Dystrobrevin beta

Overview
NameDystrobrevin beta
Smed IDSMED30020007
Length (bp)3798
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dystrobrevin beta (SMED30020007) t-SNE clustered cells

Violin plots show distribution of expression levels for Dystrobrevin beta (SMED30020007) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dystrobrevin beta (SMED30020007) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dystrobrevin beta (SMED30020007) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020007

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020007SMESG000078318.1 SmedASXL_012491SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30020007SMESG000078318.1 dd_Smed_v4_12275_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020007SMESG000078318.1 dd_Smed_v4_12275_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020007SMESG000078318.1 dd_Smed_v4_12275_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30020007SMESG000078318.1 dd_Smed_v6_12275_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dystrobrevin beta vs. Ensembl Human
Match: DTNA (dystrobrevin alpha [Source:HGNC Symbol;Acc:HGNC:3057])

HSP 1 Score: 283.878 bits (725), Expect = 2.174e-83
Identity = 130/300 (43.33%), Postives = 208/300 (69.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  V+E+ R+  L  ++ +  L+ +++E +++ ++ QL+ R+P   Q+H   + +SI +L+ +LL ++D  G G++SV A+K+AL+TL  GK MDK +Y F++++D SG ++  R++Q+L ++L L   VFEGP+F Y  Q+++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G   G+HSN H +KEYT S KS +++  +AL KS
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIH---VEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCF-SQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYT-SWKSPAKKLTNALSKS 306          

HSP 2 Score: 78.5666 bits (192), Expect = 3.008e-14
Identity = 72/174 (41.38%), Postives = 92/174 (52.87%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKS 2276
            D+EHRLIARYA+ L +  S+         S       AP I   + ++          K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L      Q  S +   +S
Sbjct:  371 DEEHRLIARYAARLAAESSS---------SQPPQQRSAPDISFTIDAN----------KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEELKQGVSYVPYCRS 510          
BLAST of Dystrobrevin beta vs. Ensembl Human
Match: DTNA (dystrobrevin alpha [Source:HGNC Symbol;Acc:HGNC:3057])

HSP 1 Score: 283.878 bits (725), Expect = 2.431e-83
Identity = 130/300 (43.33%), Postives = 208/300 (69.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  V+E+ R+  L  ++ +  L+ +++E +++ ++ QL+ R+P   Q+H   + +SI +L+ +LL ++D  G G++SV A+K+AL+TL  GK MDK +Y F++++D SG ++  R++Q+L ++L L   VFEGP+F Y  Q+++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G   G+HSN H +KEYT S KS +++  +AL KS
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIH---VEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCF-SQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYT-SWKSPAKKLTNALSKS 306          

HSP 2 Score: 78.5666 bits (192), Expect = 3.040e-14
Identity = 72/174 (41.38%), Postives = 92/174 (52.87%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKS 2276
            D+EHRLIARYA+ L +  S+         S       AP I   + ++          K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L      Q  S +   +S
Sbjct:  374 DEEHRLIARYAARLAAESSS---------SQPPQQRSAPDISFTIDAN----------KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEELKQGVSYVPYCRS 513          
BLAST of Dystrobrevin beta vs. Ensembl Human
Match: DTNA (dystrobrevin alpha [Source:HGNC Symbol;Acc:HGNC:3057])

HSP 1 Score: 278.485 bits (711), Expect = 3.578e-83
Identity = 130/300 (43.33%), Postives = 208/300 (69.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  V+E+ R+  L  ++ +  L+ +++E +++ ++ QL+ R+P   Q+H   + +SI +L+ +LL ++D  G G++SV A+K+AL+TL  GK MDK +Y F++++D SG ++  R++Q+L ++L L   VFEGP+F Y  Q+++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G   G+HSN H +KEYT S KS +++  +AL KS
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIH---VEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCF-SQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYT-SWKSPAKKLTNALSKS 306          
BLAST of Dystrobrevin beta vs. Ensembl Human
Match: DTNA (dystrobrevin alpha [Source:HGNC Symbol;Acc:HGNC:3057])

HSP 1 Score: 278.1 bits (710), Expect = 3.862e-83
Identity = 130/300 (43.33%), Postives = 208/300 (69.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  V+E+ R+  L  ++ +  L+ +++E +++ ++ QL+ R+P   Q+H   + +SI +L+ +LL ++D  G G++SV A+K+AL+TL  GK MDK +Y F++++D SG ++  R++Q+L ++L L   VFEGP+F Y  Q+++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G   G+HSN H +KEYT S KS +++  +AL KS
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIH---VEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCF-SQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYT-SWKSPAKKLTNALSKS 306          
BLAST of Dystrobrevin beta vs. Ensembl Human
Match: DTNB (dystrobrevin beta [Source:HGNC Symbol;Acc:HGNC:3058])

HSP 1 Score: 284.263 bits (726), Expect = 5.956e-83
Identity = 127/300 (42.33%), Postives = 205/300 (68.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ +  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G +I ++F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  C  E ++GFRY+CQ+CH+Y LCQ+CFW G   G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRK-IMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 78.5666 bits (192), Expect = 4.532e-14
Identity = 69/168 (41.07%), Postives = 86/168 (51.19%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSA 2258
            D+EHRLIARYA+ L +                  N   P  ++    D        + K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L      Q   A
Sbjct:  369 DEEHRLIARYAARLAAEAG---------------NVTRPPTDLSFNFD--------ANKQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKEEEQKQAAQA 498          
BLAST of Dystrobrevin beta vs. Ensembl Celegans
Match: dyb-1 (Dystrobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y048])

HSP 1 Score: 263.462 bits (672), Expect = 1.048e-75
Identity = 122/297 (41.08%), Postives = 191/297 (64.31%), Query Frame = 3
Query:  285 FKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
             ++LI+EM+ + FDSIRFA YR ACKLR+IQQ+T++ L+D+  ++E+FR+ GL  +     +  ++ E+++  ++  L+ RL A   +  ++   SI +L+ +LL +YD   TGRL+V ++KVAL+TL +GK +DK +Y F+ + D +G +   +F  +L  +L L   VFE P F ++  A       + + + +  FL+  L+DP P C++WL + HR+A++ NV H V C+ C      GFRYKCQRC +Y LCQ CFW G T+ NHSN H++KEY SS KS ++Q  H++ KS
Sbjct:   36 MQQLIDEMRLQDFDSIRFATYRAACKLRFIQQKTKVHLVDIWNMIEAFRENGLNALPLHTVIKTSRAELLLTTVFHNLNKRLVASQHVDTDV---SISLLLAFLLGAYDKQNTGRLTVFSIKVALATLCAGKLVDKLRYIFSQIADSNGLMDHIKFTDFLQQILSLTTAVFEAPTFGFSENAVNQCF-HKDEKVSLNVFLDTFLSDPCPPCIMWLPLLHRMASVSNVYHPVVCDACQVRSFTGFRYKCQRCANYQLCQSCFWRGRTSQNHSNEHEMKEY-SSYKSPTKQLVHSIHKS 327          
BLAST of Dystrobrevin beta vs. Ensembl Celegans
Match: dyb-1 (Dystrobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9Y048])

HSP 1 Score: 209.534 bits (532), Expect = 5.878e-58
Identity = 98/254 (38.58%), Postives = 156/254 (61.42%), Query Frame = 3
Query:  414 VVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            ++E+FR+ GL  +     +  ++ E+++  ++  L+ RL A   +  ++   SI +L+ +LL +YD   TGRL+V ++KVAL+TL +GK +DK +Y F+ + D +G +   +F  +L  +L L   VFE P F ++  A       + + + +  FL+  L+DP P C++WL + HR+A++ NV H V C+ C      GFRYKCQRC +Y LCQ CFW G T+ NHSN H++KEY SS KS ++Q  H++ KS
Sbjct:    1 MIEAFRENGLNALPLHTVIKTSRAELLLTTVFHNLNKRLVASQHVDTDV---SISLLLAFLLGAYDKQNTGRLTVFSIKVALATLCAGKLVDKLRYIFSQIADSNGLMDHIKFTDFLQQILSLTTAVFEAPTFGFSENAVNQCF-HKDEKVSLNVFLDTFLSDPCPPCIMWLPLLHRMASVSNVYHPVVCDACQVRSFTGFRYKCQRCANYQLCQSCFWRGRTSQNHSNEHEMKEY-SSYKSPTKQLVHSIHKS 249          
BLAST of Dystrobrevin beta vs. Ensembl Celegans
Match: dys-1 (Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW65])

HSP 1 Score: 119.783 bits (299), Expect = 8.261e-27
Identity = 89/298 (29.87%), Postives = 148/298 (49.66%), Query Frame = 3
Query:  318 QFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESF-RQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLH---PNLIPE---SIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDL-----LVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALR 1169
            QF+ ++F AYRTA KLR +Q+R  L L+D+  + ++F R  GL   E         +E M+  L       LP  + LH   PN +     ++++ + +LL  +D S  G + V++ K+A+   ++    +K++Y F L++   G     +    L+DL     LV     F G N    S  S F  V  +  I    F++ +  +P  Q ++WL + HRL   E+ +H  +C  C    IIG RY+C  C + +LCQ+CF++  T  +H   H ++EY   ++S   +R F   +R
Sbjct:  993 QFNRVKFLAYRTAMKLRALQKRLCLDLVDLTLLEKAFVRLKGLSAEECPG------LEGMVCAL-------LPMYEALHAKYPNQVQSVSLAVDICINFLLNLFDQSRDGIMRVLSFKIAMIVFSNIPLEEKYRYLFKLVSQ-DGHATQKQIALLLYDLIHIPRLVGESAAFGGTNVE-PSVRSCFETVRLAPTISEGAFIDWVKKEP--QSIVWLAVMHRLVISESTKHASKCNVCKMFPIIGIRYRCLTCFNCDLCQNCFFSQRTAKSHRTNHPMQEYCEKTTSSDDARDFAKMIR 1273          
BLAST of Dystrobrevin beta vs. Ensembl Celegans
Match: dys-1 (Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW65])

HSP 1 Score: 112.849 bits (281), Expect = 1.211e-24
Identity = 89/301 (29.57%), Postives = 149/301 (49.50%), Query Frame = 3
Query:  318 QFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESF-RQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLH---PNLIPE---SIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDL-----LVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALRKSW 1178
            QF+ ++F AYRTA KLR +Q+R  L L+D+  + ++F R  GL   E         +E M+  L       LP  + LH   PN +     ++++ + +LL  +D S  G + V++ K+A+   ++    +K++Y F L++   G     +    L+DL     LV     F G N    S  S F  V  +  I    F++ +  +P  Q ++WL + HRL   E+ +H  +C  C    IIG RY+C  C + +LCQ+CF++  T  +H   H ++EY   ++S   +R F   +R  +
Sbjct: 1931 QFNRVKFLAYRTAMKLRALQKRLCLDLVDLTLLEKAFVRLKGLSAEECP------GLEGMVCAL-------LPMYEALHAKYPNQVQSVSLAVDICINFLLNLFDQSRDGIMRVLSFKIAMIVFSNIPLEEKYRYLFKLVSQ-DGHATQKQIALLLYDLIHIPRLVGESAAFGGTNVE-PSVRSCFETVRLAPTISEGAFIDWVKKEP--QSIVWLAVMHRLVISESTKHASKCNVCKMFPIIGIRYRCLTCFNCDLCQNCFFSQRTAKSHRTNHPMQEYCEKTTSSDDARDFAKMIRNKF 2214          
BLAST of Dystrobrevin beta vs. Ensembl Celegans
Match: dys-1 (Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW65])

HSP 1 Score: 112.849 bits (281), Expect = 1.220e-24
Identity = 89/301 (29.57%), Postives = 149/301 (49.50%), Query Frame = 3
Query:  318 QFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESF-RQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLH---PNLIPE---SIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDL-----LVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALRKSW 1178
            QF+ ++F AYRTA KLR +Q+R  L L+D+  + ++F R  GL   E         +E M+  L       LP  + LH   PN +     ++++ + +LL  +D S  G + V++ K+A+   ++    +K++Y F L++   G     +    L+DL     LV     F G N    S  S F  V  +  I    F++ +  +P  Q ++WL + HRL   E+ +H  +C  C    IIG RY+C  C + +LCQ+CF++  T  +H   H ++EY   ++S   +R F   +R  +
Sbjct: 1920 QFNRVKFLAYRTAMKLRALQKRLCLDLVDLTLLEKAFVRLKGLSAEECP------GLEGMVCAL-------LPMYEALHAKYPNQVQSVSLAVDICINFLLNLFDQSRDGIMRVLSFKIAMIVFSNIPLEEKYRYLFKLVSQ-DGHATQKQIALLLYDLIHIPRLVGESAAFGGTNVE-PSVRSCFETVRLAPTISEGAFIDWVKKEP--QSIVWLAVMHRLVISESTKHASKCNVCKMFPIIGIRYRCLTCFNCDLCQNCFFSQRTAKSHRTNHPMQEYCEKTTSSDDARDFAKMIRNKF 2203          
BLAST of Dystrobrevin beta vs. Ensembl Fly
Match: Dyb (gene:FBgn0033739 transcript:FBtr0308613)

HSP 1 Score: 285.804 bits (730), Expect = 2.045e-82
Identity = 124/295 (42.03%), Postives = 193/295 (65.42%), Query Frame = 3
Query:  294 LINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1178
            ++ +++ + FDSIRFA+YRTA KLRYIQ+ T L L+D+  V+E+FR+ GL  +E    +   ++E +++ LY  L+ RLP   Q+    +     +L+ WLL +Y +  +G++ V ++KVAL+T+ SGK +DK +Y F+ ++D +G L+  +  ++L ++L L   V+E P F Y     + I    +K + + +F+  ++++PGP CL+WL + HRLA +E + H   C  CH+E   GFRY+CQRCH Y LCQ+CFW G T+ NH N H+VKEY SS KS S+Q GH+LRKS+
Sbjct:    9 ILQDLRLQTFDSIRFASYRTASKLRYIQKSTNLHLVDIWNVIEAFRENGLNTLEPQSEVSVARLETLVSSLYHNLNKRLPTAQQVP---VDSKAGLLLNWLLAAYTSDNSGKIRVFSIKVALATMCSGKLVDKLRYIFSQISDGAGQLVAWKLGEFLREVLALPAAVYESPTFHYKEGLEEEIFPAENK-VTVNDFMATLMSEPGPSCLVWLPLVHRLATVETIVHPTVCSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEY-SSYKSPSKQIGHSLRKSF 298          

