+GY+   W +++LQA GGL++AVV+KYADNILKGFATS++II+S + S YI    +    F  G   V+ + FLYGY P  S   P
Sbjct:    4 IHMNANTLKYISLLTLTLQNAILGLSMRYARTRPG--DIFLSSTAVLMAEFAKLITCLFLV-FNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNL-TLQFSFGAGLVIASIFLYGYDPARSAPKP 341          
BLAST of slc35a-1 vs. Ensembl Fly
Match: Ugalt (gene:FBgn0024994 transcript:FBtr0070501)

HSP 1 Score: 242.276 bits (617), Expect = 3.113e-77
Identity = 157/342 (45.91%), Postives = 211/342 (61.70%), Query Frame = 1
Query:   73 INMN---LKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTF-NIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSF---------------SGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSNELP 1041
            I+MN   LKY+SL+ L  Q   L L MRY+R   G    ++SSTAV MAE  KL TC+ ++ F  + K    F   +   I+ N  DTLK+ VPS +Y +QNNLLY++ S+LDAATYQVTYQLKILTTA+F+V++L +KL + QW +L++L++G+  VQ        + +                    +M+GL + L AC  SGFAG+YFEKILKG+  S+WMRN+QL L     GL    V D S I   GFF+GY+   W +++LQA GGL++AVV+KYADNILKGFATS++II+S + S YI    +    F  G   V+ + FLYGY P  S   P
Sbjct:    4 IHMNANTLKYISLLTLTLQNAILGLSMRYARTRPG--DIFLSSTAVLMAEFAKLITCLFLV-FNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNL-TLQFSFGAGLVIASIFLYGYDPARSAPKP 341          
BLAST of slc35a-1 vs. Ensembl Fly
Match: senju (gene:FBgn0031676 transcript:FBtr0079009)

HSP 1 Score: 63.1586 bits (152), Expect = 8.817e-11
Identity = 69/281 (24.56%), Postives = 127/281 (45.20%), Query Frame = 1
Query:  160 ESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKL-SVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLG-----VSFVQWPSNSKRGNINLSFSGQM------------------------IGLLSVLMACVSSGFAGVYFEKIL--KGSSPSIWMRNI----QXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFAT 894
            ES  S  Y + T V + E+ KL     + C  N  +     ++++   V    + L L  VP+ LY + NNL ++ L+  D  TY +  QL+++ T +   ++  K L   QW SL++L LG     V F  + S++   + + +   Q+                        +  + +L   + S  AGVY E +L  KG+  +I+++N+       +  +V+ L    + D    +  G    ++ +  I+I+  A  G+V +  +KY ++ILK FA+
Sbjct:   37 ESNNSYGYNTVTVVLLTEVFKLIVSTCLYCRDNNLR-----SLVRD--VQKDRNVLGLYMVPAFLYCLYNNLAFVNLATFDPTTYYLLLQLRVVVTGILFQIIFKKYLSQRQWISLILLTLGCMMKQVDFGSFYSDANDDSESAAIQQQLQSHNKTTSAETHAHGKNMSGFDFSLSAVFILAQTICSCLAGVYNEYLLKDKGADVNIFVQNVFMYLDSIVCNAVILLLRGELLDAFSPQNLGSIMRFSVL--IIIVNNAAIGIVTSFFLKYMNSILKTFAS 308          
BLAST of slc35a-1 vs. Ensembl Zebrafish
Match: slc35a3a (solute carrier family 35 member A3a [Source:ZFIN;Acc:ZDB-GENE-081105-80])

HSP 1 Score: 329.331 bits (843), Expect = 1.407e-111
Identity = 185/319 (57.99%), Postives = 247/319 (77.43%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRG--NINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
             LKY+SL +L+FQTT+LVL MRYSR   G   +Y++S+AV +AE +K+ TC+ ++  +N +  +   +I++ EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L ++L  +QW SL+ILM GV+FVQWP++S       +L+   Q +GL++VL+AC SSGFAGVYFEKILK +  S+W+RNIQLGLFG V G+FG+L  D   +R+ G FQGYN +TWIV+ LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY++L DF P + F +G   V++ATFLYGY  KP +
Sbjct:    5 KLKYLSLGVLVFQTTSLVLTMRYSRTLQGDGPRYLASSAVVVAEFLKILTCVGLVFKENSYSGRALSSIMRQEIIHKPVETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGRRLGVYQWLSLLILMAGVAFVQWPTDSPADPQKEHLTAGSQFVGLVAVLVACCSSGFAGVYFEKILKETKQSVWVRNIQLGLFGLVFGVFGMLAYDGDRVREHGMFQGYNTLTWIVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFLLEDFEPTSVFFLGAILVIMATFLYGYENKPPS 323          
BLAST of slc35a-1 vs. Ensembl Zebrafish
Match: slc35a3a (solute carrier family 35 member A3a [Source:ZFIN;Acc:ZDB-GENE-081105-80])

HSP 1 Score: 329.331 bits (843), Expect = 1.407e-111
Identity = 185/319 (57.99%), Postives = 247/319 (77.43%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRG--NINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
             LKY+SL +L+FQTT+LVL MRYSR   G   +Y++S+AV +AE +K+ TC+ ++  +N +  +   +I++ EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L ++L  +QW SL+ILM GV+FVQWP++S       +L+   Q +GL++VL+AC SSGFAGVYFEKILK +  S+W+RNIQLGLFG V G+FG+L  D   +R+ G FQGYN +TWIV+ LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY++L DF P + F +G   V++ATFLYGY  KP +
Sbjct:    5 KLKYLSLGVLVFQTTSLVLTMRYSRTLQGDGPRYLASSAVVVAEFLKILTCVGLVFKENSYSGRALSSIMRQEIIHKPVETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGRRLGVYQWLSLLILMAGVAFVQWPTDSPADPQKEHLTAGSQFVGLVAVLVACCSSGFAGVYFEKILKETKQSVWVRNIQLGLFGLVFGVFGMLAYDGDRVREHGMFQGYNTLTWIVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFLLEDFEPTSVFFLGAILVIMATFLYGYENKPPS 323          
BLAST of slc35a-1 vs. Ensembl Zebrafish
Match: slc35a3a (solute carrier family 35 member A3a [Source:ZFIN;Acc:ZDB-GENE-081105-80])

HSP 1 Score: 329.331 bits (843), Expect = 1.407e-111
Identity = 185/319 (57.99%), Postives = 247/319 (77.43%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRG--NINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
             LKY+SL +L+FQTT+LVL MRYSR   G   +Y++S+AV +AE +K+ TC+ ++  +N +  +   +I++ EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L ++L  +QW SL+ILM GV+FVQWP++S       +L+   Q +GL++VL+AC SSGFAGVYFEKILK +  S+W+RNIQLGLFG V G+FG+L  D   +R+ G FQGYN +TWIV+ LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY++L DF P + F +G   V++ATFLYGY  KP +
Sbjct:    5 KLKYLSLGVLVFQTTSLVLTMRYSRTLQGDGPRYLASSAVVVAEFLKILTCVGLVFKENSYSGRALSSIMRQEIIHKPVETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGRRLGVYQWLSLLILMAGVAFVQWPTDSPADPQKEHLTAGSQFVGLVAVLVACCSSGFAGVYFEKILKETKQSVWVRNIQLGLFGLVFGVFGMLAYDGDRVREHGMFQGYNTLTWIVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFLLEDFEPTSVFFLGAILVIMATFLYGYENKPPS 323          
BLAST of slc35a-1 vs. Ensembl Zebrafish
Match: slc35a3b (solute carrier family 35 member A3b [Source:ZFIN;Acc:ZDB-GENE-050417-460])

HSP 1 Score: 311.612 bits (797), Expect = 2.627e-104
Identity = 185/318 (58.18%), Postives = 235/318 (73.90%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPS--NSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPS 1029
             LKY SL +L+FQTT+LVL MRYSR        Y++S+AV  AE++K+  CI ++   + F  +    ++K EI+     TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L K+L  +QW SLVILM G++ VQWP+  +S  G  +L+ S Q+IGLL+VL+AC SSGFAGVYFEKILK S  S+W+RNIQLGLFG V G  GV   D   + ++G FQGYN +TW V+ LQA+GGLVIA VIKYADNILKGFATSISIILS++ SY++L DF P + F +G   V+ ATFLYG    P+
Sbjct:   30 RLKYASLGVLVFQTTSLVLTMRYSRTLHTEEPLYLASSAVVCAELLKIVACILLVFRDHSFSVRSLNLVLKEEIINRPLLTLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKRLGIYQWLSLVILMFGIALVQWPTEVSSSTGEKDLTASSQLIGLLAVLVACFSSGFAGVYFEKILKESKQSVWVRNIQLGLFGLVFGFGGVFTYDRERVLENGLFQGYNNVTWSVVALQALGGLVIAAVIKYADNILKGFATSISIILSTLISYFLLDDFDPTSVFFLGAMLVIAATFLYGCERTPA 347          
BLAST of slc35a-1 vs. Ensembl Zebrafish
Match: slc35a3b (solute carrier family 35 member A3b [Source:ZFIN;Acc:ZDB-GENE-050417-460])

HSP 1 Score: 311.612 bits (797), Expect = 3.586e-104
Identity = 185/318 (58.18%), Postives = 235/318 (73.90%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPS--NSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPS 1029
             LKY SL +L+FQTT+LVL MRYSR        Y++S+AV  AE++K+  CI ++   + F  +    ++K EI+     TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L K+L  +QW SLVILM G++ VQWP+  +S  G  +L+ S Q+IGLL+VL+AC SSGFAGVYFEKILK S  S+W+RNIQLGLFG V G  GV   D   + ++G FQGYN +TW V+ LQA+GGLVIA VIKYADNILKGFATSISIILS++ SY++L DF P + F +G   V+ ATFLYG    P+
Sbjct:   41 RLKYASLGVLVFQTTSLVLTMRYSRTLHTEEPLYLASSAVVCAELLKIVACILLVFRDHSFSVRSLNLVLKEEIINRPLLTLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKRLGIYQWLSLVILMFGIALVQWPTEVSSSTGEKDLTASSQLIGLLAVLVACFSSGFAGVYFEKILKESKQSVWVRNIQLGLFGLVFGFGGVFTYDRERVLENGLFQGYNNVTWSVVALQALGGLVIAAVIKYADNILKGFATSISIILSTLISYFLLDDFDPTSVFFLGAMLVIAATFLYGCERTPA 358          
BLAST of slc35a-1 vs. Ensembl Xenopus
Match: crabp1 (cellular retinoic acid binding protein 1 [Source:Xenbase;Acc:XB-GENE-962771])

HSP 1 Score: 320.472 bits (820), Expect = 7.638e-108
Identity = 182/317 (57.41%), Postives = 233/317 (73.50%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRG-NINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPS 1029
            +LKY+SL +L+FQTT LVL MR+SR       +Y+SSTAV  AE++K+  C+ ++   N +  +    ++  EIV    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L +KL   QW SL+ILM GV+ VQWP +S    N  +S     +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FG + GL GV + D   +   GFFQGYN +TW V+ LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PKP+
Sbjct:   11 HLKYISLGVLVFQTTTLVLTMRFSRTLKEEGPRYLSSTAVVAAEVLKIVACVLLVYKDNSYSLRSLKRVLHDEIVNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLQRKLTKHQWMSLLILMAGVALVQWPDDSSNAPNKEVSVGSGFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGWIFGLMGVYIYDGERVSNGGFFQGYNNLTWAVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFVGALLVIAATFLYGYVPKPA 327          
BLAST of slc35a-1 vs. Ensembl Xenopus
Match: mindy2 (to MINDY lysine 48 deubiquitinase 2 [Source:Xenbase;Acc:XB-GENE-990463])

HSP 1 Score: 317.39 bits (812), Expect = 9.112e-107
Identity = 183/317 (57.73%), Postives = 238/317 (75.08%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSN-SKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPS 1029
            ++KY+SL +L+ QTT+LVL MRYSR +     +Y+SSTAV  AE++K+  CI ++   N++  +    ++  EI+   +DTLKL++PS +YT+QNN+LYIALSNLDAATYQVTYQLKILTTA+F+V +L +KL   QW SL+ILM GV+ VQWP++ SK  N  L      +GL++V+ AC SSGFAGVYFEKILK +  S+W+RNIQLGLFG + GL GVL+ D   + K GFFQGYN +TWIV+ LQA+GGLV+A VIKYADNILK FA SISIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PK S
Sbjct:    4 HIKYISLGVLVLQTTSLVLTMRYSRTQQEEGPRYLSSTAVVSAEVLKIVACILLVYKDNKYNLRSLKRVLHDEIINKPKDTLKLAIPSGIYTLQNNVLYIALSNLDAATYQVTYQLKILTTALFTVSMLQRKLTKHQWVSLLILMAGVALVQWPADSSKTPNKALPTGSGFVGLVAVITACFSSGFAGVYFEKILKETKQSLWIRNIQLGLFGWLFGLMGVLIYDGQRVSKGGFFQGYNNLTWIVVALQALGGLVVATVIKYADNILKSFAASISIILSTLISYFWLKDFVPTSVFFVGALLVIAATFLYGYVPKAS 320          
BLAST of slc35a-1 vs. Ensembl Xenopus
Match: crabp1 (cellular retinoic acid binding protein 1 [Source:Xenbase;Acc:XB-GENE-962771])

HSP 1 Score: 304.679 bits (779), Expect = 2.044e-101
Identity = 182/347 (52.45%), Postives = 233/347 (67.15%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRG-NINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTF------------------------------FLIGTTFVLIATFLYGYTPKPS 1029
            +LKY+SL +L+FQTT LVL MR+SR       +Y+SSTAV  AE++K+  C+ ++   N +  +    ++  EIV    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L +KL   QW SL+ILM GV+ VQWP +S    N  +S     +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FG + GL GV + D   +   GFFQGYN +TW V+ LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P  +                              F +G   V+ ATFLYGY PKP+
Sbjct:    4 HLKYISLGVLVFQTTTLVLTMRFSRTLKEEGPRYLSSTAVVAAEVLKIVACVLLVYKDNSYSLRSLKRVLHDEIVNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLQRKLTKHQWMSLLILMAGVALVQWPDDSSNAPNKEVSVGSGFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGWIFGLMGVYIYDGERVSNGGFFQGYNNLTWAVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTRYPYFLQLYVTDMVSKGYIAYNGYLFIFFLSVFFVGALLVIAATFLYGYVPKPA 350          
BLAST of slc35a-1 vs. Ensembl Xenopus
Match: mindy2 (to MINDY lysine 48 deubiquitinase 2 [Source:Xenbase;Acc:XB-GENE-990463])

HSP 1 Score: 261.536 bits (667), Expect = 9.159e-81
Identity = 140/252 (55.56%), Postives = 186/252 (73.81%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSN-SKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIG 834
            ++KY+SL +L+ QTT+LVL MRYSR +     +Y+SSTAV  AE++K+  CI ++   N++  +    ++  EI+   +DTLKL++PS +YT+QNN+LYIALSNLDAATYQVTYQLKILTTA+F+V +L +KL   QW SL+ILM GV+ VQWP++ SK  N  L      +GL++V+ AC SSGFAGVYFEKILK +  S+W+RNIQLGLFG + GL GVL+ D   + K GFFQGYN +TWIV+ LQ  G
Sbjct:    4 HIKYISLGVLVLQTTSLVLTMRYSRTQQEEGPRYLSSTAVVSAEVLKIVACILLVYKDNKYNLRSLKRVLHDEIINKPKDTLKLAIPSGIYTLQNNVLYIALSNLDAATYQVTYQLKILTTALFTVSMLQRKLTKHQWVSLLILMAGVALVQWPADSSKTPNKALPTGSGFVGLVAVITACFSSGFAGVYFEKILKETKQSLWIRNIQLGLFGWLFGLMGVLIYDGQRVSKGGFFQGYNNLTWIVVALQPQG 255          
BLAST of slc35a-1 vs. Ensembl Xenopus
Match: mindy2 (to MINDY lysine 48 deubiquitinase 2 [Source:Xenbase;Acc:XB-GENE-990463])

HSP 1 Score: 261.536 bits (667), Expect = 1.490e-80
Identity = 140/252 (55.56%), Postives = 186/252 (73.81%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSN-SKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIG 834
            ++KY+SL +L+ QTT+LVL MRYSR +     +Y+SSTAV  AE++K+  CI ++   N++  +    ++  EI+   +DTLKL++PS +YT+QNN+LYIALSNLDAATYQVTYQLKILTTA+F+V +L +KL   QW SL+ILM GV+ VQWP++ SK  N  L      +GL++V+ AC SSGFAGVYFEKILK +  S+W+RNIQLGLFG + GL GVL+ D   + K GFFQGYN +TWIV+ LQ  G
Sbjct:    4 HIKYISLGVLVLQTTSLVLTMRYSRTQQEEGPRYLSSTAVVSAEVLKIVACILLVYKDNKYNLRSLKRVLHDEIINKPKDTLKLAIPSGIYTLQNNVLYIALSNLDAATYQVTYQLKILTTALFTVSMLQRKLTKHQWVSLLILMAGVALVQWPADSSKTPNKALPTGSGFVGLVAVITACFSSGFAGVYFEKILKETKQSLWIRNIQLGLFGWLFGLMGVLIYDGQRVSKGGFFQGYNNLTWIVVALQPQG 255          
BLAST of slc35a-1 vs. Ensembl Mouse
Match: Slc35a3 (solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3 [Source:MGI Symbol;Acc:MGI:1917648])

HSP 1 Score: 331.643 bits (849), Expect = 1.697e-112
Identity = 194/321 (60.44%), Postives = 246/321 (76.64%), Query Frame = 1
Query:   73 INMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNI-NLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            ++ NLKY+SL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE +K+  CI ++   ++   +    ++  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L KKL  +QW SLVILM GV+FVQWPS+S+  N  +LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV V D   + K+GFFQGYN +TWIV+ LQA+GGLVIA VIKYADNILKGFATS+SIILS+I SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:    1 MSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAEFLKIMACIFLVYKDSKCSVRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKKLGVYQWLSLVILMAGVAFVQWPSDSQELNSKDLSTGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNQLTWIVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTIISYFWLQDFVPTSVFFLGAILVIAATFLYGYDPKPAG 321          
BLAST of slc35a-1 vs. Ensembl Mouse
Match: Slc35a3 (solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3 [Source:MGI Symbol;Acc:MGI:1917648])