HSP 2 Score: 80.8777 bits (198), Expect = 4.792e-15
Identity = 103/341 (30.21%), Postives = 155/341 (45.45%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN----TSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRT-FSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVKEL 2762
            D+EHRLIARYA+ L       S L    T I  DN+                      ++Q+ELIA+LE+KNKEI+REI RLR +Q+    A                      NP L+ ELR LR RK ELE  + +LQ+SR +LM+QLE LMR+L      S  S  NS+  S KS  M   A          G+ G +P+S+L      Q ++ H     +   +         ++   GP S     + N ++   R+ F+A+   G     P RT T+   T     + + +         + QN +L+ + +L +    AAD++T+A++ +V +L
Sbjct:  397 DEEHRLIARYAARLAQENRAPSNLPDNATPIGTDNS----------------------RAQRELIAQLESKNKEIMREIARLRRQQETEQMAPE--------------------NPALINELRALRQRKGELEGHLGALQDSRRQLMEQLEGLMRMLKNQQTASPRSTPNSSPRSGKSPPMPGGA----------GILGTSPMSAL----HAQQMQQHPMAGGVRASQQQLLQQQQQQAHGHGPFSQSQLEQLNQISSDMRSAFAAN---GSATPPPMRTTTA---TANVSAIPSLNPI-------SNQNPNLNPDAELNE----AADHLTSAISHMVSDL 664          
BLAST of Dystrobrevin beta vs. Ensembl Fly
Match: Dyb (gene:FBgn0033739 transcript:FBtr0100298)

HSP 1 Score: 283.878 bits (725), Expect = 2.692e-82
Identity = 124/295 (42.03%), Postives = 193/295 (65.42%), Query Frame = 3
Query:  294 LINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1178
            ++ +++ + FDSIRFA+YRTA KLRYIQ+ T L L+D+  V+E+FR+ GL  +E    +   ++E +++ LY  L+ RLP   Q+    +     +L+ WLL +Y +  +G++ V ++KVAL+T+ SGK +DK +Y F+ ++D +G L+  +  ++L ++L L   V+E P F Y     + I    +K + + +F+  ++++PGP CL+WL + HRLA +E + H   C  CH+E   GFRY+CQRCH Y LCQ+CFW G T+ NH N H+VKEY SS KS S+Q GH+LRKS+
Sbjct:    9 ILQDLRLQTFDSIRFASYRTASKLRYIQKSTNLHLVDIWNVIEAFRENGLNTLEPQSEVSVARLETLVSSLYHNLNKRLPTAQQVP---VDSKAGLLLNWLLAAYTSDNSGKIRVFSIKVALATMCSGKLVDKLRYIFSQISDGAGQLVAWKLGEFLREVLALPAAVYESPTFHYKEGLEEEIFPAENK-VTVNDFMATLMSEPGPSCLVWLPLVHRLATVETIVHPTVCSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEY-SSYKSPSKQIGHSLRKSF 298          

HSP 2 Score: 81.2629 bits (199), Expect = 3.488e-15
Identity = 77/206 (37.38%), Postives = 100/206 (48.54%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN----TSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSL 2360
            D+EHRLIARYA+ L       S L    T I  DN+                      ++Q+ELIA+LE+KNKEI+REI RLR +Q+    A                      NP L+ ELR LR RK ELE  + +LQ+SR +LM+QLE LMR+L      S  S  NS+  S KS  M   A          G+ G +P+S+L
Sbjct:  397 DEEHRLIARYAARLAQENRAPSNLPDNATPIGTDNS----------------------RAQRELIAQLESKNKEIMREIARLRRQQETEQMAPE--------------------NPALINELRALRQRKGELEGHLGALQDSRRQLMEQLEGLMRMLKNQQTASPRSTPNSSPRSGKSPPMPGGA----------GILGTSPMSAL 550          
BLAST of Dystrobrevin beta vs. Ensembl Fly
Match: Dyb (gene:FBgn0033739 transcript:FBtr0087929)

HSP 1 Score: 283.108 bits (723), Expect = 2.749e-82
Identity = 126/303 (41.58%), Postives = 195/303 (64.36%), Query Frame = 3
Query:  294 LINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTV 1202
            ++ +++ + FDSIRFA+YRTA KLRYIQ+ T L L+D+  V+E+FR+ GL  +E    +   ++E +++ LY  L+ RLP   Q+    +     +L+ WLL +Y +  +G++ V ++KVAL+T+ SGK +DK +Y F+ ++D +G L+  +  ++L ++L L   V+E P F Y     + I    +K + + +F+  ++++PGP CL+WL + HRLA +E + H   C  CH+E   GFRY+CQRCH Y LCQ+CFW G T+ NH N H+VKEY SS KS S+Q GH+LRKS+      TV
Sbjct:    9 ILQDLRLQTFDSIRFASYRTASKLRYIQKSTNLHLVDIWNVIEAFRENGLNTLEPQSEVSVARLETLVSSLYHNLNKRLPTAQQVP---VDSKAGLLLNWLLAAYTSDNSGKIRVFSIKVALATMCSGKLVDKLRYIFSQISDGAGQLVAWKLGEFLREVLALPAAVYESPTFHYKEGLEEEIFPAENK-VTVNDFMATLMSEPGPSCLVWLPLVHRLATVETIVHPTVCSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEY-SSYKSPSKQIGHSLRKSFRCVPEKTV 306          

HSP 2 Score: 81.2629 bits (199), Expect = 3.064e-15
Identity = 77/206 (37.38%), Postives = 100/206 (48.54%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN----TSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSL 2360
            D+EHRLIARYA+ L       S L    T I  DN+                      ++Q+ELIA+LE+KNKEI+REI RLR +Q+    A                      NP L+ ELR LR RK ELE  + +LQ+SR +LM+QLE LMR+L      S  S  NS+  S KS  M   A          G+ G +P+S+L
Sbjct:  397 DEEHRLIARYAARLAQENRAPSNLPDNATPIGTDNS----------------------RAQRELIAQLESKNKEIMREIARLRRQQETEQMAPE--------------------NPALINELRALRQRKGELEGHLGALQDSRRQLMEQLEGLMRMLKNQQTASPRSTPNSSPRSGKSPPMPGGA----------GILGTSPMSAL 550          
BLAST of Dystrobrevin beta vs. Ensembl Fly
Match: Dyb (gene:FBgn0033739 transcript:FBtr0305077)

HSP 1 Score: 283.493 bits (724), Expect = 4.720e-82
Identity = 124/295 (42.03%), Postives = 193/295 (65.42%), Query Frame = 3
Query:  294 LINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1178
            ++ +++ + FDSIRFA+YRTA KLRYIQ+ T L L+D+  V+E+FR+ GL  +E    +   ++E +++ LY  L+ RLP   Q+    +     +L+ WLL +Y +  +G++ V ++KVAL+T+ SGK +DK +Y F+ ++D +G L+  +  ++L ++L L   V+E P F Y     + I    +K + + +F+  ++++PGP CL+WL + HRLA +E + H   C  CH+E   GFRY+CQRCH Y LCQ+CFW G T+ NH N H+VKEY SS KS S+Q GH+LRKS+
Sbjct:   18 ILQDLRLQTFDSIRFASYRTASKLRYIQKSTNLHLVDIWNVIEAFRENGLNTLEPQSEVSVARLETLVSSLYHNLNKRLPTAQQVP---VDSKAGLLLNWLLAAYTSDNSGKIRVFSIKVALATMCSGKLVDKLRYIFSQISDGAGQLVAWKLGEFLREVLALPAAVYESPTFHYKEGLEEEIFPAENK-VTVNDFMATLMSEPGPSCLVWLPLVHRLATVETIVHPTVCSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEY-SSYKSPSKQIGHSLRKSF 307          

HSP 2 Score: 81.2629 bits (199), Expect = 3.195e-15
Identity = 77/206 (37.38%), Postives = 100/206 (48.54%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN----TSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSL 2360
            D+EHRLIARYA+ L       S L    T I  DN+                      ++Q+ELIA+LE+KNKEI+REI RLR +Q+    A                      NP L+ ELR LR RK ELE  + +LQ+SR +LM+QLE LMR+L      S  S  NS+  S KS  M   A          G+ G +P+S+L
Sbjct:  406 DEEHRLIARYAARLAQENRAPSNLPDNATPIGTDNS----------------------RAQRELIAQLESKNKEIMREIARLRRQQETEQMAPE--------------------NPALINELRALRQRKGELEGHLGALQDSRRQLMEQLEGLMRMLKNQQTASPRSTPNSSPRSGKSPPMPGGA----------GILGTSPMSAL 559          
BLAST of Dystrobrevin beta vs. Ensembl Fly
Match: Dyb (gene:FBgn0033739 transcript:FBtr0087930)

HSP 1 Score: 282.722 bits (722), Expect = 5.155e-82
Identity = 126/303 (41.58%), Postives = 195/303 (64.36%), Query Frame = 3
Query:  294 LINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTV 1202
            ++ +++ + FDSIRFA+YRTA KLRYIQ+ T L L+D+  V+E+FR+ GL  +E    +   ++E +++ LY  L+ RLP   Q+    +     +L+ WLL +Y +  +G++ V ++KVAL+T+ SGK +DK +Y F+ ++D +G L+  +  ++L ++L L   V+E P F Y     + I    +K + + +F+  ++++PGP CL+WL + HRLA +E + H   C  CH+E   GFRY+CQRCH Y LCQ+CFW G T+ NH N H+VKEY SS KS S+Q GH+LRKS+      TV
Sbjct:   18 ILQDLRLQTFDSIRFASYRTASKLRYIQKSTNLHLVDIWNVIEAFRENGLNTLEPQSEVSVARLETLVSSLYHNLNKRLPTAQQVP---VDSKAGLLLNWLLAAYTSDNSGKIRVFSIKVALATMCSGKLVDKLRYIFSQISDGAGQLVAWKLGEFLREVLALPAAVYESPTFHYKEGLEEEIFPAENK-VTVNDFMATLMSEPGPSCLVWLPLVHRLATVETIVHPTVCSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEY-SSYKSPSKQIGHSLRKSFRCVPEKTV 315          

HSP 2 Score: 81.2629 bits (199), Expect = 2.963e-15
Identity = 77/206 (37.38%), Postives = 100/206 (48.54%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN----TSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSL 2360
            D+EHRLIARYA+ L       S L    T I  DN+                      ++Q+ELIA+LE+KNKEI+REI RLR +Q+    A                      NP L+ ELR LR RK ELE  + +LQ+SR +LM+QLE LMR+L      S  S  NS+  S KS  M   A          G+ G +P+S+L
Sbjct:  406 DEEHRLIARYAARLAQENRAPSNLPDNATPIGTDNS----------------------RAQRELIAQLESKNKEIMREIARLRRQQETEQMAPE--------------------NPALINELRALRQRKGELEGHLGALQDSRRQLMEQLEGLMRMLKNQQTASPRSTPNSSPRSGKSPPMPGGA----------GILGTSPMSAL 559          
BLAST of Dystrobrevin beta vs. Ensembl Zebrafish
Match: dtnbb (dystrobrevin, beta b [Source:ZFIN;Acc:ZDB-GENE-070117-3])

HSP 1 Score: 283.878 bits (725), Expect = 5.541e-83
Identity = 125/300 (41.67%), Postives = 203/300 (67.67%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            M   ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+DV  ++E+FR  GL  ++ +  ++ +++E +++ ++ QL+ RLP   Q++   + +SI +L+ +++ +YD+ G G+L+V A+K  L+T+  GK +DK +Y F+ ++D +G ++  +F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ ++ADP PQCL+WL + HRLAN+ENV H V C  C  E ++GFRY+CQ+CH Y LCQ CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MVEKRQLFMEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDVWNMIEAFRDNGLSTLDHNAEINVSRLETILSSIFYQLNKRLPTTHQIN---VEQSIGLLLNFIVATYDSEGHGKLTVFAMKAMLATMCGGKILDKLRYVFSQISDSNGVMVFAKFDQFLREVLKLPTAVFEGPSFGYTEHSVR-TCFPQQKKILLNTFLDVLMADPPPQCLVWLPLMHRLANVENVFHPVECSYCRSESMMGFRYRCQQCHGYQLCQSCFWRGHASGPHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 83.5741 bits (205), Expect = 7.809e-16
Identity = 83/202 (41.09%), Postives = 110/202 (54.46%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDL-FNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +  S              ++T  P       SDL FN +   + K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LRHRKDELE RM++LQESR ELM QLE LMR+L   + +  +S+   + S +M     + +A +  T + Q  L GV
Sbjct:  343 DEEHRLIARYAARLAAEAS--------------NSTQCPP------SDLSFNFD---ANKQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRHRKDELERRMSALQESRRELMVQLEGLMRLLKAQTGTSPHSSPSHSASCTMPMPIRSTSAGSTPTHTPQDCLAGV 506          
BLAST of Dystrobrevin beta vs. Ensembl Zebrafish
Match: dtnbb (dystrobrevin, beta b [Source:ZFIN;Acc:ZDB-GENE-070117-3])

HSP 1 Score: 283.878 bits (725), Expect = 5.707e-83
Identity = 125/300 (41.67%), Postives = 203/300 (67.67%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            M   ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+DV  ++E+FR  GL  ++ +  ++ +++E +++ ++ QL+ RLP   Q++   + +SI +L+ +++ +YD+ G G+L+V A+K  L+T+  GK +DK +Y F+ ++D +G ++  +F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ ++ADP PQCL+WL + HRLAN+ENV H V C  C  E ++GFRY+CQ+CH Y LCQ CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MVEKRQLFMEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDVWNMIEAFRDNGLSTLDHNAEINVSRLETILSSIFYQLNKRLPTTHQIN---VEQSIGLLLNFIVATYDSEGHGKLTVFAMKAMLATMCGGKILDKLRYVFSQISDSNGVMVFAKFDQFLREVLKLPTAVFEGPSFGYTEHSVR-TCFPQQKKILLNTFLDVLMADPPPQCLVWLPLMHRLANVENVFHPVECSYCRSESMMGFRYRCQQCHGYQLCQSCFWRGHASGPHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 83.1889 bits (204), Expect = 8.665e-16
Identity = 83/202 (41.09%), Postives = 110/202 (54.46%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDL-FNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +  S              ++T  P       SDL FN +   + K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LRHRKDELE RM++LQESR ELM QLE LMR+L   + +  +S+   + S +M     + +A +  T + Q  L GV
Sbjct:  343 DEEHRLIARYAARLAAEAS--------------NSTQCPP------SDLSFNFD---ANKQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRHRKDELERRMSALQESRRELMVQLEGLMRLLKAQTGTSPHSSPSHSASCTMPMPIRSTSAGSTPTHTPQDCLAGV 506          
BLAST of Dystrobrevin beta vs. Ensembl Zebrafish
Match: dtna (dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-070117-2])

HSP 1 Score: 285.419 bits (729), Expect = 4.820e-82
Identity = 127/300 (42.33%), Postives = 201/300 (67.00%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A   DSIR + YRTACKLR+IQ+R  L L+D+  ++E FR+  L  +E +     + ++ +++ ++ QL+ RLP   Q++   + +SI  L+ +LL +YD  G G++S   +K+AL+TL  GK +DK +Y F+ ++DP+G +I ++F+Q+L ++L + V VFEGP+F Y  Q+++     + K + +  FL+  ++DP PQCL+WL + HRLAN+ENV H V C  CH + ++GFRY+CQ+C +Y LCQ+CFW G  +G+HSN H +KEY  S KS +++   AL KS
Sbjct:   12 MADRRQLFAEMRALDLDSIRLSTYRTACKLRFIQKRCNLHLVDIWNIIEVFRENRLNSVELNTEFSVSHLQAILSTIFQQLNKRLPTTHQIN---VDQSISYLLNFLLTAYDQEGVGKISAFVMKMALATLCGGKILDKLRYIFSQISDPNGLMIYSQFDQFLREVLKVPVSVFEGPSFGYTEQSTRSCF-PQEKKVTLNVFLDTFMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHSQSMMGFRYRCQQCDNYQLCQECFWRGHASGSHSNQHQMKEYM-SWKSPAKKLSDALSKS 306          