HSP 1 Score: 331.643 bits (849), Expect = 1.697e-112
Identity = 194/321 (60.44%), Postives = 246/321 (76.64%), Query Frame = 1
Query:   73 INMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNI-NLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            ++ NLKY+SL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE +K+  CI ++   ++   +    ++  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L KKL  +QW SLVILM GV+FVQWPS+S+  N  +LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV V D   + K+GFFQGYN +TWIV+ LQA+GGLVIA VIKYADNILKGFATS+SIILS+I SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:    1 MSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAEFLKIMACIFLVYKDSKCSVRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKKLGVYQWLSLVILMAGVAFVQWPSDSQELNSKDLSTGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNQLTWIVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTIISYFWLQDFVPTSVFFLGAILVIAATFLYGYDPKPAG 321          
BLAST of slc35a-1 vs. Ensembl Mouse
Match: Slc35a3 (solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3 [Source:MGI Symbol;Acc:MGI:1917648])

HSP 1 Score: 241.506 bits (615), Expect = 8.197e-79
Identity = 122/211 (57.82%), Postives = 160/211 (75.83%), Query Frame = 1
Query:   73 INMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGN-INLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQ 702
            ++ NLKY+SL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE +K+  CI ++   ++   +    ++  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L KKL  +QW SLVILM GV+FVQWPS+S+  N  +LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQ
Sbjct:    1 MSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAEFLKIMACIFLVYKDSKCSVRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKKLGVYQWLSLVILMAGVAFVQWPSDSQELNSKDLSTGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQ 211          
BLAST of slc35a-1 vs. Ensembl Mouse
Match: Slc35a2 (solute carrier family 35 (UDP-galactose transporter), member A2 [Source:MGI Symbol;Acc:MGI:1345297])

HSP 1 Score: 236.884 bits (603), Expect = 1.237e-74
Identity = 139/273 (50.92%), Postives = 189/273 (69.23%), Query Frame = 1
Query:   76 NMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFAT 894
            +  LKY+SL +L+ Q  +L+L +RY+R   G   ++ ++TAV MAE++K  TC+ ++  Q +   K     +   ++  Y DTLKL+VPS +YT+QNNL Y+A+SNL AAT+QVTYQLKILTTA+FSVL+LN+ L   QW SL++L  GV+ VQ       G   L       GL +V+ +C+SSGFAGVYFEKILKGSS S+W+RN+QLGLFG+ LGL G+   + + +   GFF GY    W V++ QA GGL++AVV+KYADNILKGFAT
Sbjct:   32 HRRLKYISLAVLVVQNASLILSIRYARTLPG--DRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGSGPRPLD-QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVASQGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFAT 301          
BLAST of slc35a-1 vs. Ensembl Mouse
Match: Slc35a2 (solute carrier family 35 (UDP-galactose transporter), member A2 [Source:MGI Symbol;Acc:MGI:1345297])

HSP 1 Score: 236.884 bits (603), Expect = 1.239e-74
Identity = 139/273 (50.92%), Postives = 189/273 (69.23%), Query Frame = 1
Query:   76 NMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFAT 894
            +  LKY+SL +L+ Q  +L+L +RY+R   G   ++ ++TAV MAE++K  TC+ ++  Q +   K     +   ++  Y DTLKL+VPS +YT+QNNL Y+A+SNL AAT+QVTYQLKILTTA+FSVL+LN+ L   QW SL++L  GV+ VQ       G   L       GL +V+ +C+SSGFAGVYFEKILKGSS S+W+RN+QLGLFG+ LGL G+   + + +   GFF GY    W V++ QA GGL++AVV+KYADNILKGFAT
Sbjct:   32 HRRLKYISLAVLVVQNASLILSIRYARTLPG--DRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGSGPRPLD-QNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVASQGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFAT 301          
BLAST of slc35a-1 vs. UniProt/SwissProt
Match: sp|Q9Y2D2|S35A3_HUMAN (UDP-N-acetylglucosamine transporter OS=Homo sapiens OX=9606 GN=SLC35A3 PE=1 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 5.276e-114
Identity = 192/317 (60.57%), Postives = 246/317 (77.60%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            NLKYVSL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE++K+  CI ++   ++   +    ++  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL  +QW SLVILM GV+FVQWPS+S+  +  LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV + D   + K+GFFQGYN +TWIV++LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:    4 NLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAG 320          
BLAST of slc35a-1 vs. UniProt/SwissProt
Match: sp|Q6YC49|S35A3_BOVIN (UDP-N-acetylglucosamine transporter OS=Bos taurus OX=9913 GN=SLC35A3 PE=2 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 7.379e-113
Identity = 194/321 (60.44%), Postives = 248/321 (77.26%), Query Frame = 1
Query:   73 INMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNI-NLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            ++ NLKY+SL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE++K+  CI ++   ++   +    I+  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL  +QW SLVILM GV+FVQWPS+S+  N   LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV V D   + K+GFFQGYN +TWIV++LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:    1 MSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRILHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQELNSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAG 321          
BLAST of slc35a-1 vs. UniProt/SwissProt
Match: sp|O77592|S35A3_CANLF (UDP-N-acetylglucosamine transporter OS=Canis lupus familiaris OX=9615 GN=SLC35A3 PE=2 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 1.166e-112
Identity = 193/321 (60.12%), Postives = 248/321 (77.26%), Query Frame = 1
Query:   73 INMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKR-GNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            ++ NLKY+SL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE++K+  CI ++   ++   +    I+  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL  +QW SLVILM GV+FVQWPS+S+   +  LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV + D   + K+GFFQGYN +TWIV+ILQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:    1 MSTNLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRILHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQELDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVILQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPTG 321          
BLAST of slc35a-1 vs. UniProt/SwissProt
Match: sp|Q6AXR5|S35A3_RAT (UDP-N-acetylglucosamine transporter OS=Rattus norvegicus OX=10116 GN=Slc35a3 PE=2 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 1.450e-112
Identity = 194/321 (60.44%), Postives = 248/321 (77.26%), Query Frame = 1
Query:   73 INMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNI-NLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            ++ NLKY+SL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE +K+  CI ++   ++   +    ++  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L KKL  +QW SLVILM GV+FVQWPS+S+  N  +LS   Q +GL++VL+AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV V D   + K+GFFQGYN +TWIV++LQA+GGLVIA VIKYADNILKGFATS+SIILS+I SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:    1 MSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAEFLKIMACIFLVYKDSKCSVRTLNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKKLGMYQWLSLVILMAGVAFVQWPSDSQELNSKDLSTGSQFVGLMAVLIACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNQLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTIISYFWLQDFVPTSVFFLGAILVIAATFLYGYDPKPAG 321          
BLAST of slc35a-1 vs. UniProt/SwissProt
Match: sp|Q8R1T4|S35A3_MOUSE (UDP-N-acetylglucosamine transporter OS=Mus musculus OX=10090 GN=Slc35a3 PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 1.187e-111
Identity = 194/321 (60.44%), Postives = 246/321 (76.64%), Query Frame = 1
Query:   73 INMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNI-NLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            ++ NLKY+SL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE +K+  CI ++   ++   +    ++  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L KKL  +QW SLVILM GV+FVQWPS+S+  N  +LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV V D   + K+GFFQGYN +TWIV+ LQA+GGLVIA VIKYADNILKGFATS+SIILS+I SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:    1 MSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAEFLKIMACIFLVYKDSKCSVRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKKLGVYQWLSLVILMAGVAFVQWPSDSQELNSKDLSTGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNQLTWIVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTIISYFWLQDFVPTSVFFLGAILVIAATFLYGYDPKPAG 321          
BLAST of slc35a-1 vs. TrEMBL
Match: A0A0H3YFJ2 (Slc35a-1 OS=Schmidtea mediterranea OX=79327 GN=slc35a-1 PE=2 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 322/322 (100.00%), Postives = 322/322 (100.00%), Query Frame = 1
Query:   79 MNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSNELPQ 1044
            MNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQLGLFGSVLGLFGVLVTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATSISIILSSIFSYYILSDFIPNTFFLIGTTFVLIATFLYGYTPKPSNELPQ
Sbjct:    1 MNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQLGLFGSVLGLFGVLVTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATSISIILSSIFSYYILSDFIPNTFFLIGTTFVLIATFLYGYTPKPSNELPQ 322          
BLAST of slc35a-1 vs. TrEMBL
Match: A0A2U4A1D3 (UDP-N-acetylglucosamine transporter isoform X2 OS=Tursiops truncatus OX=9739 GN=SLC35A3 PE=4 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 9.715e-113
Identity = 196/323 (60.68%), Postives = 250/323 (77.40%), Query Frame = 1
Query:   67 KIINMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNI-NLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            K ++ NLKY+SL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE++K+  CI ++   ++   +    I+  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL  +QW SLVILM GV+FVQWPS+S+  N   LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV V D   + K+GFFQGYNW+TWIV++LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:   11 KTMSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRILHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQELNSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNWLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAG 333          
BLAST of slc35a-1 vs. TrEMBL
Match: H2N6N6 (Solute carrier family 35 member A3 OS=Pongo abelii OX=9601 GN=SLC35A3 PE=4 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 2.572e-112
Identity = 193/322 (59.94%), Postives = 249/322 (77.33%), Query Frame = 1
Query:   67 KIINMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            K ++ NLKYVSL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE++K+  CI ++   ++   +    ++  EI+    DTLKL++PS +YT+Q+NLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL  +QW SLVILM GV+FVQWPS+S+  +  LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV + D   + K+GFFQGYN +TWIV++LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:   41 KTMSANLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMDTLKLAIPSGIYTLQHNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAG 362          
BLAST of slc35a-1 vs. TrEMBL
Match: A0A2U4A1D7 (UDP-N-acetylglucosamine transporter isoform X3 OS=Tursiops truncatus OX=9739 GN=SLC35A3 PE=4 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 3.330e-112
Identity = 195/321 (60.75%), Postives = 249/321 (77.57%), Query Frame = 1
Query:   73 INMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNI-NLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            ++ NLKY+SL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE++K+  CI ++   ++   +    I+  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL  +QW SLVILM GV+FVQWPS+S+  N   LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV V D   + K+GFFQGYNW+TWIV++LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:    1 MSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRILHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQELNSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNWLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAG 321          
BLAST of slc35a-1 vs. TrEMBL
Match: A0A2R9C031 (Uncharacterized protein OS=Pan paniscus OX=9597 PE=4 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 4.680e-112
Identity = 193/322 (59.94%), Postives = 249/322 (77.33%), Query Frame = 1
Query:   67 KIINMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            K ++ NLKYVSL +L+FQTT+LVL MRYSR       +Y+SSTAV +AE++K+  CI ++   ++   +    ++  EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL  +QW SLVILM GV+FVQWPS+S+  +  LS   Q +GL++VL AC SSGFAGVYFEKILK +  S+W+RNIQLG FGS+ GL GV + D   + K+GFFQGYN +TWIV++LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF+P + F +G   V+ ATFLYGY PKP+ 
Sbjct:   41 KTMSANLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAG 362          
BLAST of slc35a-1 vs. Ensembl Cavefish
Match: slc35a3a (UDP-N-acetylglucosamine transporter-like [Source:NCBI gene;Acc:103041649])