HSP 2 Score: 74.3294 bits (181), Expect = 7.237e-13
Identity = 68/158 (43.04%), Postives = 80/158 (50.63%), Query Frame = 3
Query: 1752 HDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL 2225
             DDEH LIARYAS L +      G      S+  D                      S K Q++LIA+LE KNKEIL+EIQRLR +   +  A     DK               NP LL ELR LR RK+ELE RM++LQESR ELM QLE LM +L
Sbjct:  424 QDDEHCLIARYASRLAADEVAAKGRVPTDISLCLD----------------------SNKQQRQLIAELENKNKEILQEIQRLRQQ---HEEASQPPLDKNQ------------QNPMLLAELRLLRQRKEELEQRMSALQESRRELMVQLEQLMLLL 544          
BLAST of Dystrobrevin beta vs. Ensembl Zebrafish
Match: dtna (dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-070117-2])

HSP 1 Score: 285.419 bits (729), Expect = 6.140e-82
Identity = 127/300 (42.33%), Postives = 201/300 (67.00%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A   DSIR + YRTACKLR+IQ+R  L L+D+  ++E FR+  L  +E +     + ++ +++ ++ QL+ RLP   Q++   + +SI  L+ +LL +YD  G G++S   +K+AL+TL  GK +DK +Y F+ ++DP+G +I ++F+Q+L ++L + V VFEGP+F Y  Q+++     + K + +  FL+  ++DP PQCL+WL + HRLAN+ENV H V C  CH + ++GFRY+CQ+C +Y LCQ+CFW G  +G+HSN H +KEY  S KS +++   AL KS
Sbjct:   12 MADRRQLFAEMRALDLDSIRLSTYRTACKLRFIQKRCNLHLVDIWNIIEVFRENRLNSVELNTEFSVSHLQAILSTIFQQLNKRLPTTHQIN---VDQSISYLLNFLLTAYDQEGVGKISAFVMKMALATLCGGKILDKLRYIFSQISDPNGLMIYSQFDQFLREVLKVPVSVFEGPSFGYTEQSTRSCF-PQEKKVTLNVFLDTFMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHSQSMMGFRYRCQQCDNYQLCQECFWRGHASGSHSNQHQMKEYM-SWKSPAKKLSDALSKS 306          

HSP 2 Score: 72.7886 bits (177), Expect = 2.134e-12
Identity = 70/158 (44.30%), Postives = 84/158 (53.16%), Query Frame = 3
Query: 1752 HDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL 2225
             DDEH LIARYAS L +         +P        TD   I + L S+          K Q++LIA+LE KNKEIL+EIQRLR +   +  A     DK               NP LL ELR LR RK+ELE RM++LQESR ELM QLE LM +L
Sbjct:  427 QDDEHCLIARYASRLAADEVAAQKGRVP--------TD---ISLCLDSN----------KQQRQLIAELENKNKEILQEIQRLRQQ---HEEASQPPLDKNQ------------QNPMLLAELRLLRQRKEELEQRMSALQESRRELMVQLEQLMLLL 548          
BLAST of Dystrobrevin beta vs. Ensembl Zebrafish
Match: dtna (dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-070117-2])

HSP 1 Score: 285.419 bits (729), Expect = 6.140e-82
Identity = 127/300 (42.33%), Postives = 201/300 (67.00%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A   DSIR + YRTACKLR+IQ+R  L L+D+  ++E FR+  L  +E +     + ++ +++ ++ QL+ RLP   Q++   + +SI  L+ +LL +YD  G G++S   +K+AL+TL  GK +DK +Y F+ ++DP+G +I ++F+Q+L ++L + V VFEGP+F Y  Q+++     + K + +  FL+  ++DP PQCL+WL + HRLAN+ENV H V C  CH + ++GFRY+CQ+C +Y LCQ+CFW G  +G+HSN H +KEY  S KS +++   AL KS
Sbjct:   12 MADRRQLFAEMRALDLDSIRLSTYRTACKLRFIQKRCNLHLVDIWNIIEVFRENRLNSVELNTEFSVSHLQAILSTIFQQLNKRLPTTHQIN---VDQSISYLLNFLLTAYDQEGVGKISAFVMKMALATLCGGKILDKLRYIFSQISDPNGLMIYSQFDQFLREVLKVPVSVFEGPSFGYTEQSTRSCF-PQEKKVTLNVFLDTFMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHSQSMMGFRYRCQQCDNYQLCQECFWRGHASGSHSNQHQMKEYM-SWKSPAKKLSDALSKS 306          

HSP 2 Score: 72.7886 bits (177), Expect = 2.134e-12
Identity = 70/158 (44.30%), Postives = 84/158 (53.16%), Query Frame = 3
Query: 1752 HDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL 2225
             DDEH LIARYAS L +         +P        TD   I + L S+          K Q++LIA+LE KNKEIL+EIQRLR +   +  A     DK               NP LL ELR LR RK+ELE RM++LQESR ELM QLE LM +L
Sbjct:  427 QDDEHCLIARYASRLAADEVAAQKGRVP--------TD---ISLCLDSN----------KQQRQLIAELENKNKEILQEIQRLRQQ---HEEASQPPLDKNQ------------QNPMLLAELRLLRQRKEELEQRMSALQESRRELMVQLEQLMLLL 548          
BLAST of Dystrobrevin beta vs. Ensembl Xenopus
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:779813])

HSP 1 Score: 291.197 bits (744), Expect = 2.003e-84
Identity = 125/300 (41.67%), Postives = 208/300 (69.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  ++E+ R+  L  ++ +  L+  ++E +++ ++ QL+ R+P   Q++   + +SI +++ +LL +YD+ G G+++V A+K+AL+TL  GK MDK +Y +++++D +G ++  R++Q+L ++L L   +FEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++   AL KS
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNIIEALRENSLNNVDPNVELNVARLEAVLSTVFFQLNKRMPTTHQIN---VEQSISLMLNFLLTAYDSEGHGKITVFAVKMALATLCGGKIMDKLRYIYSMISDTNGMMVYGRYDQFLREVLKLPTAIFEGPSFGYTEQAARSCF-SQQKKVTLNSFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLSTALSKS 306          

HSP 2 Score: 81.6481 bits (200), Expect = 5.397e-15
Identity = 80/201 (39.80%), Postives = 105/201 (52.24%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +  S+ +  D+  T       DA                    K Q++LIA+LE KN+EIL+EIQRLR+E   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L T  +    S+   T SR +     + +A +  T + Q  LTGV
Sbjct:  421 DEEHRLIARYAARLAAENSS-AVTDISFT------IDA-------------------NKQQRQLIAELENKNREILQEIQRLRIE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGV 580          
BLAST of Dystrobrevin beta vs. Ensembl Xenopus
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:779813])

HSP 1 Score: 291.967 bits (746), Expect = 2.036e-84
Identity = 125/300 (41.67%), Postives = 208/300 (69.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  ++E+ R+  L  ++ +  L+  ++E +++ ++ QL+ R+P   Q++   + +SI +++ +LL +YD+ G G+++V A+K+AL+TL  GK MDK +Y +++++D +G ++  R++Q+L ++L L   +FEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++   AL KS
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNIIEALRENSLNNVDPNVELNVARLEAVLSTVFFQLNKRMPTTHQIN---VEQSISLMLNFLLTAYDSEGHGKITVFAVKMALATLCGGKIMDKLRYIYSMISDTNGMMVYGRYDQFLREVLKLPTAIFEGPSFGYTEQAARSCF-SQQKKVTLNSFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLSTALSKS 306          

HSP 2 Score: 83.1889 bits (204), Expect = 1.560e-15
Identity = 81/206 (39.32%), Postives = 105/206 (50.97%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRST-----HSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +  S+       G D+  T       DA                    K Q++LIA+LE KN+EIL+EIQRLR+E   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L T  +    S+   T SR +     + +A +  T + Q  LTGV
Sbjct:  374 DEEHRLIARYAARLAAENSSAQAQQRGGADISFT------IDA-------------------NKQQRQLIAELENKNREILQEIQRLRIE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGV 539          
BLAST of Dystrobrevin beta vs. Ensembl Xenopus
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:779813])

HSP 1 Score: 291.967 bits (746), Expect = 2.482e-84
Identity = 125/300 (41.67%), Postives = 208/300 (69.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  ++E+ R+  L  ++ +  L+  ++E +++ ++ QL+ R+P   Q++   + +SI +++ +LL +YD+ G G+++V A+K+AL+TL  GK MDK +Y +++++D +G ++  R++Q+L ++L L   +FEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++   AL KS
Sbjct:   18 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNIIEALRENSLNNVDPNVELNVARLEAVLSTVFFQLNKRMPTTHQIN---VEQSISLMLNFLLTAYDSEGHGKITVFAVKMALATLCGGKIMDKLRYIYSMISDTNGMMVYGRYDQFLREVLKLPTAIFEGPSFGYTEQAARSCF-SQQKKVTLNSFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLSTALSKS 312          

HSP 2 Score: 76.6406 bits (187), Expect = 1.858e-13
Identity = 81/213 (38.03%), Postives = 105/213 (49.30%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRST-----HSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL-------NTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +  S+       G D+  T       DA                    K Q++LIA+LE KN+EIL+EIQRLR+E   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L        T  +    S+   T SR +     + +A +  T + Q  LTGV
Sbjct:  377 DEEHRLIARYAARLAAENSSAQAQQRGGADISFT------IDA-------------------NKQQRQLIAELENKNREILQEIQRLRIE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEQELRQETQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGV 549          
BLAST of Dystrobrevin beta vs. Ensembl Xenopus
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:779813])

HSP 1 Score: 291.967 bits (746), Expect = 3.397e-84
Identity = 125/300 (41.67%), Postives = 208/300 (69.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  ++E+ R+  L  ++ +  L+  ++E +++ ++ QL+ R+P   Q++   + +SI +++ +LL +YD+ G G+++V A+K+AL+TL  GK MDK +Y +++++D +G ++  R++Q+L ++L L   +FEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++   AL KS
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNIIEALRENSLNNVDPNVELNVARLEAVLSTVFFQLNKRMPTTHQIN---VEQSISLMLNFLLTAYDSEGHGKITVFAVKMALATLCGGKIMDKLRYIYSMISDTNGMMVYGRYDQFLREVLKLPTAIFEGPSFGYTEQAARSCF-SQQKKVTLNSFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLSTALSKS 306          

HSP 2 Score: 83.5741 bits (205), Expect = 1.454e-15
Identity = 81/206 (39.32%), Postives = 105/206 (50.97%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRST-----HSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +  S+       G D+  T       DA                    K Q++LIA+LE KN+EIL+EIQRLR+E   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L T  +    S+   T SR +     + +A +  T + Q  LTGV
Sbjct:  428 DEEHRLIARYAARLAAENSSAQAQQRGGADISFT------IDA-------------------NKQQRQLIAELENKNREILQEIQRLRIE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGV 593          
BLAST of Dystrobrevin beta vs. Ensembl Xenopus
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:779813])

HSP 1 Score: 292.352 bits (747), Expect = 5.062e-84
Identity = 125/300 (41.67%), Postives = 208/300 (69.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  ++E+ R+  L  ++ +  L+  ++E +++ ++ QL+ R+P   Q++   + +SI +++ +LL +YD+ G G+++V A+K+AL+TL  GK MDK +Y +++++D +G ++  R++Q+L ++L L   +FEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++   AL KS
Sbjct:   18 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNIIEALRENSLNNVDPNVELNVARLEAVLSTVFFQLNKRMPTTHQIN---VEQSISLMLNFLLTAYDSEGHGKITVFAVKMALATLCGGKIMDKLRYIYSMISDTNGMMVYGRYDQFLREVLKLPTAIFEGPSFGYTEQAARSCF-SQQKKVTLNSFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLSTALSKS 312          

HSP 2 Score: 83.5741 bits (205), Expect = 1.569e-15
Identity = 81/206 (39.32%), Postives = 105/206 (50.97%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRST-----HSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +  S+       G D+  T       DA                    K Q++LIA+LE KN+EIL+EIQRLR+E   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L T  +    S+   T SR +     + +A +  T + Q  LTGV
Sbjct:  434 DEEHRLIARYAARLAAENSSAQAQQRGGADISFT------IDA-------------------NKQQRQLIAELENKNREILQEIQRLRIE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGV 599          
BLAST of Dystrobrevin beta vs. Ensembl Mouse
Match: Dtnb (dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203728])

HSP 1 Score: 285.804 bits (730), Expect = 1.210e-83
Identity = 128/300 (42.67%), Postives = 204/300 (68.00%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ S  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVR-TCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 78.5666 bits (192), Expect = 2.750e-14
Identity = 81/208 (38.94%), Postives = 105/208 (50.48%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKS-------RSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L      Q   A  S  +       R M     + +A +  T   Q  L+GV
Sbjct:  369 DEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEEQKQAAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGV 538          
BLAST of Dystrobrevin beta vs. Ensembl Mouse
Match: Dtnb (dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203728])

HSP 1 Score: 285.804 bits (730), Expect = 1.241e-83
Identity = 128/300 (42.67%), Postives = 204/300 (68.00%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ S  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVR-TCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 81.2629 bits (199), Expect = 3.527e-15
Identity = 78/201 (38.81%), Postives = 106/201 (52.74%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++   +++      R M     + +A +  T   Q  L+GV
Sbjct:  369 DEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGV 531          
BLAST of Dystrobrevin beta vs. Ensembl Mouse
Match: Dtnb (dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203728])

HSP 1 Score: 286.189 bits (731), Expect = 2.689e-83
Identity = 128/300 (42.67%), Postives = 204/300 (68.00%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ S  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVR-TCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 83.9593 bits (206), Expect = 6.397e-16
Identity = 105/336 (31.25%), Postives = 136/336 (40.48%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVKEL 2762
            D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L               K     QAA         +G    +P               HG G PM                        P P  +T    + T    + L G     +  F  G R                               +LR +LL+AAD++TN M+ LVKEL
Sbjct:  399 DEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLL---------------KEEEQKQAAQA-------TGSPHTSP--------------THGGGRPM------------------------PMPVRSTSAGSTPTHGPQDSLSGVGGDVQEAFAQGTRR------------------------------NLRNDLLVAADSITNTMSSLVKEL 606          
BLAST of Dystrobrevin beta vs. Ensembl Mouse
Match: Dtnb (dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203728])

HSP 1 Score: 285.804 bits (730), Expect = 2.916e-83
Identity = 128/300 (42.67%), Postives = 204/300 (68.00%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ S  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVR-TCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 78.5666 bits (192), Expect = 3.126e-14
Identity = 81/208 (38.94%), Postives = 105/208 (50.48%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKS-------RSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L      Q   A  S  +       R M     + +A +  T   Q  L+GV
Sbjct:  399 DEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEEQKQAAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGV 568          
BLAST of Dystrobrevin beta vs. Ensembl Mouse
Match: Dtnb (dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203728])