HSP 1 Score: 322.398 bits (825), Expect = 5.027e-109
Identity = 182/321 (56.70%), Postives = 246/321 (76.64%), Query Frame = 1
Query:   76 NMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSK-RGNINLSFSGQ-MIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            +  LKY+SL +L+FQTT+LVL MRYSR       +Y++S+AV +AE++K+ TCI ++C ++ +  +   ++++ EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L ++L  +QW SL+ILM GV+ VQWP++S          SG   +GL++VL+AC SSGFAGVYFEKILK +  S+W+RNIQLG+FG V GLFG+++ D   +R+ G FQGYN ITW V+ LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF P + F +G   V++ATFLYGY  KP++
Sbjct:    3 SARLKYLSLGVLVFQTTSLVLTMRYSRTLQSDGPRYLASSAVVVAELLKILTCIGLVCKEHSYSVRALHSVLRQEILHKPIETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGRRLGLYQWLSLLILMAGVALVQWPTDSPGTPEKEQPASGSPFVGLVAVLVACCSSGFAGVYFEKILKETKQSVWVRNIQLGMFGLVFGLFGMVLYDGERVREHGMFQGYNSITWTVVSLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFEPTSIFFLGAVLVIVATFLYGYESKPAS 323          
BLAST of slc35a-1 vs. Ensembl Cavefish
Match: slc35a3a (UDP-N-acetylglucosamine transporter-like [Source:NCBI gene;Acc:103041649])

HSP 1 Score: 322.783 bits (826), Expect = 8.081e-109
Identity = 182/321 (56.70%), Postives = 246/321 (76.64%), Query Frame = 1
Query:   76 NMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSK-RGNINLSFSGQ-MIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            +  LKY+SL +L+FQTT+LVL MRYSR       +Y++S+AV +AE++K+ TCI ++C ++ +  +   ++++ EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L ++L  +QW SL+ILM GV+ VQWP++S          SG   +GL++VL+AC SSGFAGVYFEKILK +  S+W+RNIQLG+FG V GLFG+++ D   +R+ G FQGYN ITW V+ LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY+ L DF P + F +G   V++ATFLYGY  KP++
Sbjct:   23 SARLKYLSLGVLVFQTTSLVLTMRYSRTLQSDGPRYLASSAVVVAELLKILTCIGLVCKEHSYSVRALHSVLRQEILHKPIETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGRRLGLYQWLSLLILMAGVALVQWPTDSPGTPEKEQPASGSPFVGLVAVLVACCSSGFAGVYFEKILKETKQSVWVRNIQLGMFGLVFGLFGMVLYDGERVREHGMFQGYNSITWTVVSLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFEPTSIFFLGAVLVIVATFLYGYESKPAS 343          
BLAST of slc35a-1 vs. Ensembl Cavefish
Match: slc35a3b (UDP-N-acetylglucosamine transporter [Source:NCBI gene;Acc:103042800])

HSP 1 Score: 310.842 bits (795), Expect = 4.231e-104
Identity = 180/319 (56.43%), Postives = 234/319 (73.35%), Query Frame = 1
Query:   85 LKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRG------NINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPK 1023
            LKYVSL +L+ QTT+LVL MRYSR       +Y++STAV   E+IK+  C+ ++   +    +    ++K EIV    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L K L  +QW SLVILM+GV+ VQWPS+ ++          +    Q +GLL+VL+AC SSGFAGVYFEKILK +  S+W+RNIQLGLFG V G+ G+L  D   I+++G FQGYN +T+ V++LQA+GGLVIA VIKYADNILKGFATS+SII S+  SY+ L+DF+P + F +G   V+ ATFLYGY  K
Sbjct:   25 LKYVSLGVLVLQTTSLVLTMRYSRTLQDEGPRYLASTAVVFTEVIKIIVCVILVFRDHNCSMRGLNQVLKEEIVNKPLETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLRKGLGVYQWLSLVILMMGVALVQWPSDPQKSPEEKGMEQEMPTGSQFVGLLAVLVACFSSGFAGVYFEKILKETKQSVWIRNIQLGLFGLVFGVMGMLAYDGKRIKENGIFQGYNKVTYAVVLLQALGGLVIAAVIKYADNILKGFATSLSIIFSTFISYFWLADFVPTSLFFLGAVLVITATFLYGYEGK 343          
BLAST of slc35a-1 vs. Ensembl Cavefish
Match: slc35a2 (solute carrier family 35 member A2 [Source:NCBI gene;Acc:103035724])

HSP 1 Score: 254.218 bits (648), Expect = 1.322e-81
Identity = 144/276 (52.17%), Postives = 198/276 (71.74%), Query Frame = 1
Query:   76 NMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQM---IGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFAT 894
            N  LKY+SL +L+ Q  +L+L +RY R   G   ++ +++AV MAE++K+ TC+ I+ F+ +   +D   ++   IV  Y DTLKL+VPS +YT+QNNL Y+A+SNL AAT+QVTYQLKILTTA+FSVL+L K L   QW SL++L  GV+ VQ   +S +    ++ S       GL++V+++C+SSGFAGVYFEKILKGSS S+W+RN+QLG+FG+VLGL G+   D + I + GF  GY  + W VI  QA GGL++AVV+KYADNILKGFAT
Sbjct:   26 NKKLKYISLAVLVIQNASLILSIRYVRTLPG--DRFFATSAVVMAEVLKVITCLIILLFEKKGNIRDFVALLYDSIVVQYRDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLRKSLSRVQWVSLLLLFAGVAIVQVQQDSSKQKEAITSSTNQNYAKGLVAVVVSCLSSGFAGVYFEKILKGSSASVWLRNVQLGIFGTVLGLLGMWWNDGAAIAEKGFTFGYTSMVWGVIFNQAFGGLLVAVVVKYADNILKGFAT 299          
BLAST of slc35a-1 vs. Ensembl Cavefish
Match: slc35a3b (UDP-N-acetylglucosamine transporter [Source:NCBI gene;Acc:103042800])