HSP 1 Score: 286.189 bits (731), Expect = 3.011e-83
Identity = 128/300 (42.67%), Postives = 204/300 (68.00%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ S  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVRTCF-PQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 80.8777 bits (198), Expect = 5.763e-15
Identity = 78/201 (38.81%), Postives = 106/201 (52.74%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++   +++      R M     + +A +  T   Q  L+GV
Sbjct:  399 DEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGV 561          
BLAST of Dystrobrevin beta vs. UniProt/SwissProt
Match: sp|O60941|DTNB_HUMAN (Dystrobrevin beta OS=Homo sapiens OX=9606 GN=DTNB PE=1 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 8.170e-82
Identity = 127/300 (42.33%), Postives = 205/300 (68.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ +  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G +I ++F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  C  E ++GFRY+CQ+CH+Y LCQ+CFW G   G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRK-IMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 83.9593 bits (206), Expect = 4.536e-15
Identity = 104/336 (30.95%), Postives = 134/336 (39.88%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVKEL 2762
            D+EHRLIARYA+ L +       +  P T +S +               F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L               K     QAA         +G    +P               HG G PM                        P P  +T    + T    + L G     +  F  G R                               +LR +LL+AAD++TN M+ LVKEL
Sbjct:  399 DEEHRLIARYAARLAAEAG---NVTRPPTDLSFN---------------FDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLL---------------KEEEQKQAAQA-------TGSPHTSP--------------THGGGRPM------------------------PMPVRSTSAGSTPTHCPQDSLSGVGGDVQEAFAQGTRR------------------------------NLRNDLLVAADSITNTMSSLVKEL 606          
BLAST of Dystrobrevin beta vs. UniProt/SwissProt
Match: sp|O70585|DTNB_MOUSE (Dystrobrevin beta OS=Mus musculus OX=10090 GN=Dtnb PE=1 SV=3)

HSP 1 Score: 285.804 bits (730), Expect = 9.463e-82
Identity = 128/300 (42.67%), Postives = 204/300 (68.00%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ S  +  +++E +I+ +Y QL+ RLP+  Q+    + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS---VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVR-TCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 81.2629 bits (199), Expect = 3.796e-14
Identity = 78/201 (38.81%), Postives = 106/201 (52.74%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++   +++      R M     + +A +  T   Q  L+GV
Sbjct:  399 DEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGV 561          
BLAST of Dystrobrevin beta vs. UniProt/SwissProt
Match: sp|Q9Y4J8|DTNA_HUMAN (Dystrobrevin alpha OS=Homo sapiens OX=9606 GN=DTNA PE=1 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 3.021e-81
Identity = 130/300 (43.33%), Postives = 208/300 (69.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  V+E+ R+  L  ++ +  L+ +++E +++ ++ QL+ R+P   Q+H   + +SI +L+ +LL ++D  G G++SV A+K+AL+TL  GK MDK +Y F++++D SG ++  R++Q+L ++L L   VFEGP+F Y  Q+++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G   G+HSN H +KEYT S KS +++  +AL KS
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIH---VEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCF-SQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYT-SWKSPAKKLTNALSKS 306          

HSP 2 Score: 87.4261 bits (215), Expect = 5.190e-16
Identity = 81/201 (40.30%), Postives = 106/201 (52.74%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +  S+         S       AP I   + ++          K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L T  +    S+   T SR +     + +A +  T + Q  LTGV
Sbjct:  431 DEEHRLIARYAARLAAESSS---------SQPPQQRSAPDISFTIDAN----------KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGV 597          
BLAST of Dystrobrevin beta vs. UniProt/SwissProt
Match: sp|Q9D2N4|DTNA_MOUSE (Dystrobrevin alpha OS=Mus musculus OX=10090 GN=Dtna PE=1 SV=2)

HSP 1 Score: 286.189 bits (731), Expect = 4.650e-81
Identity = 130/300 (43.33%), Postives = 207/300 (69.00%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  D IR + YRTACKLR++Q++  L L+D+  V+E+ R+  L  ++ +  L+  ++E +++ ++ QL+ R+P   Q+H   + +SI +L+ +LL ++D  G G++SV A+K+AL+TL  GK MDK +Y F++++D SG ++  R++Q+L ++L L   VFEGP+F Y  Q+++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G   G+HSN H +KEYT S KS +++  +AL KS
Sbjct:   12 MAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPNIELNVARLEAVLSTIFYQLNKRMPTTHQIH---VEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCF-SQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYT-SWKSPAKKLTNALSKS 306          

HSP 2 Score: 81.6481 bits (200), Expect = 3.088e-14
Identity = 81/208 (38.94%), Postives = 106/208 (50.96%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL-------NTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +  S+         S       AP I   + ++          K Q++LIA+LE KN+EIL+EIQRLR+E   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L        T  +S   S+   T SR +     + +A    T + Q  LTGV
Sbjct:  428 DEEHRLIARYAARLAAESSS---------SQPTQQRSAPDISFTIDAN----------KQQRQLIAELENKNREILQEIQRLRVE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEELKQGTQGASSPRSSPSHTISRPIPMPIRSASACPTPTHTPQDSLTGV 601          
BLAST of Dystrobrevin beta vs. UniProt/SwissProt
Match: sp|P84060|DTNB_RAT (Dystrobrevin beta OS=Rattus norvegicus OX=10116 GN=Dtnb PE=1 SV=2)

HSP 1 Score: 283.493 bits (724), Expect = 4.999e-81
Identity = 127/300 (42.33%), Postives = 203/300 (67.67%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+D+  ++E+FR  GL  ++ +  +  +++E +I+ +Y QL+ RLP+  Q++   + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D +G ++  + +Q+L + L L   VFEGP+F Y   A +     + K I++  FL+ M+ADP PQCL+WL + HRLA++ENV H V C  CH E ++GFRY+CQ+CH+Y LCQ+CFW G   G HSN H +KE  SS KS +++  HA+ KS
Sbjct:   12 MAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHATEISVSRLETVISSIYYQLNKRLPSTHQIN---VEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVR-TCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEL-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 83.5741 bits (205), Expect = 5.828e-15
Identity = 79/201 (39.30%), Postives = 107/201 (53.23%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +             ++++  TDA        S  F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++   +++      RSM     + +A +  T   Q  L+GV
Sbjct:  399 DEEHRLIARYAARLAAEAG----------NMTRPPTDA--------SFNFDAN-----KQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKAQATGSPHTSPTHGGGRSMPMPVRSTSAGSTPTHGPQDSLSGV 561          
BLAST of Dystrobrevin beta vs. TrEMBL
Match: A0A4S2LEN9 (ZZ-type domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009439 PE=4 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 1.831e-119
Identity = 188/311 (60.45%), Postives = 235/311 (75.56%), Query Frame = 3
Query:  282 GFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLY-LMESSCNLDRTQIEMMIAQLYTQLSNRLPAGD-----------QLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1178
            GFKRL+ EMK +QFD+IRFAAYRTA KLRYIQQRT    M++  VVE+FR+ GL+ L + + +LD      ++A++Y+QLS   P  D              PN++  + E+L+ +L+Y+ D   T RL+V +LK+ALSTL + KP DKF+YHFTLL+DPSGALI  +FE YL DLL L + VFEGPNF Y  QA++ +L GRSK I+IE+FLE+MLADPGPQ L+WLTIFHRLA +EN+RHNVRCEGC RE + G RYKC RC HYNLCQDCFWTGVTT  H+N HDVKEY+S+SKSHSRQFGH+LRKS+
Sbjct:   85 GFKRLLAEMKLRQFDTIRFAAYRTASKLRYIQQRTLFRFMELGRVVETFREFGLHQLNDPNASLDYAGTARILARIYSQLS--CPTTDVQTKSCSRTTPSFDPNVLRAASEILLSFLIYALDVCATARLTVNSLKIALSTLTNAKPSDKFRYHFTLLSDPSGALIQGKFETYLQDLLRLPISVFEGPNFFYTPQAAQAMLSGRSKNILIEDFLERMLADPGPQLLVWLTIFHRLAAVENIRHNVRCEGCKREPLFGLRYKCTRCQHYNLCQDCFWTGVTTEPHTNAHDVKEYSSASKSHSRQFGHSLRKSF 393          
BLAST of Dystrobrevin beta vs. TrEMBL
Match: A0A3R7EUH4 (Dystrobrevin beta OS=Clonorchis sinensis OX=79923 GN=DTNB PE=4 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 5.861e-119
Identity = 187/311 (60.13%), Postives = 235/311 (75.56%), Query Frame = 3
Query:  282 GFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLY-LMESSCNLDRTQIEMMIAQLYTQLSNRLPAGD-----------QLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1178
            GFKRL+ EMK +QFD+IRFAAYRTA KLRYIQQRT    M++  VVE+FR+ GL+ L + + +LD      ++A++Y+QLS   P  D              PN++  + E+L+ +L+Y+ D   T RL+V +LK+ALSTL + KP +KF+YHFTLL+DPSGALI  +FE YL DLL L + VFEGPNF Y  QA++ +L GRSK I+IE+FLE+MLADPGPQ L+WLTIFHRLA +EN+RHNVRCEGC RE + G RYKC RC HYNLCQDCFWTGVTT  H+N HDVKEY+S+SKSHSRQFGH+LRKS+
Sbjct:   85 GFKRLLAEMKLRQFDTIRFAAYRTASKLRYIQQRTLFRFMELGRVVETFREFGLHQLNDPNASLDYAGTARILARIYSQLSG--PTTDVQTKSGSKTTPSFDPNVLRAASEILLSFLIYALDVCATARLTVNSLKIALSTLTNAKPSEKFRYHFTLLSDPSGALIQGKFETYLQDLLRLPISVFEGPNFFYTPQAAQAMLSGRSKNILIEDFLERMLADPGPQLLVWLTIFHRLAAVENIRHNVRCEGCKREPLFGLRYKCTRCQHYNLCQDCFWTGVTTEPHTNAHDVKEYSSASKSHSRQFGHSLRKSF 393          
BLAST of Dystrobrevin beta vs. TrEMBL
Match: A0A0X3NGC7 (Dystrobrevin-1 OS=Schistocephalus solidus OX=70667 GN=DTN1 PE=4 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 4.789e-117
Identity = 186/320 (58.13%), Postives = 233/320 (72.81%), Query Frame = 3
Query:  261 TQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGD--------------QLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1178
            ++    AGF+RL+ E+KAK+FD IRFAAYRTA KLRYIQ+RT L  +D+  VVE+FR  GL+L + S  L+R   E ++ ++Y  L    P  D               L   ++ ++ E+L+GWL Y  D +  GRL+V  LKVALSTLASGKP DKF+YHFTLLT+P+G L   R E YL +LL LAVGVFE PNF+YNSQ SKFI+ GRSK+I++EEFLE+MLA+PGPQ   WL +FHR+  +ENVRH V+CEGC RE IIG RYKC RC  YNLCQDCFWTG+TT  H+N+HDVKEYT+S+K HSRQFGH+LRKS+
Sbjct:  101 SENAAFAGFRRLLAELKAKKFDQIRFAAYRTASKLRYIQKRTLLGSLDIWRVVETFRDVGLHLADPSVTLNRQGTEQLLWRIYANLP---PPTDSPVVCDATGQRQILPLQSPMLTQAAEILLGWLTYILDPTNCGRLAVSGLKVALSTLASGKPADKFRYHFTLLTNPAGVLQIPRLETYLQELLSLAVGVFEEPNFSYNSQTSKFIISGRSKSILVEEFLERMLAEPGPQTFSWLKVFHRMVIVENVRHQVKCEGCKREPIIGLRYKCTRCPRYNLCQDCFWTGITTDAHTNSHDVKEYTTSTKQHSRQFGHSLRKSF 417          
BLAST of Dystrobrevin beta vs. TrEMBL
Match: A0A0X3NXD5 (Dystrobrevin-1 OS=Schistocephalus solidus OX=70667 GN=DTN1 PE=4 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 2.550e-116
Identity = 186/320 (58.13%), Postives = 233/320 (72.81%), Query Frame = 3
Query:  261 TQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQ--------------LHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1178
            ++    AGF+RL+ E+KAK+FD IRFAAYRTA KLRYIQ+RT L  +D+  VVE+FR  GL+L + S  L+R   E ++ ++Y  L    P  D               L   ++ ++ E+L+GWL Y  D +  GRL+V  LKVALSTLASGKP DKF+YHFTLLT+P+G L   R E YL +LL LAVGVFE PNF+YNSQ SKFI+ GRSK+I++EEFLE+MLA+PGPQ   WL +FHR+  +ENVRH V+CEGC RE IIG RYKC RC  YNLCQDCFWTG+TT  H+N+HDVKEYT+S+K HSRQFGH+LRKS+
Sbjct:  101 SENAAFAGFRRLLAELKAKKFDQIRFAAYRTASKLRYIQKRTLLGSLDIWRVVETFRDVGLHLADPSVTLNRQGTEQLLWRIYANLP---PPTDSPVVCDATGQRQILPLQSPMLTQAAEILLGWLTYILDPTNCGRLAVSGLKVALSTLASGKPADKFRYHFTLLTNPAGVLQIPRLETYLQELLSLAVGVFEEPNFSYNSQTSKFIISGRSKSILVEEFLERMLAEPGPQTFSWLKVFHRMVIVENVRHQVKCEGCKREPIIGLRYKCTRCPRYNLCQDCFWTGITTDAHTNSHDVKEYTTSTKQHSRQFGHSLRKSF 417          
BLAST of Dystrobrevin beta vs. TrEMBL
Match: A0A4E0RH39 (Dystrobrevin beta OS=Fasciola hepatica OX=6192 GN=D915_003256 PE=4 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 7.863e-115
Identity = 185/305 (60.66%), Postives = 232/305 (76.07%), Query Frame = 3
Query:  282 GFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLY-LMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPE-----SIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSW 1178
            GFKRL+ EM+A+QFDSIRFAAYRTA KLRYIQQRT   ++D+  VV++FR  GL+ + E++  LD      ++A++Y+ L+  +       P  +       ++E+L+GWL Y+ D   TGRL+V  LK+ALS L + KP +KF+YHFTLL+DPSGALIP +FE YL DLL L V VFEGPNF Y  QA++ +L GRSK I+IEEFL++MLADPG Q L+WLTIFHRLA++ENVRH+VRCE C RE I+G RYKC RC HYNLCQDCFWTG TT  H+N HDVKEY+SSSKSHSRQFGH+LRKS+
Sbjct:  114 GFKRLLTEMRARQFDSIRFAAYRTASKLRYIQQRTMFGMVDLWRVVDTFRDFGLHQITENNATLDYASTGRLLARIYSHLNGAVEPNSGKPPRTLDVTAVHLAVELLLGWLAYALDICSTGRLTVTGLKIALSVLTNAKPAEKFRYHFTLLSDPSGALIPAKFEAYLQDLLKLPVSVFEGPNFFYTPQAAQSLLSGRSKNILIEEFLDRMLADPGSQLLVWLTIFHRLASVENVRHSVRCEVCKREPILGLRYKCTRCPHYNLCQDCFWTGATTDQHTNAHDVKEYSSSSKSHSRQFGHSLRKSF 418          