HSP 1 Score: 233.802 bits (595), Expect = 1.015e-74
Identity = 151/313 (48.24%), Postives = 200/313 (63.90%), Query Frame = 1
Query:   85 LKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPK 1023
            LKYVSL +L+ QTT+LVL MRYSR       +Y++STAV   E+IK+  C+ ++   +    +    ++K EIV    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQ                   K ++                 + P+ S           Q +GLL+VL+AC SSGFAGVYFEKILK +  S+W+RNIQLGLFG V G+ G+L  D   I+++G FQGYN +T+ V++LQA+GGLVIA VIKYADNILKGFATS+SII S+  SY+ L+DF+P + F +G   V+ ATFLYGY  K
Sbjct:   18 LKYVSLGVLVLQTTSLVLTMRYSRTLQDEGPRYLASTAVVFTEVIKIIVCVILVFRDHNCSMRGLNQVLKEEIVNKPLETLKLAIPSGIYTLQNNLLYVALSNLDAATYQ------------------EKGMEQ----------------EMPTGS-----------QFVGLLAVLVACFSSGFAGVYFEKILKETKQSVWIRNIQLGLFGLVFGVMGMLAYDGKRIKENGIFQGYNKVTYAVVLLQALGGLVIAAVIKYADNILKGFATSLSIIFSTFISYFWLADFVPTSLFFLGAVLVITATFLYGYEGK 285          
BLAST of slc35a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001949.1 (pep scaffold:Pmarinus_7.0:GL478223:154121:174070:1 gene:ENSPMAG00000001752.1 transcript:ENSPMAT00000001949.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 185.267 bits (469), Expect = 1.957e-56
Identity = 123/276 (44.57%), Postives = 175/276 (63.41%), Query Frame = 1
Query:   82 NLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQ----MIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGG-LVIAVVIKYADNILKGFAT 894
             LKYVSL +L+ Q  +L+L +RY R   G   K+  +TAV +AE++K+ TC+ ++  Q++    +    +   IV    DTLKL VP+ +YT+QNNL Y+A+SNL AAT+QVTYQLKILTTA+FSVL+L++ L   QW SL++L  GV+ VQ     + G    S +G     +IGL++V+++CVSSGFAGVYFEKILK S  +  +R + +    +  G  GV    +  I+    +   N   W  +I +  G  L++AVV+KYADNILKGFAT
Sbjct:    1 RLKYVSLAVLVVQNASLILSIRYVRTLPG--DKFFYTTAVVLAELLKMLTCLVLLLLQHRGNVCEWLRYLYESIVLQPADTLKLGVPAVIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLHRSLSRAQWGSLLLLFCGVAAVQ---VQQVGGGESSTAGGDQSYLIGLVAVIISCVSSGFAGVYFEKILKVSHGTASLRVMTMVCAATRWGATGVWRRQFILIKIIKIYFHKNNQIWSTVIGRGFGNILLVAVVVKYADNILKGFAT 271          
BLAST of slc35a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010664.1 (pep scaffold:Pmarinus_7.0:GL477367:216292:219753:1 gene:ENSPMAG00000009655.1 transcript:ENSPMAT00000010664.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.236 bits (417), Expect = 2.498e-50
Identity = 107/165 (64.85%), Postives = 132/165 (80.00%), Query Frame = 1
Query:  532 VQWPSNS-KRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPK 1023
            +QWPS++   G  +LS   Q++GL++VL+ACVSSGFAGVYFEKILKGS  S+W+RNIQLGLFG++ GL GV+V D  ++ + GF QGYN ITW+V+ILQA+GGLV+A VIKYADNILKGFA S SIILSS  SY  L DFIP + F +G T V++ATFLYGY PK
Sbjct:    1 LQWPSDAAPSGRQSLSVGSQVVGLVAVLIACVSSGFAGVYFEKILKGSRQSVWVRNIQLGLFGTLFGLIGVIVYDGDKVWQQGFLQGYNSITWVVVILQAVGGLVVAAVIKYADNILKGFAASFSIILSSFISYMWLQDFIPTSVFFVGATLVILATFLYGYEPK 165          
BLAST of slc35a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005236.1 (pep scaffold:Pmarinus_7.0:GL479281:30128:33541:1 gene:ENSPMAG00000004758.1 transcript:ENSPMAT00000005236.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 6.669e-15
Identity = 37/115 (32.17%), Postives = 68/115 (59.13%), Query Frame = 1
Query:   73 INMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQV 417
            +++  K   L ++     A ++ +RY+R  +G    Y ++TAV + E+ KL    +++  +     +     +  +++ N ++TLKL++PS +Y +QNN+ Y+ALSNLDAA YQV
Sbjct:    8 VSLPFKLYCLTVMTLVAAAYIVGLRYTRTTTG--DMYFATTAVCLTEVAKLIVSFAMLTRETG-SVRGMAKSVWEDVIVNRKETLKLAIPSLVYALQNNMGYVALSNLDAAVYQV 119          
BLAST of slc35a-1 vs. Ensembl Nematostella
Match: EDO34876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN25])

HSP 1 Score: 319.701 bits (818), Expect = 3.642e-108
Identity = 192/324 (59.26%), Postives = 240/324 (74.07%), Query Frame = 1
Query:   67 KIINMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPS-NSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSNE 1035
            K I + LKYV L +L+ QT+ LVL MRYSR  S     YISSTAV +AE+ K+F C+ ++  Q  + ++     I SEI     +TLKL+VPS LYTIQNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L+KKL S +W +L++LM GV+ +QWPS  +K    +LS S + +GL++VL AC SSGFAGVYFEKILKG+S +IW+RNIQLG FG V GL  V V D  +++  GFFQGYN+ITWIV+ LQA GGL++A V+KYADNILKGFATS+SII SS+ SYY L DF P + F +GT  VL AT+LYG   KP  +
Sbjct:   16 KAITIPLKYVCLGILVLQTSTLVLTMRYSRTVS-VGPVYISSTAVVLAEVFKVFACLCVMFHQAGYNWRVFATEIDSEIFKKPLETLKLAVPSGLYTIQNNLLYVALSNLDAATYQVTYQLKILTTALFSVAMLSKKLSSIKWFALILLMAGVAAIQWPSGENKSSRKDLSTSAKFVGLVAVLSACCSSGFAGVYFEKILKGTSATIWLRNIQLGSFGIVFGLAAVFVNDGKKVQNGGFFQGYNYITWIVVFLQAFGGLIVAAVVKYADNILKGFATSVSIIFSSLVSYYFLKDFNPTSLFFLGTCAVLTATYLYG---KPEAQ 335          
BLAST of slc35a-1 vs. Ensembl Nematostella
Match: EDO34874 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN21])

HSP 1 Score: 238.039 bits (606), Expect = 1.067e-76
Identity = 150/301 (49.83%), Postives = 199/301 (66.11%), Query Frame = 1
Query:  181 YISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQW------------PSNSKRGNINLSF-SGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSNELPQ 1044
            Y+SSTAV MAE+ K+ TC+ +I    Q         +   I+G   DTLKLSVP+ +YTIQNNL Y+A+SNLDAAT+QVTYQLKILTTA+FSVL+LNK L   QW SLV+L  GVS VQ             P+ +   + NL+     ++G  +V+M+ + SGFAGVYFEKILKG+S S+W+RN+QLG + +V+GL G+ + D ++I + GFFQGY+ + W VI +QA GGL++AVV+KYADNILKGFAT    I+ S      L  F  +  F++G   V  A +LY  TP P  +LPQ
Sbjct:    2 YVSSTAVIMAEVFKVATCL-VILLVMQGGVLSWLRHLYDSIIGQPIDTLKLSVPALIYTIQNNLQYVAISNLDAATFQVTYQLKILTTALFSVLMLNKSLGRLQWLSLVMLFAGVSIVQLQSSSTKSSSTSQPNATMAPSANLATKQNALLGFGAVVMSSLCSGFAGVYFEKILKGTSGSVWLRNVQLGAYSTVIGLIGMQLNDGAKIAEKGFFQGYSSLVWSVICMQAFGGLLVAVVVKYADNILKGFAT-SFSIVLSCIVSIYLFAFHASLQFVVGAALVCTAIYLYS-TP-PQQQLPQ 298          
BLAST of slc35a-1 vs. Ensembl Nematostella
Match: EDO43895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX29])

HSP 1 Score: 211.075 bits (536), Expect = 3.037e-66
Identity = 119/274 (43.43%), Postives = 178/274 (64.96%), Query Frame = 1
Query:   85 LKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIK---SEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSF-SGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFAT 894
            +KY+SL +L  Q  +L+L +RYSR   G  + YI+ST V + E++K    + ++ ++     KD    +K   S   G  +D + ++VP+ +YT+QNNL Y+A+SNLDAA +QVTYQLKIL+TA+ SVL+L K L   QW SL++L +GVS VQ   N  +   + S     ++GL +V+ +C+ SGFAGVYFEK LK +   +W RN+QL  FG+++ L GV   D + +++ GFF GY  + + ++  Q  GGL++ +V+KYADNILKGFA 
Sbjct:    1 IKYLSLAILAIQNASLILTIRYSRTIPG--ELYIASTVVAITEVVKGIVSLVVMLWEK----KDPIEWLKYVYSSTFGQTKDMMLMAVPALIYTVQNNLQYVAISNLDAAVFQVTYQLKILSTALMSVLMLKKHLSKMQWFSLMLLFVGVSIVQLQDNGNQLKTHHSIKQNSLLGLAAVVASCICSGFAGVYFEKTLKATQTPLWARNLQLAFFGAIIALLGVAYNDGAAVKQKGFFFGYGPLVYGIVFSQVFGGLLVGIVVKYADNILKGFAA 268          
BLAST of slc35a-1 vs. Ensembl Nematostella
Match: EDO43955 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX28])

HSP 1 Score: 128.257 bits (321), Expect = 1.616e-35
Identity = 86/206 (41.75%), Postives = 131/206 (63.59%), Query Frame = 1
Query:  412 QVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSK------RGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYG 1011
            Q+T QLKI+TTA+FS+LLLNK +   +W  L++LM+GV+ V+   + K      +   + +    +IG LSVL A V SGFAGV+ EKI+K  S S+W+ N+ L  +G  LG+ GV++ D  +I + GFF GY+ + W V+ L + GG+++++V+KYA  I KGFAT    I+ S  +  I+  F P+ +F++G   V+ A  LYG
Sbjct:    1 QITNQLKIMTTALFSILLLNKSISRKRWFYLLMLMIGVAVVEIELHRKIAAKMNKKEADAASKSFLIGFLSVLAASVISGFAGVFLEKIVKHKSTSLWIMNVHLYSWGVCLGVLGVVLKDGYQISQLGFFYGYDSVVWTVVALASAGGILVSLVLKYASTITKGFAT-SCAIVLSSLASVIIFGFDPSIYFILGAFLVVFAVILYG 205          
BLAST of slc35a-1 vs. Ensembl Nematostella
Match: EDO36570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIC2])