HSP 2 Score: 63.929 bits (154), Expect = 2.918e-6
Identity = 41/88 (46.59%), Postives = 56/88 (63.64%), Query Frame = 3
Query: 2097 NPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN-TSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSS 2357
            NP L+ EL+ LR RKDELE RM++LQ +R ELM QLE+L+R+L+ T    QTN A    + ++ +   + +S  S  SGL   TP SS
Sbjct:  855 NPKLVTELQALRQRKDELETRMSNLQRNRTELMLQLETLVRLLSVTGGPIQTNQA----RPQTTDAVESVLSDLS-PSGLLPSTPSSS 937          
BLAST of Dystrobrevin beta vs. Ensembl Cavefish
Match: dtnbb (dystrobrevin, beta b [Source:ZFIN;Acc:ZDB-GENE-070117-3])

HSP 1 Score: 282.337 bits (721), Expect = 2.324e-82
Identity = 124/296 (41.89%), Postives = 202/296 (68.24%), Query Frame = 3
Query:  288 KRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            ++L  EM+A+ FD IR + YRTACKLR++Q+R  L L+DV  ++E+FR  GL  ++ +  ++ +++E +++ ++ QL+ RLP   Q++   + +SI +L+ +++ +YD+ G G+L+V ++K  L+T+  GK +DK +Y F+ ++D  G ++  +F+Q+L ++L L   VFEGP+F Y   + +     + K I++  FL+ M+ADP PQCL+WL + HRLAN+ENV H V C  C  E ++GFRY+CQ+CH Y LCQ+CFW G  +G HSN H +KE+ SS KS +++  HA+ KS
Sbjct:   16 RQLFMEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDVWNMIEAFRDNGLSTLDHNAEINVSRLETILSSIFYQLNKRLPTTHQIN---VEQSIGLLLNFMVATYDSEGHGKLTVFSMKSMLATMCGGKIVDKLRYIFSQISDSGGTMVFAKFDQFLREVLKLPTAVFEGPSFGYTEHSVR-TCFPQQKKILLNTFLDVMMADPPPQCLVWLPLMHRLANVENVFHPVECSYCRSESMMGFRYRCQQCHGYQLCQNCFWRGHASGPHSNQHQMKEH-SSWKSPAKKLSHAISKS 306          

HSP 2 Score: 84.3445 bits (207), Expect = 3.645e-16
Identity = 79/201 (39.30%), Postives = 106/201 (52.74%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +  S              ++T  P  ++    D        + K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LRHRKDELE RM++LQESR ELM QLE LMR+L   +    +S+   + S +M     + +A +  T + Q  L GV
Sbjct:  344 DEEHRLIARYAARLAAEAS--------------NSTQCPPTDLSFNFD--------ANKQQRQLIAELENKNREILQEIQRLRLE---HEQASQPTPEKAQ------------QNPTLLAELRLLRHRKDELEKRMSALQESRRELMVQLEGLMRLLKAQTGGSPHSSPSHSASCTMPMPIRSTSAGSTPTHTPQDCLAGV 507          
BLAST of Dystrobrevin beta vs. Ensembl Cavefish
Match: dtna (dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-070117-2])

HSP 1 Score: 276.559 bits (706), Expect = 5.962e-81
Identity = 128/300 (42.67%), Postives = 203/300 (67.67%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A + DSIR + YR ACKLR++Q+R  L L+D+  V+E+FR+ GL  M+ +      ++E +++ ++ QL+ R+P   Q++   + +SI +L+ +LL +YD  G G++SV  +K+AL+TL  GK +DK +Y F+ + DP G ++ ++F+Q+L ++L L   VFEGP+F+Y    +K I   + K + +  FL+  ++DP  QCL+WL + HRLAN+ENV H V C  C  + ++GFRY+CQ+CH+Y LCQ+CFW G  +G+HSN H +KEYT S KS +++  +AL KS
Sbjct:   10 MADKRQLFAEMRALELDSIRLSTYRAACKLRFVQKRCNLHLVDIWNVIEAFRENGLNTMDLNTEFTVARLEAILSTIFHQLNKRMPTTHQIN---VEQSILLLLNFLLAAYDPDGQGKVSVFVVKMALATLCGGKILDKLRYIFSQIADPDGIMVYSQFDQFLKEVLKLPGVVFEGPSFSYTEHTAK-ICFSQHKQVTLNIFLDAFMSDPPAQCLVWLPLMHRLANVENVFHPVECSYCQSQSMMGFRYRCQQCHNYQLCQECFWRGNASGSHSNQHQMKEYT-SWKSPAKKLSNALSKS 304          

HSP 2 Score: 65.855 bits (159), Expect = 1.602e-10
Identity = 60/144 (41.67%), Postives = 81/144 (56.25%), Query Frame = 3
Query: 1929 KSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL------NTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGV 2342
            K Q+ LIA+LE KN+EIL EIQRLR +   +  A   +TDK               NP LL EL+ LR RK+ELE RM++LQESR ELM QLE LM +L      ++  SS  ++A  S  +  +  + +T  + S Q  L G+
Sbjct:  346 KQQRLLIAELENKNREILLEIQRLRQQ---HVEASQPSTDKEQ------------QNPTLLAELKQLRQRKEELEQRMSALQESRRELMVQLEQLMLLLKNPGAGSSPRSSPGHTASSSVPTPVLLTSCSTTPSHSPQDSLMGL 474          
BLAST of Dystrobrevin beta vs. Ensembl Cavefish
Match: dtnba (dystrobrevin, beta a [Source:ZFIN;Acc:ZDB-GENE-030131-3967])

HSP 1 Score: 276.559 bits (706), Expect = 1.622e-80
Identity = 123/300 (41.00%), Postives = 205/300 (68.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  +++  EM+ + FD+IR + YRTACKLR++Q++ +L L+DV  ++E+FR  GL  ++ +  L  +++E +++ +Y QL+ RLP   Q++   + +SI +L+ +LL ++++ G GRL+V ++K+ L+ + SGK +DK +Y F+ ++D +GA+  +RF+ +L + L L   VFEGP+F Y   +++     + K +++  FL+ ++ D  PQCL+WL + HR+AN+ENV H V C  C  E ++GFRY+CQ+C  Y LCQ+CFW G  +GNHSN H +KE+ SS KS +++FG A+ KS
Sbjct:   12 MAEKRQIFMEMRTQNFDTIRLSTYRTACKLRFVQKKCKLHLVDVWNMIEAFRDNGLNTLDHNTELSVSRLETIVSSIYFQLNKRLPTTHQIN---VQQSISLLLNFLLAAHESEGQGRLTVFSVKMMLAIMCSGKIVDKLRYIFSQISDSNGAMTVSRFDHFLRECLKLPSAVFEGPSFGYTEHSAQSCF-PQQKKVMLNMFLDTIMDDSPPQCLVWLPLMHRIANVENVVHPVSCSYCRSESMVGFRYRCQQCFSYQLCQNCFWRGHASGNHSNQHQMKEH-SSWKSPAKKFGRAISKS 306          

HSP 2 Score: 78.9518 bits (193), Expect = 1.452e-14
Identity = 72/196 (36.73%), Postives = 99/196 (50.51%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGV 2342
            D+EHRLIARY S L +                 + ++AP++        F+ N     K Q++LIA+LE KN+EIL+EIQRLRLE   +  A     +K               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM++L   ++    ++     SR +     +  T    +G   +
Sbjct:  372 DEEHRLIARYTSRLAT-----------------EPSNAPQLN-------FDVN-----KQQRQLIAELEHKNREILQEIQRLRLE---HEQACQPTPEKAQ------------QNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKAQAAGSPQTSPGHRSSRPIPMPVRSTGTTPTHTGYPPI 523          
BLAST of Dystrobrevin beta vs. Ensembl Cavefish
Match: dtna (dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-070117-2])

HSP 1 Score: 276.944 bits (707), Expect = 1.513e-79
Identity = 128/300 (42.67%), Postives = 203/300 (67.67%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A + DSIR + YR ACKLR++Q+R  L L+D+  V+E+FR+ GL  M+ +      ++E +++ ++ QL+ R+P   Q++   + +SI +L+ +LL +YD  G G++SV  +K+AL+TL  GK +DK +Y F+ + DP G ++ ++F+Q+L ++L L   VFEGP+F+Y    +K I   + K + +  FL+  ++DP  QCL+WL + HRLAN+ENV H V C  C  + ++GFRY+CQ+CH+Y LCQ+CFW G  +G+HSN H +KEYT S KS +++  +AL KS
Sbjct:   10 MADKRQLFAEMRALELDSIRLSTYRAACKLRFVQKRCNLHLVDIWNVIEAFRENGLNTMDLNTEFTVARLEAILSTIFHQLNKRMPTTHQIN---VEQSILLLLNFLLAAYDPDGQGKVSVFVVKMALATLCGGKILDKLRYIFSQIADPDGIMVYSQFDQFLKEVLKLPGVVFEGPSFSYTEHTAK-ICFSQHKQVTLNIFLDAFMSDPPAQCLVWLPLMHRLANVENVFHPVECSYCQSQSMMGFRYRCQQCHNYQLCQECFWRGNASGSHSNQHQMKEYT-SWKSPAKKLSNALSKS 304          

HSP 2 Score: 75.0998 bits (183), Expect = 3.184e-13
Identity = 74/202 (36.63%), Postives = 99/202 (49.01%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVL------NTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGV 2342
            DDEH LIARYAS L +  ++         S+  D                        K Q+ LIA+LE KN+EIL EIQRLR +   +  A   +TDK               NP LL EL+ LR RK+ELE RM++LQESR ELM QLE LM +L      ++  SS  ++A  S  +  +  + +T  + S Q  L G+
Sbjct:  425 DDEHYLIARYASRLAADEASAKSRAPEAMSLPLDTN----------------------KQQRLLIAELENKNREILLEIQRLRQQ---HVEASQPSTDKEQ------------QNPTLLAELKQLRQRKEELEQRMSALQESRRELMVQLEQLMLLLKNPGAGSSPRSSPGHTASSSVPTPVLLTSCSTTPSHSPQDSLMGL 589          
BLAST of Dystrobrevin beta vs. Ensembl Cavefish
Match: drp2 (dystrophin related protein 2 [Source:NCBI gene;Acc:103025899])

HSP 1 Score: 138.658 bits (348), Expect = 9.089e-33
Identity = 105/356 (29.49%), Postives = 170/356 (47.75%), Query Frame = 3
Query:  321 FDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFR----QTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLA-----VGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQ---ASPCLPYRNTVSRIQ 1346
             ++I+F+AYRTA KLR +Q+  RL L+ +  V + FR    Q G Y+M+         +E++ A   T L  RL     +  N IP  ++M + WLL  YD+   G++ V++ K  + +L +    +K++Y F  +  P+G          LH+++ +      V  F G N    S  S F +     AI +  FLE M  +P  Q ++WL + HR+   E+ +H  RC  C +  I GFRY+  +  + ++CQ CF TG TT      + + EY   ++S    R F   L+  +              SK Y     Q R     Q +++  +G+   +SP LP+ +T SRI+
Sbjct:  317 LNNIKFSAYRTAMKLRRVQKALRLDLLKLTSVTDVFREQELQHGEYVMDV--------VEVIHA--LTALYERLEEERSVLIN-IPLCVDMCLNWLLNVYDSGRNGKMRVLSFKTGVVSLCNADVQEKYRYLFRQVCGPNGLTDQKHLSLLLHEVIQIPRQLGEVAAFGGSNVE-PSVRSCFRMAPGKPAIEVSHFLEWMSLEP--QSVVWLPVLHRVTAAESAKHQARCYICKQCPIKGFRYRSLKQFNVDICQMCFLTGRTTKGKRLHYPIMEYYTPTTSGEKMRDFAKTLKNKF-------------RSKQYFSKHPQ-RGYLPVQTVLEAESGETPCSSPRLPHADTHSRIE 644          
BLAST of Dystrobrevin beta vs. Ensembl Sea Lamprey
Match: dtnba (dystrobrevin, beta a [Source:ZFIN;Acc:ZDB-GENE-030131-3967])

HSP 1 Score: 304.294 bits (778), Expect = 2.931e-90
Identity = 131/300 (43.67%), Postives = 205/300 (68.33%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+ FD+IR + YRTACKLR++Q++  L L+D+  ++E+FR+ GL  +++   +   ++E +IA +Y QL+ RLP   Q+H   + +SI +L+ ++L +Y+  G G+++V  +KVAL+T+  GK +DK +Y F+ ++D +G ++  +F+QYLH++L L   VFEGP+F Y  QA++     + K + +  FL+ +++DP PQ L+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH Y LCQDCFW G  +  HSN H +KEYT S KS +++   AL KS
Sbjct:   12 MADRRQLFLEMRAQNFDAIRLSTYRTACKLRFVQKKCNLHLVDIWNMIEAFRENGLNALDAGAEVSVARLENLIASVYYQLNKRLPTTHQIH---VEQSINLLLNFMLAAYNGEGCGKMTVFGVKVALATMCGGKVVDKLRYIFSQISDSNGVMVLNKFDQYLHEVLKLPTAVFEGPSFGYTEQAARSCFPHQQKKVTLNVFLDALMSDPPPQILIWLPLMHRLANVENVFHPVECSFCHSESMLGFRYRCQQCHSYQLCQDCFWRGQASSTHSNQHQMKEYT-SWKSPAKKLTRALSKS 307          