HSP 1 Score: 67.781 bits (164), Expect = 1.113e-12
Identity = 52/186 (27.96%), Postives = 89/186 (47.85%), Query Frame = 1
Query:  160 ESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLS----VPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSS--PSIWMRNI 699
            +      Y ++T V   E++KLF      CF    + +++      E + + +D +K+     +P+ LY + NNL ++ L   D  TY +  Q +++ T V    L +K+L   QW SL++L  G    Q   N+    ++L        L+ +L+    S FAGVY E +LKG S    I ++N+
Sbjct:   45 DKNNRYHYNTTTVVLFTEVVKLFAA----CF---LQLQES---TPREFLTHIKDNIKVLGLYLIPAFLYCLYNNLAFVNLGAYDPTTYYLLLQFRVVVTGVIFQCLFSKQLSRIQWVSLLLLTAGCIVKQLNFNTMSSGLSLKLD---YNLVLILVQVFCSCFAGVYNEYLLKGRSGDAPIMVQNV 217          
BLAST of slc35a-1 vs. Ensembl Medaka
Match: slc35a3b (UDP-N-acetylglucosamine transporter-like [Source:NCBI gene;Acc:101157322])

HSP 1 Score: 283.878 bits (725), Expect = 8.909e-94
Identity = 178/323 (55.11%), Postives = 247/323 (76.47%), Query Frame = 1
Query:   76 NMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNIN----LSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSN 1032
            +++LKYVSL +L+ QTT+LVL MRYSR       +Y++S+AV  AE++K+F C  ++  +N F  ++   ++K ++V    +TLKL+VP+ +YT+QNNLLY+ALSNLDAATYQVTYQLKILTTA+FSV +L ++L  FQW SL++LM GV+ VQWP++S+ GN      L+   + +G+++VLMAC+SSGFAGVYFEKILK +  S+W+RNIQLGLF  V G  G++V D   + ++G FQGYN++TW+V++LQA+GGLV+AVVIKYADNILKGFATS+SII S++ SY++L DF P   F +G   V+ ATFLYG   KP++
Sbjct:    8 SVHLKYVSLGVLVLQTTSLVLTMRYSRTLKEDGPRYLASSAVVSAEVLKMFACSVLVLMENNFSLQEMKQLMKEQVVKKPMETLKLAVPAGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGRRLSLFQWLSLLLLMAGVTLVQWPTDSE-GNAEEQKVLTAGSRFVGVMAVLMACISSGFAGVYFEKILKETKQSVWVRNIQLGLFSFVFGFVGMMVYDGRGVWQAGMFQGYNFVTWVVVVLQAVGGLVVAVVIKYADNILKGFATSLSIIASTLISYFLLEDFNPTRIFFLGALLVISATFLYGCERKPAS 329          
BLAST of slc35a-1 vs. Ensembl Medaka
Match: slc35a2 (solute carrier family 35 member A2 [Source:NCBI gene;Acc:101172226])

HSP 1 Score: 267.7 bits (683), Expect = 4.944e-87
Identity = 146/276 (52.90%), Postives = 204/276 (73.91%), Query Frame = 1
Query:   73 INMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQ--MIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFAT 894
            +N  LKY+SL +L+ Q  +L+L +RY R   G  +++ S++AV MAE++K+ TC+ II  Q +F  K+T +++ + IV  Y DTLKL++P+ +YT+QNNL YIA+SNL AAT+QVTYQLKILTTA+FSVL+L K L   QW SL++L  GV+ VQ     + GN   S + Q  M+G+++V+++C+SSGFAGVYFEKILKGSS S+W+RN+QLG+FG+ LGL G+   D + + + GF  GY  + W VI  QA GGL++A+V+KYADNILKGFAT
Sbjct:   22 VNRKLKYISLAVLVVQNASLILSIRYVRTLPG--ERFFSTSAVVMAEVLKVCTCLVIILLQKRFNLKETLHLLLNSIVFQYRDTLKLAIPALIYTLQNNLQYIAISNLPAATFQVTYQLKILTTALFSVLMLKKSLSRVQWISLLLLFAGVAIVQV---QQEGNKEASMANQNYMVGVVAVVISCLSSGFAGVYFEKILKGSSASVWIRNVQLGIFGTALGLLGLWWNDGAAVAERGFLFGYTGMVWCVIFNQAFGGLLVAMVVKYADNILKGFAT 292          
BLAST of slc35a-1 vs. Ensembl Medaka
Match: slc35a2 (solute carrier family 35 member A2 [Source:NCBI gene;Acc:101172226])

HSP 1 Score: 267.7 bits (683), Expect = 6.694e-87
Identity = 146/276 (52.90%), Postives = 204/276 (73.91%), Query Frame = 1
Query:   73 INMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQ--MIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFAT 894
            +N  LKY+SL +L+ Q  +L+L +RY R   G  +++ S++AV MAE++K+ TC+ II  Q +F  K+T +++ + IV  Y DTLKL++P+ +YT+QNNL YIA+SNL AAT+QVTYQLKILTTA+FSVL+L K L   QW SL++L  GV+ VQ     + GN   S + Q  M+G+++V+++C+SSGFAGVYFEKILKGSS S+W+RN+QLG+FG+ LGL G+   D + + + GF  GY  + W VI  QA GGL++A+V+KYADNILKGFAT
Sbjct:   22 VNRKLKYISLAVLVVQNASLILSIRYVRTLPG--ERFFSTSAVVMAEVLKVCTCLVIILLQKRFNLKETLHLLLNSIVFQYRDTLKLAIPALIYTLQNNLQYIAISNLPAATFQVTYQLKILTTALFSVLMLKKSLSRVQWISLLLLFAGVAIVQV---QQEGNKEASMANQNYMVGVVAVVISCLSSGFAGVYFEKILKGSSASVWIRNVQLGIFGTALGLLGLWWNDGAAVAERGFLFGYTGMVWCVIFNQAFGGLLVAMVVKYADNILKGFAT 292          
BLAST of slc35a-1 vs. Ensembl Medaka
Match: slc35a2 (solute carrier family 35 member A2 [Source:NCBI gene;Acc:101172226])

HSP 1 Score: 267.314 bits (682), Expect = 9.731e-87
Identity = 146/276 (52.90%), Postives = 204/276 (73.91%), Query Frame = 1
Query:   73 INMNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQ--MIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFAT 894
            +N  LKY+SL +L+ Q  +L+L +RY R   G  +++ S++AV MAE++K+ TC+ II  Q +F  K+T +++ + IV  Y DTLKL++P+ +YT+QNNL YIA+SNL AAT+QVTYQLKILTTA+FSVL+L K L   QW SL++L  GV+ VQ     + GN   S + Q  M+G+++V+++C+SSGFAGVYFEKILKGSS S+W+RN+QLG+FG+ LGL G+   D + + + GF  GY  + W VI  QA GGL++A+V+KYADNILKGFAT
Sbjct:   22 VNRKLKYISLAVLVVQNASLILSIRYVRTLPG--ERFFSTSAVVMAEVLKVCTCLVIILLQKRFNLKETLHLLLNSIVFQYRDTLKLAIPALIYTLQNNLQYIAISNLPAATFQVTYQLKILTTALFSVLMLKKSLSRVQWISLLLLFAGVAIVQV---QQEGNKEASMANQNYMVGVVAVVISCLSSGFAGVYFEKILKGSSASVWIRNVQLGIFGTALGLLGLWWNDGAAVAERGFLFGYTGMVWCVIFNQAFGGLLVAMVVKYADNILKGFAT 292          
BLAST of slc35a-1 vs. Ensembl Medaka
Match: slc35a3a (solute carrier family 35 member A3 [Source:NCBI gene;Acc:101168693])

HSP 1 Score: 245.358 bits (625), Expect = 2.315e-79
Identity = 156/324 (48.15%), Postives = 212/324 (65.43%), Query Frame = 1
Query:   79 MNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNIN--LSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGY----TPKPSN 1032
            M LKY+SL +L+FQTT+LVL MRYSR   G   +Y++S+AV +AE++K+  C+ ++  ++ +  +   +I++ EI+    +TLKL++PS +YT+QNNLLY+ALSNLDAATYQ                                         WPS+S   +     S   Q +G+ +VL+AC SSGFAGVYFEKILK S  S+W+RNIQLG+FG V GLFG+L  D   +R++G FQGY+ +TW V+ LQA+GGLVIA VIKYADNILKGFATS+SIILS++ SY++L DF P + F +G   V++ATFLYGY    +P PS 
Sbjct:    1 MFLKYLSLGVLVFQTTSLVLTMRYSRTLQGDGPRYLASSAVVVAELMKIVACVLLVFKEHSYSVRALNSILRQEILQKPVETLKLAIPSGIYTLQNNLLYVALSNLDAATYQ-----------------------------------------WPSDSAVSSEKEPASAGSQFVGVAAVLVACCSSGFAGVYFEKILKESKQSVWIRNIQLGMFGLVFGLFGMLAYDGERVREAGMFQGYSTVTWTVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFLLQDFEPTSVFFLGAILVIMATFLYGYEGKSSPNPSR 283          
BLAST of slc35a-1 vs. Planmine SMEST
Match: SMESG000022370.1 (SMESG000022370.1)

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 320/322 (99.38%), Postives = 322/322 (100.00%), Query Frame = 1
Query:   79 MNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYGYTPKPSNELPQ 1044
            MNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIIC+QNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPS+SKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQLGLFGSVLGLFGVLVTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATSISIILSSIFSYYILSDFIPNTFFLIGTTFVLIATFLYGYTPKPSNELPQ
Sbjct:    1 MNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICYQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSDSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQLGLFGSVLGLFGVLVTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATSISIILSSIFSYYILSDFIPNTFFLIGTTFVLIATFLYGYTPKPSNELPQ 322          
BLAST of slc35a-1 vs. Planmine SMEST
Match: SMESG000020105.1 (SMESG000020105.1)

HSP 1 Score: 217.624 bits (553), Expect = 2.816e-68
Identity = 134/317 (42.27%), Postives = 208/317 (65.62%), Query Frame = 1
Query:   85 LKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFK--FKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSK--RGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYG-YTP 1020
            +K +SL+LL  Q  + +L+MRY R    T++ + +S+ + + EI+KL     + C+Q+  K  + +TFN I         D++K+ VP+A+Y IQNNLLY+ALSNLD+A +QV+YQLK+LTTAVFSV +L + +   QW SL +L  GV+ VQ  S S   +G  +     ++IG+ +VL ACV SGFAG+YFEK LKGS+ S+W RN+ +   G ++   G    ++  I + GFF G++++  I+I LQ+ GGL++AVV+KYA+ +LKGFA S SI++S +FS +I   ++    FL+G + V+++  LY  ++P
Sbjct:    4 IKELSLILLTIQNASHILMMRYCRTR--TTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIG--------DSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACSASIVISILFSVFIFHTYVSG-LFLVGASMVVVSIVLYSKFSP 309          
BLAST of slc35a-1 vs. Planmine SMEST
Match: SMESG000020105.1 (SMESG000020105.1)

HSP 1 Score: 206.453 bits (524), Expect = 3.720e-64
Identity = 127/299 (42.47%), Postives = 196/299 (65.55%), Query Frame = 1
Query:  139 IMRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFK--FKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSK--RGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYG-YTP 1020
            +MRY R    T++ + +S+ + + EI+KL     + C+Q+  K  + +TFN I         D++K+ VP+A+Y IQNNLLY+ALSNLD+A +QV+YQLK+LTTAVFSV +L + +   QW SL +L  GV+ VQ  S S   +G  +     ++IG+ +VL ACV SGFAG+YFEK LKGS+ S+W RN+ +   G ++   G    ++  I + GFF G++++  I+I LQ+ GGL++AVV+KYA+ +LKGFA S SI++S +FS +I   ++    FL+G + V+++  LY  ++P
Sbjct:    1 MMRYCRTR--TTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIG--------DSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACSASIVISILFSVFIFHTYVSG-LFLVGASMVVVSIVLYSKFSP 288          
BLAST of slc35a-1 vs. Planmine SMEST
Match: SMESG000020105.1 (SMESG000020105.1)