HSP 2 Score: 83.9593 bits (206), Expect = 1.061e-16
Identity = 73/208 (35.10%), Postives = 102/208 (49.04%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRST--HSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQ-TNSALYSTKSRSMNQ---------AANTISTFSRQSGLTGV 2342
            D+EHRLIARYA+ L +  ST  H+    P              E+   SD        + K Q++LIA+LE KN+  + +  +    + + AS  +   D+               NP LL EL+ LR RKDELE RM++LQESR ELM QLE LM++L      Q T S+  S+ S +M +         +A +  T + Q  LTGV
Sbjct:  425 DEEHRLIARYAARLAAEASTTVHTVHRTP-------------TELAFNSD--------TNKQQRQLIAELENKNR-EIMQEIQRLRLEHEQASQTSPEKDQ--------------QNPTLLAELKLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEEQKQATQSSPRSSPSHTMARPMPMPIRSTSAGSTPTHTPQDSLTGV 596          
BLAST of Dystrobrevin beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002801.1 (pep scaffold:Pmarinus_7.0:GL476499:231780:258689:1 gene:ENSPMAG00000002555.1 transcript:ENSPMAT00000002801.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 2.039e-33
Identity = 83/282 (29.43%), Postives = 142/282 (50.35%), Query Frame = 3
Query:  321 FDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLI--PESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLA-----VGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHS 1145
             +++RF+AYRTA KLR +Q+   L L+ +  +   F Q+GL   ++   +D ++    +  +Y  L  +       H +L+  P  ++M + WLL  YDT   G++  ++ K  L +L++    DK+++ F  +   SG     R    LHD + +      V  F G N   + ++      GR + I    FLE M  +P  Q ++WL + HR+A  E  +H  +C  C    I+GFRY+  +  +Y++CQ CF++G T   H  ++ + EY +   SHS
Sbjct:   30 LNNVRFSAYRTAMKLRRLQKALCLDLVSLDALTNVFEQSGL--KQNDRLMDVSEAVGCLTTIYQGLERK-------HSDLVNLPLCVDMCLNWLLNVYDTGRGGKIRELSFKTGLVSLSNAHLEDKYRFLFKQVASVSGLCDQRRLGLMLHDAVQIPRQLGEVASFGGSNIEPSVRSCFQFANGRPE-IEATMFLEWMRMEP--QSMVWLPVLHRVAASETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLSYPMVEYCTPVSSHS 299          
BLAST of Dystrobrevin beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004878.1 (pep scaffold:Pmarinus_7.0:GL480232:9823:26212:1 gene:ENSPMAG00000004410.1 transcript:ENSPMAT00000004878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 8.725e-27
Identity = 86/290 (29.66%), Postives = 132/290 (45.52%), Query Frame = 3
Query:  321 FDSIRFAAYRTACKLRYIQQ---RTR-----------LILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFK-YHFTLLTDPSGALIPTR-FEQYLHDLLVLA-----VGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTS 1127
             +S+RF+AYRTA KLR +Q+   RTR           L   D + +    R  G            T++  ++A+LY  L +    G        P   +M + WLL  YD S TG++  ++LKV L  L+     +K+K Y F  ++ P G     R     L + + +      V  F G N    S  S F        + +  FLE M  +P  Q L+WL + HR+A  E  +H  +C  C    I+GFRY+  +  +Y++CQ CF++G T   H   + + EY +
Sbjct:   28 LNSVRFSAYRTAMKLRRLQKALCRTRHQPEMSTIPMGLDCHDEQSMSPHERLVGA-----------TEVGRLLAELYGGLES----GQGQRLVAAPLCTDMALNWLLNVYDPSRTGKIRSLSLKVGLICLSKAPLEEKYKLYIFRQVSGPGGGGCDQRQLGLLLQEAIQIPRQLGEVASFGGSNIE-PSVRSCFKFANSRDMVEVGRFLEWMKLEP--QSLVWLPVLHRVAASETAKHQAKCNICKECPIVGFRYRSLKHFNYDICQSCFFSGRTAKGHKLHYPMVEYCT 299          
BLAST of Dystrobrevin beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010595.1 (pep scaffold:Pmarinus_7.0:GL477281:35182:38646:-1 gene:ENSPMAG00000009594.1 transcript:ENSPMAT00000010595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 3.714e-19
Identity = 79/292 (27.05%), Postives = 135/292 (46.23%), Query Frame = 3
Query:  291 RLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPE-SIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFK-----YHFTLLTDPSGAL-IPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRS-----KAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSS 1130
             L+  +  +Q + IR+A YRTA KL  +Q+   L L+ V  ++  F  +    ++    L+  Q+  ++ +++   S   P      P++  E + E+ +  LL   D+  +G++S  ++  AL  L++G+   K++       F  +     A+ IP     Y   LL L   + EG  F     A   +    S      +I   +FL   L++P  Q  LWL   +R+       H  +C  C    I+G R++C RC + +LCQ+CF TG  TG H+ +H V E  +S
Sbjct:    3 ELLRLVLTEQLNVIRYAVYRTAAKLLALQKLCCLHLVSVSTILTVFNSSA---VDWESELNVRQVYQLLRKVHGMASREQPM-----PHVDGELASELTLNLLLAICDSERSGKVSPRSMWNALLLLSTGQLTHKYRGGVVCLCFARILPHCNAIGIPCN-NIYASQLLAL---LGEGCAFGTAEMAVTSLFHAVSYHSDIPSITESQFLGWCLSEP--QLFLWLPAMYRMMKAAGSIHEAKCNICKTCPIVGLRFRCLRCWNLDLCQNCFLTGRDTGWHAPSHPVIESCTS 280          
BLAST of Dystrobrevin beta vs. Ensembl Nematostella
Match: EDO47831 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKW6])

HSP 1 Score: 219.935 bits (559), Expect = 6.130e-61
Identity = 109/339 (32.15%), Postives = 186/339 (54.87%), Query Frame = 3
Query:  321 FDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFIL-----VGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSK----DYQQNQSQSRNVDNNQRMMKTPAGQASP 1310
            FD+IRFA+YRTA KL++IQ++T L L+DV  ++E+FR+ GL  ++ +  L   ++E +++ ++  L+ RLP    +    +  SI ++  WLLY+YD+   GR+ V+++K ALS++  G+ +DK +YHF+ + D +G L   +FE YL +LL L   V E P F +    +         + R +  ++  FLE ++    P    WL+   ++ N     H V C+ C  + ++GFRYKC  C++Y LCQDCFW G  + +H   HD++EY++ +       G +LR  +       +  +GK  +    D+ +    SR +D    +   P+  + P
Sbjct:    3 FDTIRFASYRTAAKLQFIQKKTNLHLVDVYNMIEAFRENGLNTLDHNTELHELRLEAIVSSIFYALNKRLPTTHNVD---VERSISLVTNWLLYAYDSDAIGRIRVLSVKTALSSMCYGRLVDKLRYHFSQIEDNNGMLNFPKFEAYLRELLQLPASVGEAPTFGFTEDVASIFFKPQGPLDRQRTQLVH-FLECVMNKEPPPPYAWLSTLQKMNNAAKTEHQVACQVCKNKPVVGFRYKCLHCYNYVLCQDCFWRGKVSQHHKTDHDMREYSTWNAGEK---GSSLRSKF-------LCGSGKKKRPSLPDFPREPEPSRTLDMTNIVPPLPSDLSGP 327          

HSP 2 Score: 83.5741 bits (205), Expect = 2.605e-16
Identity = 81/237 (34.18%), Postives = 110/237 (46.41%), Query Frame = 3
Query: 1755 DDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHG--YGSPMTT---HRSLSYTADS 2450
            DDEH+LI+RYA+ LV    T S    P TS S+ + DA                    K Q+ELI  LE KN+ +L                +    D+ + A  + S   +  NP LL EL+ LR RKDELE RM++LQESR ELM QLE LM +L   + S     + ++ +  +   A+T      Q+  T ++P SS L    G   +  G   GSP  T    + L   ADS
Sbjct:  385 DDEHKLISRYAARLVRVHKTFS----PATSSSELSIDA-------------------NKEQRELIQTLENKNRLLL--------------KEIRRLRDEHDEA--SKSAAQLAQNPELLAELKLLRQRKDELELRMSALQESRRELMVQLEGLMNLLKVIARSPKAQHIAASPAPGLFSKAST-----PQTPGTPMSPDSSKLSGVDGDIKQAFGDQAGSPSLTRNLRQDLLLAADS 577          
BLAST of Dystrobrevin beta vs. Ensembl Nematostella
Match: EDO41097 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5C8])

HSP 1 Score: 148.673 bits (374), Expect = 2.502e-36
Identity = 88/279 (31.54%), Postives = 142/279 (50.90%), Query Frame = 3
Query:  318 QFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVL-----AVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKS 1139
            + + I+++AYRTA KLR IQ+ T+L L+ +  +  +F Q  L     + N     +  M+  L+T   N     D ++P +   +I++ + WLL  YD+   G++ +++ K+ L  L      DK+ Y F L+ D  G +   +    LHD L +      +  F G N    S  S F      + I   +F+  + A+P  Q ++WL   HRLA  E V+H  +C  C    I+GFR++C +C +Y+LCQ CFW+G  +  H  TH V +Y  S+ S
Sbjct:  351 ELNDIKYSAYRTAMKLRCIQKATKLDLVTLNNLSSAFVQHNL---SKARNDALIGVAEMVDTLHTVFDNIEVGFDNVNPAI---NIDLTLNWLLNVYDSGRVGKIRLLSFKIGLVCLCRAHLDDKYNYLFKLVADNDGKMDHKQLGLLLHDSLQVPRQLGEIAAFGGSNIE-PSVRSCFEKAREKERIDPTQFVYWLSAEP--QSIVWLPTLHRLAASEAVKHKAKCSICKEYPIVGFRFRCLKCFNYDLCQSCFWSGRISHEHRLTHPVHQYCLSTTS 620          
BLAST of Dystrobrevin beta vs. Ensembl Nematostella
Match: EDO45067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTQ0])

HSP 1 Score: 139.043 bits (349), Expect = 5.311e-36
Identity = 87/304 (28.62%), Postives = 148/304 (48.68%), Query Frame = 3
Query:  318 QFDSIRFAAYRTACKLRYIQQRTRLILMDV---------RGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASK----FILVGRSKAIVIE-----EFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALR 1169
            + ++I++AAYRTA KLR I ++T+L L+++           V + + +  L + E+S        +++ A    Q  +R    D      IP + ++ +  +L  YD   TG +  ++LK+ +S L + K  DK++Y F  + +    L   R   +L + L +   ++E   F+  S        F  V  +  + +E      F+E M+A+P  Q ++WL   HRLA  E V+H  +C  C    I+GFRY+C +C +++LCQ CFW G  +  H   H  +EY    S K   + F   +R
Sbjct:   22 ELNNIKYAAYRTAMKLRAIHKKTQLYLVEIPILTATLDEEDVPDGYTEKALSIPEAS--------KIITALFINQNGDRQDFID------IPMASDLTLNLMLNIYDPGRTGYIQALSLKIGISLLCAAKLQDKYRYLFRQMCNSRAVLDRKRLTLFLQECLQIPKYIYESTIFSGTSVEPAVKNCFETVSFTYTLEVELQKFKSFMEWMVAEP--QTIVWLPTLHRLAVSETVKHEAKCNICKMYPIVGFRYRCLKCFNFDLCQGCFWAGRVSKGHKIGHPTQEYCLAPSQKEDIKDFAKVMR 309          
BLAST of Dystrobrevin beta vs. Ensembl Nematostella
Match: EDO29437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3M8])

HSP 1 Score: 58.9214 bits (141), Expect = 9.747e-10
Identity = 39/153 (25.49%), Postives = 77/153 (50.33%), Query Frame = 3
Query:  318 QFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLL 776
            + ++I++AAYRTA KLR I ++T+L L+++  +  +  +  +    +   L   +   +I  L+   +     GD+     IP + ++ +  +L  YD   TG +  ++LK+ +S L + K  DK++Y F  + +    L   R   +L + L
Sbjct:   48 ELNNIKYAAYRTAMKLRAIHKKTQLYLVEIPILTATLDEEDVPDGYTEKALSIPEASKIITALFINQN-----GDRQDFIDIPMASDLTLNLMLNIYDPGRTGYIQALSLKIGISLLCAAKLQDKYRYLFRQMCNSRAVLDRKRLTLFLQECL 195          
BLAST of Dystrobrevin beta vs. Ensembl Medaka
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:101173504])

HSP 1 Score: 301.597 bits (771), Expect = 3.079e-88
Identity = 132/300 (44.00%), Postives = 209/300 (69.67%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  DSIR + YRTACKLR++Q++  L L+D+  V+E+FR+ GL  M+ +  L   ++E++++ ++ QL+ RLP   Q++   + +SI +L+ +LL +YD  G G++ V  +K+AL+T+  GK +DK +Y F+ ++D SG ++ ++F+Q+L ++L L + VFEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++  H L KS
Sbjct:   18 MADRRQLYVEMRAQDLDSIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEAFRENGLNSMDLNAELSVARLEVVLSTIFYQLNKRLPTTHQIN---VEQSISLLLNFLLAAYDPEGHGKMCVFVVKMALATICGGKILDKLRYIFSQISDSSGIMVHSQFDQFLREVLKLPMAVFEGPSFGYTEQAARACF-AQQKKVSLNTFLDTLMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHTESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLTHVLSKS 312          

HSP 2 Score: 69.707 bits (169), Expect = 1.388e-11
Identity = 80/214 (37.38%), Postives = 103/214 (48.13%), Query Frame = 3
Query: 1749 YHDDEHRLIARYASTLVSSRSTHS---GLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN--------TSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            + D+EH LIARYA+ L S  +       +D+P +       DA                    K QK+LIA+LE+KN+EIL+EIQRLR++   +  A     DK               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM +L         T       S+   T SR +     + +A T  T + Q  L GV
Sbjct:  376 HQDEEHSLIARYAARLASDAAAQQQRVPMDLPCS------LDA-------------------NKQQKQLIAELESKNREILQEIQRLRIQ---HEEASQPPPDKGQ------------QNPTLLAELRLLRQRKDELEQRMSTLQESRRELMVQLEQLMMLLKLEEEQKRATQGPGSPRSSPSHTISRPIPTPIHSDSAGTTPTHTPQDSLMGV 549          
BLAST of Dystrobrevin beta vs. Ensembl Medaka
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:101173504])

HSP 1 Score: 300.056 bits (767), Expect = 3.244e-88
Identity = 132/300 (44.00%), Postives = 209/300 (69.67%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  DSIR + YRTACKLR++Q++  L L+D+  V+E+FR+ GL  M+ +  L   ++E++++ ++ QL+ RLP   Q++   + +SI +L+ +LL +YD  G G++ V  +K+AL+T+  GK +DK +Y F+ ++D SG ++ ++F+Q+L ++L L + VFEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++  H L KS
Sbjct:   12 MADRRQLYVEMRAQDLDSIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEAFRENGLNSMDLNAELSVARLEVVLSTIFYQLNKRLPTTHQIN---VEQSISLLLNFLLAAYDPEGHGKMCVFVVKMALATICGGKILDKLRYIFSQISDSSGIMVHSQFDQFLREVLKLPMAVFEGPSFGYTEQAARACF-AQQKKVSLNTFLDTLMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHTESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLTHVLSKS 306          

HSP 2 Score: 78.9518 bits (193), Expect = 1.960e-14
Identity = 75/196 (38.27%), Postives = 97/196 (49.49%), Query Frame = 3
Query: 1827 DMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSA-------------------KSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            DMP   ++  +   P+        LF+ +MPTS                    K QK+LIA+LE+KN+EIL+EIQRLR++   +  A     DK               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM +L T       S+   T SR +     + +A T  T + Q  L GV
Sbjct:  322 DMPEKPLNLAHIVPPRPVNIANEYLFSHSMPTSGNPYSTKKVPMDLPCSLDANKQQKQLIAELESKNREILQEIQRLRIQ---HEEASQPPPDKGQ------------QNPTLLAELRLLRQRKDELEQRMSTLQESRRELMVQLEQLMMLLKTQGPGSPRSSPSHTISRPIPTPIHSDSAGTTPTHTPQDSLMGV 502          
BLAST of Dystrobrevin beta vs. Ensembl Medaka
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:101173504])

HSP 1 Score: 301.212 bits (770), Expect = 9.879e-88
Identity = 132/300 (44.00%), Postives = 209/300 (69.67%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  DSIR + YRTACKLR++Q++  L L+D+  V+E+FR+ GL  M+ +  L   ++E++++ ++ QL+ RLP   Q++   + +SI +L+ +LL +YD  G G++ V  +K+AL+T+  GK +DK +Y F+ ++D SG ++ ++F+Q+L ++L L + VFEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++  H L KS
Sbjct:   18 MADRRQLYVEMRAQDLDSIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEAFRENGLNSMDLNAELSVARLEVVLSTIFYQLNKRLPTTHQIN---VEQSISLLLNFLLAAYDPEGHGKMCVFVVKMALATICGGKILDKLRYIFSQISDSSGIMVHSQFDQFLREVLKLPMAVFEGPSFGYTEQAARACF-AQQKKVSLNTFLDTLMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHTESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLTHVLSKS 312          

HSP 2 Score: 69.707 bits (169), Expect = 1.591e-11
Identity = 80/214 (37.38%), Postives = 103/214 (48.13%), Query Frame = 3
Query: 1749 YHDDEHRLIARYASTLVSSRSTHS---GLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN--------TSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            + D+EH LIARYA+ L S  +       +D+P +       DA                    K QK+LIA+LE+KN+EIL+EIQRLR++   +  A     DK               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM +L         T       S+   T SR +     + +A T  T + Q  L GV
Sbjct:  408 HQDEEHSLIARYAARLASDAAAQQQRVPMDLPCS------LDA-------------------NKQQKQLIAELESKNREILQEIQRLRIQ---HEEASQPPPDKGQ------------QNPTLLAELRLLRQRKDELEQRMSTLQESRRELMVQLEQLMMLLKLEEEQKRATQGPGSPRSSPSHTISRPIPTPIHSDSAGTTPTHTPQDSLMGV 581          
BLAST of Dystrobrevin beta vs. Ensembl Medaka
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:101173504])

HSP 1 Score: 301.212 bits (770), Expect = 1.261e-87
Identity = 132/300 (44.00%), Postives = 209/300 (69.67%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  DSIR + YRTACKLR++Q++  L L+D+  V+E+FR+ GL  M+ +  L   ++E++++ ++ QL+ RLP   Q++   + +SI +L+ +LL +YD  G G++ V  +K+AL+T+  GK +DK +Y F+ ++D SG ++ ++F+Q+L ++L L + VFEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++  H L KS
Sbjct:   18 MADRRQLYVEMRAQDLDSIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEAFRENGLNSMDLNAELSVARLEVVLSTIFYQLNKRLPTTHQIN---VEQSISLLLNFLLAAYDPEGHGKMCVFVVKMALATICGGKILDKLRYIFSQISDSSGIMVHSQFDQFLREVLKLPMAVFEGPSFGYTEQAARACF-AQQKKVSLNTFLDTLMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHTESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLTHVLSKS 312          

HSP 2 Score: 77.0258 bits (188), Expect = 9.329e-14
Identity = 80/206 (38.83%), Postives = 103/206 (50.00%), Query Frame = 3
Query: 1749 YHDDEHRLIARYASTLVSSRSTHS---GLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            + D+EH LIARYA+ L S  +       +D+P    S D                      + K QK+LIA+LE+KN+EIL+EIQRLR++   +  A     DK               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM +L T       S+   T SR +     + +A T  T + Q  L GV
Sbjct:  431 HQDEEHSLIARYAARLASDAAAQQQRVPMDLP---CSLD----------------------ANKQQKQLIAELESKNREILQEIQRLRIQ---HEEASQPPPDKGQ------------QNPTLLAELRLLRQRKDELEQRMSTLQESRRELMVQLEQLMMLLKTQGPGSPRSSPSHTISRPIPTPIHSDSAGTTPTHTPQDSLMGV 596          
BLAST of Dystrobrevin beta vs. Ensembl Medaka
Match: dtna (dystrobrevin alpha [Source:NCBI gene;Acc:101173504])

HSP 1 Score: 301.212 bits (770), Expect = 1.306e-87
Identity = 132/300 (44.00%), Postives = 209/300 (69.67%), Query Frame = 3
Query:  276 MAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKS 1175
            MA  ++L  EM+A+  DSIR + YRTACKLR++Q++  L L+D+  V+E+FR+ GL  M+ +  L   ++E++++ ++ QL+ RLP   Q++   + +SI +L+ +LL +YD  G G++ V  +K+AL+T+  GK +DK +Y F+ ++D SG ++ ++F+Q+L ++L L + VFEGP+F Y  QA++     + K + +  FL+ +++DP PQCL+WL + HRLAN+ENV H V C  CH E ++GFRY+CQ+CH+Y LCQDCFW G  +G+HSN H +KEYT S KS +++  H L KS
Sbjct:   12 MADRRQLYVEMRAQDLDSIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEAFRENGLNSMDLNAELSVARLEVVLSTIFYQLNKRLPTTHQIN---VEQSISLLLNFLLAAYDPEGHGKMCVFVVKMALATICGGKILDKLRYIFSQISDSSGIMVHSQFDQFLREVLKLPMAVFEGPSFGYTEQAARACF-AQQKKVSLNTFLDTLMSDPPPQCLVWLPLMHRLANVENVFHPVECSYCHTESMMGFRYRCQQCHNYQLCQDCFWRGHASGSHSNQHQMKEYT-SWKSPAKKLTHVLSKS 306          

HSP 2 Score: 69.3218 bits (168), Expect = 1.792e-11
Identity = 80/214 (37.38%), Postives = 103/214 (48.13%), Query Frame = 3
Query: 1749 YHDDEHRLIARYASTLVSSRSTHS---GLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLN--------TSSSSQTNSALYSTKSRSM-----NQAANTISTFSRQSGLTGV 2342
            + D+EH LIARYA+ L S  +       +D+P    S D                      + K QK+LIA+LE+KN+EIL+EIQRLR++   +  A     DK               NP LL ELR LR RKDELE RM++LQESR ELM QLE LM +L         T       S+   T SR +     + +A T  T + Q  L GV
Sbjct:  425 HQDEEHSLIARYAARLASDAAAQQQRVPMDLP---CSLD----------------------ANKQQKQLIAELESKNREILQEIQRLRIQ---HEEASQPPPDKGQ------------QNPTLLAELRLLRQRKDELEQRMSTLQESRRELMVQLEQLMMLLKLEEEQKRATQGPGSPRSSPSHTISRPIPTPIHSDSAGTTPTHTPQDSLMGV 598          
BLAST of Dystrobrevin beta vs. Planmine SMEST
Match: SMESG000078318.1 (SMESG000078318.1)

HSP 1 Score: 2085.46 bits (5402), Expect = 0.000e+0
Identity = 1075/1083 (99.26%), Postives = 1075/1083 (99.26%), Query Frame = 3
Query:  228 MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNFTGNEKWNKMLLFSHQQHSLDASTKTLNDASNAGLMSSNSQPLIMTQAVNKIDRNFNTASPSSNHQMTIKSVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVKELQPSANNKXXXXXXXXXXXXXXXXXXXRMNHNYHFNEYESEYERALDDCGMAKKSSTAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDYNNHNLQNDSPPGPAPKLQESSVNKGVRIAXXXXXXHRTRPQGELRTNSNGTLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEKLYDIHSLHQKIXXXXXXXXXXXXXXRHKWDNSN 3476
            MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNFTGNEKWNKMLLFSHQQHSLDASTKTLNDASNAGLMSSNSQPLIMTQAVNKIDRNFNTASPS        SVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKEILREIQRLRLEQQQNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVKELQPSANNKQTFSQNSSPTSTSQPNNQNRMNHNYHFNEYESEYERALDDCGMAKKSSTAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDYNNHNLQNDSPPGPAPKLQESSVNKGVRIAPPPLPPHRTRPQGELRTNSNGTLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEKLYDIHSLHQKINSLNNGDLDQDLDNRHKWDNSN
Sbjct:    1 MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNFTGNEKWNKMLLFSHQQHSLDASTKTLNDASNAGLMSSNSQPLIMTQAVNKIDRNFNTASPS--------SVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKEILREIQRLRLEQQQNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVKELQPSANNKQTFSQNSSPTSTSQPNNQNRMNHNYHFNEYESEYERALDDCGMAKKSSTAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDYNNHNLQNDSPPGPAPKLQESSVNKGVRIAPPPLPPHRTRPQGELRTNSNGTLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEKLYDIHSLHQKINSLNNGDLDQDLDNRHKWDNSN 1075          
BLAST of Dystrobrevin beta vs. Planmine SMEST
Match: SMESG000078318.1 (SMESG000078318.1)

HSP 1 Score: 1120.92 bits (2898), Expect = 0.000e+0
Identity = 622/631 (98.57%), Postives = 625/631 (99.05%), Query Frame = 3
Query: 1584 ASPSSNHQMTIKSVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKXXXXXXXXXXXXXXXNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVKELQPSANNKXXXXXXXXXXXXXXXXXXXRMNHNYHFNEYESEYERALDDCGMAKKSSTAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDYNNHNLQNDSPPGPAPKLQESSVNKGVRIAXXXXXXHRTRPQGELRTNSNGTLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEKLYDIHSLHQKIXXXXXXXXXXXXXXRHKWDNSN 3476
            ASP+     T ++VNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKEILREIQRLRLEQQQNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVKELQPSANNKQTFSQNSSPTSTSQPNNQNRMNHNYHFNEYESEYERALDDCGMAKKSSTAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDYNNHNLQNDSPPGPAPKLQESSVNKGVRIAPPPLPPHRTRPQGELRTNSNGTLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEKLYDIHSLHQKINSLNNGDLDQDLDNRHKWDNSN
Sbjct:  382 ASPNQTMMTTDQNVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQPSKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKIEVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKEILREIQRLRLEQQQNASAVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQESRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQSGLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPHSILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTTDYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVKELQPSANNKQTFSQNSSPTSTSQPNNQNRMNHNYHFNEYESEYERALDDCGMAKKSSTAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDYNNHNLQNDSPPGPAPKLQESSVNKGVRIAPPPLPPHRTRPQGELRTNSNGTLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEKLYDIHSLHQKINSLNNGDLDQDLDNRHKWDNSN 1012          

HSP 2 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 396/399 (99.25%), Postives = 397/399 (99.50%), Query Frame = 3
Query:  228 MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQ--NFTG 1418
            MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQ  NF+G
Sbjct:    1 MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQQRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNRLPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTSSSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQRMMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNVNFSG 399          
BLAST of Dystrobrevin beta vs. Planmine SMEST
Match: SMESG000020523.1 (SMESG000020523.1)

HSP 1 Score: 117.087 bits (292), Expect = 7.450e-26
Identity = 59/208 (28.37%), Postives = 110/208 (52.88%), Query Frame = 3
Query:  573 IEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILV-------GRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALR 1169
            +++ + WLL  YD++  G++ V++LK A+  L +    +K+KY F+L+ +  G L   R    L D +++   + E  +F  ++     I         G  + I +  FL  +  +P  Q L+WL + +R+ + E+  H  +C  C  + I+G RY+C RC +++LCQ CF+   T+ +H  +H ++EY   +SS+ + R +    R
Sbjct: 3366 VDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNSPESGNHRFIRLSNFLAWLRLEP--QSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFR 3571          
BLAST of Dystrobrevin beta vs. Planmine SMEST
Match: SMESG000020523.1 (SMESG000020523.1)