HSP 1 Score: 206.068 bits (523), Expect = 4.829e-64
Identity = 127/298 (42.62%), Postives = 195/298 (65.44%), Query Frame = 1
Query:  142 MRYSRMESGTSKKYISSTAVFMAEIIKLFTCISIICFQNQFK--FKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVSFVQWPSNSK--RGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSPSIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGFATXXXXXXXXXXXXXXXXXXXPNTFFLIGTTFVLIATFLYG-YTP 1020
            MRY R    T++ + +S+ + + EI+KL     + C+Q+  K  + +TFN I         D++K+ VP+A+Y IQNNLLY+ALSNLD+A +QV+YQLK+LTTAVFSV +L + +   QW SL +L  GV+ VQ  S S   +G  +     ++IG+ +VL ACV SGFAG+YFEK LKGS+ S+W RN+ +   G ++   G    ++  I + GFF G++++  I+I LQ+ GGL++AVV+KYA+ +LKGFA S SI++S +FS +I   ++    FL+G + V+++  LY  ++P
Sbjct:    1 MRYCRTR--TTELFFTSSVIIVTEIVKLLISTVVFCYQSGIKKLYHETFNDIG--------DSIKVIVPAAIYVIQNNLLYVALSNLDSAVFQVSYQLKLLTTAVFSVFILKQSILKMQWLSLFLLFSGVALVQLDSASDGSKGVADGIVQNKVIGMGAVLTACVMSGFAGIYFEKTLKGSTISLWARNVLMAFIGIIISFGGQWFYEFESINEKGFFYGFDYMVCILIFLQSAGGLLVAVVVKYANQLLKGFACSASIVISILFSVFIFHTYVSG-LFLVGASMVVVSIVLYSKFSP 287          
BLAST of slc35a-1 vs. Planmine SMEST
Match: SMESG000021327.1 (SMESG000021327.1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.910e-18
Identity = 80/242 (33.06%), Postives = 125/242 (51.65%), Query Frame = 1
Query:  187 SSTAVFMAEIIKLFTCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNL-LYIALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILML-GVS-----FVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSP-SIWMRNIQXXXXXXXXXXXXXXXTDWSEIRKSGFFQGYNWITWIVIILQAIGGLVIAVVIKYADNILKGF 888
            SS+ V M EI K    +S I F  ++K K    +    ++      +  +VP  LY + NNL +YI L  +D ATYQV    KILTTA+   L++ K +   QW +L  L+L G++     F+        G+I ++ +    GL+ + + C  SG +GVY E +LK     SI ++N  L  FG +L     L   + +      F GY   TW++II QA+ G+++ V++K+A NI + F
Sbjct:   59 SSSMVLMTEITKF--VMSAIMFIPEYK-KHGLQLPPFLLI------IPFAVPGFLYCLNNNLAVYIQLE-MDPATYQVLGNFKILTTAILFRLIIKKPITKIQWIALGFLLLAGITNSYGGFINKLVVKDLGHIYITIA----GLIMIFIYCTVSGLSGVYTEYVLKNQKELSIHLQNGLLYSFGILLNGILFLYQGY-DTADYAMFTGYTVYTWLLIISQAVIGIIMGVIMKHASNITRLF 285          
The following BLAST results are available for this feature:
BLAST of slc35a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC35A31.099e-11460.57solute carrier family 35 member A3 [Source:HGNC Sy... [more]
SLC35A31.099e-11460.57solute carrier family 35 member A3 [Source:HGNC Sy... [more]
SLC35A31.099e-11460.57solute carrier family 35 member A3 [Source:HGNC Sy... [more]
SLC35A31.354e-11459.94solute carrier family 35 member A3 [Source:HGNC Sy... [more]
SLC35A32.220e-10561.62solute carrier family 35 member A3 [Source:HGNC Sy... [more]
back to top
BLAST of slc35a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nstp-42.188e-9853.87Nucleotide Sugar TransPorter family [Source:UniPr... [more]
nstp-51.439e-6539.13Nucleotide Sugar TransPorter family [Source:UniPr... [more]
nstp-35.171e-6138.08Nucleotide Sugar TransPorter family [Source:UniPr... [more]
srf-34.452e-5838.39UDP-galactose/UDP-N-acetylglucosamine transporter ... [more]
srf-31.074e-5738.19UDP-galactose/UDP-N-acetylglucosamine transporter ... [more]
back to top
BLAST of slc35a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ugalt2.884e-7745.24gene:FBgn0024994 transcript:FBtr0273276[more]
Ugalt3.113e-7745.91gene:FBgn0024994 transcript:FBtr0345710[more]
Ugalt3.113e-7745.91gene:FBgn0024994 transcript:FBtr0070501[more]
senju8.817e-1124.56gene:FBgn0031676 transcript:FBtr0079009[more]
back to top
BLAST of slc35a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35a3a1.407e-11157.99solute carrier family 35 member A3a [Source:ZFIN;A... [more]
slc35a3a1.407e-11157.99solute carrier family 35 member A3a [Source:ZFIN;A... [more]
slc35a3a1.407e-11157.99solute carrier family 35 member A3a [Source:ZFIN;A... [more]
slc35a3b2.627e-10458.18solute carrier family 35 member A3b [Source:ZFIN;A... [more]
slc35a3b3.586e-10458.18solute carrier family 35 member A3b [Source:ZFIN;A... [more]
back to top
BLAST of slc35a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crabp17.638e-10857.41cellular retinoic acid binding protein 1 [Source:X... [more]
mindy29.112e-10757.73to MINDY lysine 48 deubiquitinase 2 [Source:Xenbas... [more]
crabp12.044e-10152.45cellular retinoic acid binding protein 1 [Source:X... [more]
mindy29.159e-8155.56to MINDY lysine 48 deubiquitinase 2 [Source:Xenbas... [more]
mindy21.490e-8055.56to MINDY lysine 48 deubiquitinase 2 [Source:Xenbas... [more]
back to top
BLAST of slc35a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc35a31.697e-11260.44solute carrier family 35 (UDP-N-acetylglucosamine ... [more]
Slc35a31.697e-11260.44solute carrier family 35 (UDP-N-acetylglucosamine ... [more]
Slc35a38.197e-7957.82solute carrier family 35 (UDP-N-acetylglucosamine ... [more]
Slc35a21.237e-7450.92solute carrier family 35 (UDP-galactose transporte... [more]
Slc35a21.239e-7450.92solute carrier family 35 (UDP-galactose transporte... [more]
back to top
BLAST of slc35a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y2D2|S35A3_HUMAN5.276e-11460.57UDP-N-acetylglucosamine transporter OS=Homo sapien... [more]
sp|Q6YC49|S35A3_BOVIN7.379e-11360.44UDP-N-acetylglucosamine transporter OS=Bos taurus ... [more]
sp|O77592|S35A3_CANLF1.166e-11260.12UDP-N-acetylglucosamine transporter OS=Canis lupus... [more]
sp|Q6AXR5|S35A3_RAT1.450e-11260.44UDP-N-acetylglucosamine transporter OS=Rattus norv... [more]
sp|Q8R1T4|S35A3_MOUSE1.187e-11160.44UDP-N-acetylglucosamine transporter OS=Mus musculu... [more]
back to top
BLAST of slc35a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFJ20.000e+0100.00Slc35a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A2U4A1D39.715e-11360.68UDP-N-acetylglucosamine transporter isoform X2 OS=... [more]
H2N6N62.572e-11259.94Solute carrier family 35 member A3 OS=Pongo abelii... [more]
A0A2U4A1D73.330e-11260.75UDP-N-acetylglucosamine transporter isoform X3 OS=... [more]
A0A2R9C0314.680e-11259.94Uncharacterized protein OS=Pan paniscus OX=9597 PE... [more]
back to top
BLAST of slc35a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35a3a5.027e-10956.70UDP-N-acetylglucosamine transporter-like [Source:N... [more]
slc35a3a8.081e-10956.70UDP-N-acetylglucosamine transporter-like [Source:N... [more]
slc35a3b4.231e-10456.43UDP-N-acetylglucosamine transporter [Source:NCBI g... [more]
slc35a21.322e-8152.17solute carrier family 35 member A2 [Source:NCBI ge... [more]
slc35a3b1.015e-7448.24UDP-N-acetylglucosamine transporter [Source:NCBI g... [more]
back to top
BLAST of slc35a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001949.11.957e-5644.57pep scaffold:Pmarinus_7.0:GL478223:154121:174070:1... [more]
ENSPMAT00000010664.12.498e-5064.85pep scaffold:Pmarinus_7.0:GL477367:216292:219753:1... [more]
ENSPMAT00000005236.16.669e-1532.17pep scaffold:Pmarinus_7.0:GL479281:30128:33541:1 g... [more]
back to top
BLAST of slc35a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc35a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348763.642e-10859.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348741.067e-7649.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438953.037e-6643.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439551.616e-3541.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365701.113e-1227.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc35a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35a3b8.909e-9455.11UDP-N-acetylglucosamine transporter-like [Source:N... [more]
slc35a24.944e-8752.90solute carrier family 35 member A2 [Source:NCBI ge... [more]
slc35a26.694e-8752.90solute carrier family 35 member A2 [Source:NCBI ge... [more]
slc35a29.731e-8752.90solute carrier family 35 member A2 [Source:NCBI ge... [more]
slc35a3a2.315e-7948.15solute carrier family 35 member A3 [Source:NCBI ge... [more]
back to top
BLAST of slc35a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022370.10.000e+099.38SMESG000022370.1[more]
SMESG000020105.12.816e-6842.27SMESG000020105.1[more]
SMESG000020105.13.720e-6442.47SMESG000020105.1[more]
SMESG000020105.14.829e-6442.62SMESG000020105.1[more]
SMESG000021327.11.910e-1833.06SMESG000021327.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020026
GenBankAKN21637.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020026 ID=SMED30020026|Name=slc35a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1079bp
GGTATACTCAAGGTTACGCATATTTAAAAAAGCATAAAATGATGATTTTT
ATTTAATCATTTAATTAAGATCATAAATATGAATCTAAAATACGTCAGTT
TGGTATTGTTAATATTCCAAACGACGGCTCTGGTTTTAATCATGAGATAT
TCTCGGATGGAAAGTGGAACGTCAAAAAAATACATTTCTTCGACAGCAGT
ATTCATGGCTGAAATAATAAAATTATTCACATGCATCTCTATAATATGCT
TTCAGAATCAATTCAAATTTAAAGACACATTCAACATTATTAAATCAGAA
ATTGTTGGCAATTATGAAGACACTTTAAAATTGTCTGTGCCTTCTGCCCT
GTACACAATACAAAACAATCTATTATACATTGCACTGTCCAATCTCGATG
CTGCTACATATCAAGTGACGTACCAATTGAAAATCTTAACGACTGCAGTG
TTTTCGGTTTTACTTTTGAATAAAAAACTCAAAAGCTTCCAATGGTGCTC
TTTGGTTATTTTAATGCTTGGTGTATCTTTTGTTCAATGGCCATCTAATA
GTAAGCGAGGCAATATCAATTTATCATTCTCTGGTCAAATGATTGGTTTA
TTATCCGTTCTAATGGCATGCGTTAGCAGTGGATTTGCAGGAGTTTACTT
CGAAAAAATATTAAAAGGTAGCAGTCCAAGCATTTGGATGAGAAACATTC
AGTTAGGTCTCTTTGGATCGGTTTTAGGATTATTTGGAGTACTCGTAACT
GATTGGTCAGAAATTAGAAAATCGGGATTTTTCCAAGGATACAATTGGAT
AACTTGGATAGTCATTATTCTTCAAGCAATTGGAGGGCTAGTTATCGCTG
TGGTCATTAAGTACGCTGACAACATCCTAAAAGGATTCGCCACTAGCATA
TCCATAATTCTATCATCGATTTTCTCATATTATATACTATCAGATTTTAT
ACCAAATACATTCTTTTTAATTGGAACTACATTCGTATTGATTGCTACTT
TCCTATATGGTTATACACCAAAACCAAGCAACGAATTGCCACAATAGCTT
TTATTTTAATTCCAATAAAAAATTTCAAA
back to top

protein sequence of SMED30020026-orf-1

>SMED30020026-orf-1 ID=SMED30020026-orf-1|Name=SMED30020026-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=323bp
MNLKYVSLVLLIFQTTALVLIMRYSRMESGTSKKYISSTAVFMAEIIKLF
TCISIICFQNQFKFKDTFNIIKSEIVGNYEDTLKLSVPSALYTIQNNLLY
IALSNLDAATYQVTYQLKILTTAVFSVLLLNKKLKSFQWCSLVILMLGVS
FVQWPSNSKRGNINLSFSGQMIGLLSVLMACVSSGFAGVYFEKILKGSSP
SIWMRNIQLGLFGSVLGLFGVLVTDWSEIRKSGFFQGYNWITWIVIILQA
IGGLVIAVVIKYADNILKGFATSISIILSSIFSYYILSDFIPNTFFLIGT
TFVLIATFLYGYTPKPSNELPQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015165pyrimidine nucleotide-sugar transmembrane transporter activity
GO:0005351sugar:proton symporter activity
GO:0005462UDP-N-acetylglucosamine transmembrane transporter activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0090481pyrimidine nucleotide-sugar transmembrane transport
GO:0008643carbohydrate transport
GO:0006047UDP-N-acetylglucosamine metabolic process
GO:0006810transport
GO:0015788UDP-N-acetylglucosamine transport
GO:0015992proton transport
GO:1990569UDP-N-acetylglucosamine transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR007271Nuc_sug_transpt
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0016021integral component of membrane
GO:0005794Golgi apparatus
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007271Nucleotide-sugar transporterPFAMPF04142Nuc_sug_transpcoord: 2..311
e-value: 1.2E-126
score: 422.2
IPR007271Nucleotide-sugar transporterPIRSFPIRSF005799UDP-gal_transptcoord: 1..322
e-value: 5.4E-116
score: 384.8
IPR007271Nucleotide-sugar transporterPANTHERPTHR10231NUCLEOTIDE-SUGAR TRANSMEMBRANE TRANSPORTERcoord: 2..317
NoneNo IPR availableTIGRFAMTIGR00803TIGR00803coord: 84..310
e-value: 3.0E-68
score: 227.8
NoneNo IPR availablePANTHERPTHR10231:SF36UDP-N-ACETYLGLUCOSAMINE TRANSPORTERcoord: 2..317
NoneNo IPR availableSUPERFAMILYSSF103481Multidrug resistance efflux transporter EmrEcoord: 90..157
NoneNo IPR availableTMHMMTMhelixcoord: 137..154
NoneNo IPR availableTMHMMTMhelixcoord: 269..286
NoneNo IPR availableTMHMMTMhelixcoord: 203..225
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 240..262
NoneNo IPR availableTMHMMTMhelixcoord: 35..57
NoneNo IPR availableTMHMMTMhelixcoord: 108..130
NoneNo IPR availableTMHMMTMhelixcoord: 5..22
NoneNo IPR availableTMHMMTMhelixcoord: 169..191