HSP 1 Score: 103.605 bits (257), Expect = 8.268e-22
Identity = 60/246 (24.39%), Postives = 112/246 (45.53%), Query Frame = 3
Query:  573 IEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFA-----------YNSQASKFIL----------------------------------VGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALR 1169
            +++ + WLL  YD++  G++ V++LK A+  L +    +K+KY F+L+ +  G L   R    L D +++   + E  +F            + +   KF+                                    G  + I +  FL  +  +P  Q L+WL + +R+ + E+  H  +C  C  + I+G RY+C RC +++LCQ CF+   T+ +H  +H ++EY   +SS+ + R +    R
Sbjct: 3358 VDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRKKNSNSENSNEKSPESGNHRFIRLSNFLAWLRLEP--QSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFR 3601          
The following BLAST results are available for this feature:
BLAST of Dystrobrevin beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DTNA2.174e-8343.33dystrobrevin alpha [Source:HGNC Symbol;Acc:HGNC:30... [more]
DTNA2.431e-8343.33dystrobrevin alpha [Source:HGNC Symbol;Acc:HGNC:30... [more]
DTNA3.578e-8343.33dystrobrevin alpha [Source:HGNC Symbol;Acc:HGNC:30... [more]
DTNA3.862e-8343.33dystrobrevin alpha [Source:HGNC Symbol;Acc:HGNC:30... [more]
DTNB5.956e-8342.33dystrobrevin beta [Source:HGNC Symbol;Acc:HGNC:305... [more]
back to top
BLAST of Dystrobrevin beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyb-11.048e-7541.08Dystrobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
dyb-15.878e-5838.58Dystrobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
dys-18.261e-2729.87Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9T... [more]
dys-11.211e-2429.57Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9T... [more]
dys-11.220e-2429.57Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9T... [more]
back to top
BLAST of Dystrobrevin beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyb2.045e-8242.03gene:FBgn0033739 transcript:FBtr0308613[more]
Dyb2.692e-8242.03gene:FBgn0033739 transcript:FBtr0100298[more]
Dyb2.749e-8241.58gene:FBgn0033739 transcript:FBtr0087929[more]
Dyb4.720e-8242.03gene:FBgn0033739 transcript:FBtr0305077[more]
Dyb5.155e-8241.58gene:FBgn0033739 transcript:FBtr0087930[more]
back to top
BLAST of Dystrobrevin beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtnbb5.541e-8341.67dystrobrevin, beta b [Source:ZFIN;Acc:ZDB-GENE-070... [more]
dtnbb5.707e-8341.67dystrobrevin, beta b [Source:ZFIN;Acc:ZDB-GENE-070... [more]
dtna4.820e-8242.33dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-0701... [more]
dtna6.140e-8242.33dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-0701... [more]
dtna6.140e-8242.33dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-0701... [more]
back to top
BLAST of Dystrobrevin beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtna2.003e-8441.67dystrobrevin alpha [Source:NCBI gene;Acc:779813][more]
dtna2.036e-8441.67dystrobrevin alpha [Source:NCBI gene;Acc:779813][more]
dtna2.482e-8441.67dystrobrevin alpha [Source:NCBI gene;Acc:779813][more]
dtna3.397e-8441.67dystrobrevin alpha [Source:NCBI gene;Acc:779813][more]
dtna5.062e-8441.67dystrobrevin alpha [Source:NCBI gene;Acc:779813][more]
back to top
BLAST of Dystrobrevin beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dtnb1.210e-8342.67dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203... [more]
Dtnb1.241e-8342.67dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203... [more]
Dtnb2.689e-8342.67dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203... [more]
Dtnb2.916e-8342.67dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203... [more]
Dtnb3.011e-8342.67dystrobrevin, beta [Source:MGI Symbol;Acc:MGI:1203... [more]
back to top
BLAST of Dystrobrevin beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60941|DTNB_HUMAN8.170e-8242.33Dystrobrevin beta OS=Homo sapiens OX=9606 GN=DTNB ... [more]
sp|O70585|DTNB_MOUSE9.463e-8242.67Dystrobrevin beta OS=Mus musculus OX=10090 GN=Dtnb... [more]
sp|Q9Y4J8|DTNA_HUMAN3.021e-8143.33Dystrobrevin alpha OS=Homo sapiens OX=9606 GN=DTNA... [more]
sp|Q9D2N4|DTNA_MOUSE4.650e-8143.33Dystrobrevin alpha OS=Mus musculus OX=10090 GN=Dtn... [more]
sp|P84060|DTNB_RAT4.999e-8142.33Dystrobrevin beta OS=Rattus norvegicus OX=10116 GN... [more]
back to top
BLAST of Dystrobrevin beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LEN91.831e-11960.45ZZ-type domain-containing protein OS=Opisthorchis ... [more]
A0A3R7EUH45.861e-11960.13Dystrobrevin beta OS=Clonorchis sinensis OX=79923 ... [more]
A0A0X3NGC74.789e-11758.13Dystrobrevin-1 OS=Schistocephalus solidus OX=70667... [more]
A0A0X3NXD52.550e-11658.13Dystrobrevin-1 OS=Schistocephalus solidus OX=70667... [more]
A0A4E0RH397.863e-11560.66Dystrobrevin beta OS=Fasciola hepatica OX=6192 GN=... [more]
back to top
BLAST of Dystrobrevin beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtnbb2.324e-8241.89dystrobrevin, beta b [Source:ZFIN;Acc:ZDB-GENE-070... [more]
dtna5.962e-8142.67dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-0701... [more]
dtnba1.622e-8041.00dystrobrevin, beta a [Source:ZFIN;Acc:ZDB-GENE-030... [more]
dtna1.513e-7942.67dystrobrevin, alpha [Source:ZFIN;Acc:ZDB-GENE-0701... [more]
drp29.089e-3329.49dystrophin related protein 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Dystrobrevin beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dtnba2.931e-9043.67dystrobrevin, beta a [Source:ZFIN;Acc:ZDB-GENE-030... [more]
ENSPMAT00000002801.12.039e-3329.43pep scaffold:Pmarinus_7.0:GL476499:231780:258689:1... [more]
ENSPMAT00000004878.18.725e-2729.66pep scaffold:Pmarinus_7.0:GL480232:9823:26212:1 ge... [more]
ENSPMAT00000010595.13.714e-1927.05pep scaffold:Pmarinus_7.0:GL477281:35182:38646:-1 ... [more]
back to top
BLAST of Dystrobrevin beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dystrobrevin beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO478316.130e-6132.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410972.502e-3631.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450675.311e-3628.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO294379.747e-1025.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dystrobrevin beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtna3.079e-8844.00dystrobrevin alpha [Source:NCBI gene;Acc:101173504... [more]
dtna3.244e-8844.00dystrobrevin alpha [Source:NCBI gene;Acc:101173504... [more]
dtna9.879e-8844.00dystrobrevin alpha [Source:NCBI gene;Acc:101173504... [more]
dtna1.261e-8744.00dystrobrevin alpha [Source:NCBI gene;Acc:101173504... [more]
dtna1.306e-8744.00dystrobrevin alpha [Source:NCBI gene;Acc:101173504... [more]
back to top
BLAST of Dystrobrevin beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000078318.10.000e+099.26SMESG000078318.1[more]
SMESG000078318.10.000e+098.57SMESG000078318.1[more]
SMESG000020523.17.450e-2628.37SMESG000020523.1[more]
SMESG000020523.18.268e-2224.39SMESG000020523.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020007 ID=SMED30020007|Name=Dystrobrevin beta|organism=Schmidtea mediterranea sexual|type=transcript|length=3798bp
ATTTAATTAAAATCAGCGAGAATTAAACCATTTATAAACGTGTATAAATT
TTACTTTTCCGGAATTGTGGAATGAAATTATTTTCAGAATCAGATATAAA
TTTTAGCGAATAGTATTTTTTCAAGAATAGTAATCAAAATTCTGAACTAT
TTGACAGATTTGTTATTTTTCGTAGAAACTGAATCTTTTCCGCGGCGCAA
AAACCATTATATTGTCCATTATTTGCAATGAACACTTTGTCGAAAACACA
AAATAAAGTCACTCAACAAATTGGAATGGCAGGTTTCAAGCGCCTAATTA
ATGAAATGAAAGCCAAACAATTTGACTCGATCCGATTCGCAGCGTATAGA
ACCGCATGCAAATTGAGATACATTCAACAGAGGACAAGATTAATTCTAAT
GGATGTCAGGGGTGTGGTAGAGTCGTTTCGTCAAACAGGACTTTACCTTA
TGGAATCCAGCTGCAATCTCGACAGAACTCAAATAGAAATGATGATAGCT
CAATTATATACCCAATTATCAAACAGATTACCAGCCGGTGACCAGTTACA
TCCGAATCTTATTCCAGAATCTATAGAAATGCTAATGGGTTGGTTGCTCT
ATAGTTATGACACATCCGGAACTGGTCGATTATCAGTAATGGCATTGAAA
GTAGCTTTATCAACTTTAGCTTCAGGAAAACCAATGGATAAATTTAAATA
TCATTTCACACTATTAACTGATCCATCTGGAGCTCTGATCCCAACGCGAT
TCGAACAATATCTTCACGATTTACTAGTTTTGGCTGTGGGTGTATTTGAA
GGACCAAATTTTGCTTACAATTCTCAAGCTTCAAAATTTATTCTTGTTGG
AAGATCAAAAGCTATCGTAATTGAAGAATTTCTTGAAAAAATGTTAGCTG
ATCCCGGTCCCCAATGTTTACTGTGGTTGACAATTTTCCATAGATTAGCA
AACATTGAAAACGTGCGTCACAATGTTCGATGTGAAGGGTGTCACAGGGA
AGTGATTATTGGATTCAGATACAAATGCCAGAGGTGCCATCATTATAATT
TATGCCAAGATTGTTTCTGGACAGGAGTGACTACTGGCAATCATAGCAAC
ACTCATGATGTCAAAGAATACACGTCTTCTTCAAAGTCTCATTCGCGTCA
ATTTGGTCACGCGCTTCGTAAATCATGGGATAGACAAAACAATTCCACAG
TAGCATGTACTGGAAAATCATCAAAAGATTACCAACAAAACCAGTCACAA
TCAAGGAATGTTGACAATAATCAACGAATGATGAAAACCCCTGCAGGTCA
GGCTAGTCCATGTCTACCATATAGAAATACAGTATCCCGAATCCAAGCGG
CCGATAATGGTCAATTTAGAGCTTCTCCAAATCAAACAATGATGACCACG
GACCAAAATTTCACTGGAAACGAAAAATGGAACAAAATGTTGCTCTTCTC
TCATCAACAACATTCTCTAGACGCTTCTACAAAGACTTTAAACGATGCTT
CCAATGCAGGACTCATGTCATCGAACAGTCAGCCTCTTATAATGACCCAA
GCAGTAAATAAAATTGATAGGAATTTCAATACAGCTTCTCCATCGAGTAA
TCATCAAATGACTATTAAAAGTGTTAACTTTTCCGGTGTTAGTCAAATTC
CTTCAATGAATCACGCATGTAGTAACGTTACAAATACCGGAAATTGGGAT
TCATCCCTGAAGCATACTAATCAGCCTTCAAAAGACTGGCGTCAGTTCTA
TCATGATGACGAACACAGGCTGATCGCTCGTTATGCAAGCACTTTGGTCT
CTAGTCGTTCTACTCATTCCGGCCTTGATATGCCTCACACTTCTATCAGT
CAAGATAATACAGATGCTCCGAAAATTGAGGTCCATTTAAGATCAGATTT
ATTCAATCAAAATATGCCTACGTCCGCCAAATCGCAGAAAGAACTTATCG
CAAAATTGGAAGCTAAAAATAAAGAAATTTTACGTGAAATCCAAAGACTG
CGGCTTGAGCAACAACAAAACGCATCTGCTGTAAATGCTGCAACGGATAA
AACCAACAGTGCAATCAACAATGATTCCGTCACCGGAATTGTAAATAATC
CCAATTTACTGGTGGAGTTAAGGAATCTCAGACACAGGAAAGATGAGTTG
GAAAACCGTATGACAAGTTTACAGGAAAGTCGATTGGAACTGATGCAACA
ATTGGAATCATTAATGAGAGTTCTTAATACCAGTTCAAGTAGTCAAACAA
ATTCTGCTCTTTATAGTACTAAATCAAGATCTATGAATCAGGCTGCAAAT
ACAATATCAACATTCAGTAGGCAGTCGGGGCTGACAGGTGTGACCCCATT
GAGTAGTTTACTTCCATCAAATTCTGGCCAGCCATTAAAGCTTCATGGTT
ATGGCTCACCGATGACTACTCACAGATCCCTCAGTTATACTGCAGATAGT
AATAGATCAGTAACAATGGGTCCGCATTCAATTTTACCCCAACCCCGATT
TAACACACTCACTCGTCATTCCAGAACATTTTCAGCAGATGAAGGATTAG
GCGGATTCGCTTCTCAACCGAGAAGAACTTTCACTTCTGGGAATCGTACT
CTAGAATCGTTGGGTGTTGATACAACAGATTATTATTTAAAACAATCATC
AGATAAAGCTAAACAAAATAATTCACTTTCCAAAGAAATGGATTTGAGAC
AAAATTTATTAATGGCAGCCGACAATGTCACAAATGCCATGACTGGTCTT
GTAAAGGAACTCCAACCTTCTGCCAATAACAAACAGACTTTCAGCCAAAA
TTCATCGCCAACGTCTACGTCACAGCCCAACAATCAAAATAGAATGAATC
ATAATTATCATTTCAATGAATATGAATCCGAATACGAAAGAGCTCTAGAT
GACTGTGGAATGGCAAAAAAATCTTCCACTGCTCCACAAAATCTTAATTC
TGCAACTGTTTTTGCAAATAGTAGAATATCTAGTAGAATTTTATCTGAAC
AGCGATTTTTAAACGAATTGCGTGCCAGACGGCAAAATAATACACTCGGG
CGAGGCAGTAATGATCAAAATGACTACAATAATCACAATTTACAAAATGA
CAGCCCTCCAGGTCCTGCTCCGAAATTGCAGGAATCGTCTGTAAATAAAG
GCGTAAGAATTGCTCCTCCACCTCTGCCACCTCATAGAACTAGACCTCAA
GGTGAACTTCGAACAAATAGCAATGGAACACTTTGTAATTATGGAGAATC
AGATTCAGAAGCATATTTATATTCGGATCCTGAATGCAGTTTATTGAGAC
TTAATGAAGATGAAATGGGTCCAGCTATGTCTTTAGGTAGAGGCAGAGAA
AAAAGTATACCCATGGAAAACGAAAAGTTGTATGATATACATAGCCTACA
TCAAAAAATAAATTCATTAAACAATGGTGACTTAGACCAAGATTTAGACA
ACCGCCATAAATGGGATAATTCTAACTGACAAATTGGGATGTAGGCTCGG
AATCCATGGACTCGAATACAAAATCATGTTTCAATTCATGTTAATTCATC
AATTTATCATGATATTTTAACTATTTCATGCGAAAACTCTCGATTGATGT
TTATTTTATAAAAATCATTTCCAGACATTTTAGTGAAAAGATAAAAATTG
TAAATGTTTAATCGTAGTTGTTTTAGTCTTAAATTTTTATATAAATTCAC
AGATTTTTAAATTAGCTCGATTTTATTGAATTGTGTTTTTTTGTTGAAAG
ATAATTAACGTTTTTGAAATTTACTGTAAATCTTTTTTAAAAGAGCAC
back to top

protein sequence of SMED30020007-orf-1

>SMED30020007-orf-1 ID=SMED30020007-orf-1|Name=SMED30020007-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1084bp
MNTLSKTQNKVTQQIGMAGFKRLINEMKAKQFDSIRFAAYRTACKLRYIQ
QRTRLILMDVRGVVESFRQTGLYLMESSCNLDRTQIEMMIAQLYTQLSNR
LPAGDQLHPNLIPESIEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASG
KPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQ
ASKFILVGRSKAIVIEEFLEKMLADPGPQCLLWLTIFHRLANIENVRHNV
RCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEYTS
SSKSHSRQFGHALRKSWDRQNNSTVACTGKSSKDYQQNQSQSRNVDNNQR
MMKTPAGQASPCLPYRNTVSRIQAADNGQFRASPNQTMMTTDQNFTGNEK
WNKMLLFSHQQHSLDASTKTLNDASNAGLMSSNSQPLIMTQAVNKIDRNF
NTASPSSNHQMTIKSVNFSGVSQIPSMNHACSNVTNTGNWDSSLKHTNQP
SKDWRQFYHDDEHRLIARYASTLVSSRSTHSGLDMPHTSISQDNTDAPKI
EVHLRSDLFNQNMPTSAKSQKELIAKLEAKNKEILREIQRLRLEQQQNAS
AVNAATDKTNSAINNDSVTGIVNNPNLLVELRNLRHRKDELENRMTSLQE
SRLELMQQLESLMRVLNTSSSSQTNSALYSTKSRSMNQAANTISTFSRQS
GLTGVTPLSSLLPSNSGQPLKLHGYGSPMTTHRSLSYTADSNRSVTMGPH
SILPQPRFNTLTRHSRTFSADEGLGGFASQPRRTFTSGNRTLESLGVDTT
DYYLKQSSDKAKQNNSLSKEMDLRQNLLMAADNVTNAMTGLVKELQPSAN
NKQTFSQNSSPTSTSQPNNQNRMNHNYHFNEYESEYERALDDCGMAKKSS
TAPQNLNSATVFANSRISSRILSEQRFLNELRARRQNNTLGRGSNDQNDY
NNHNLQNDSPPGPAPKLQESSVNKGVRIAPPPLPPHRTRPQGELRTNSNG
TLCNYGESDSEAYLYSDPECSLLRLNEDEMGPAMSLGRGREKSIPMENEK
LYDIHSLHQKINSLNNGDLDQDLDNRHKWDNSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043145Znf_ZZ_sf
IPR000433Znf_ZZ
IPR015153EF-hand_dom_typ1
IPR015154EF-hand_dom_typ2
IPR011992EF-hand-dom_pair
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 567..594
NoneNo IPR availableCOILSCoilCoilcoord: 624..658
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 55..151
e-value: 4.4E-8
score: 35.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 978..999
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 296..350
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 850..872
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 315..350
NoneNo IPR availablePANTHERPTHR12268E3 UBIQUITIN-PROTEIN LIGASE KCMF1coord: 509..683
coord: 16..317
NoneNo IPR availablePANTHERPTHR12268:SF19DYSTROBREVIN ALPHAcoord: 509..683
coord: 16..317
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 227..300
IPR000433Zinc finger, ZZ-typeSMARTSM00291zz_5coord: 246..291
e-value: 4.5E-15
score: 66.1
IPR000433Zinc finger, ZZ-typePFAMPF00569ZZcoord: 247..289
e-value: 4.4E-11
score: 42.4
IPR000433Zinc finger, ZZ-typePROSITEPS50135ZF_ZZ_2coord: 246..293
score: 14.03
IPR015154EF-hand domain, type 2PFAMPF09069EF-hand_3coord: 154..241
e-value: 1.2E-14
score: 54.5
IPR015153EF-hand domain, type 1PFAMPF09068EF-hand_2coord: 22..147
e-value: 6.0E-26
score: 91.0
IPR043145Zinc finger, ZZ-type superfamilyGENE3DG3DSA:3.30.60.90coord: 241..301
e-value: 2.7E-22
score: 80.1
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 30..149
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 152..245