SUN domain-containing protein 2

Overview
NameSUN domain-containing protein 2
Smed IDSMED30019991
Length (bp)2971
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SUN domain-containing protein 2 (SMED30019991) t-SNE clustered cells

Violin plots show distribution of expression levels for SUN domain-containing protein 2 (SMED30019991) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019991

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30019991h1SMcG0017956 Contig4149_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30019991h1SMcG0017956 Contig4149_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SUN domain-containing protein 2 vs. Ensembl Human
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:14210])

HSP 1 Score: 176.022 bits (445), Expect = 4.916e-45
Identity = 92/223 (41.26%), Postives = 130/223 (58.30%), Query Frame = 2
Query: 2114 KLLNYSAFCANKKIKE-------NLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            K+L + A    K  +E        L  E    ++E ++  +VK A+++YS D++GLAD+ALES G SVI+TR S TY      LS    PL     S R I+QP    G CW+F G  G AV++LS +I   AVTLEH+P  L  +  I SAPK F I+   E+ Q++  L+G F Y QDG  IQTF    P +A  ++V+  +L+N G+ ++TC+YR R+HG
Sbjct:  491 KILTHVAEMQGKSAREAAASLSLTLQKEGVIGVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHG 713          
BLAST of SUN domain-containing protein 2 vs. Ensembl Human
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:14210])

HSP 1 Score: 176.022 bits (445), Expect = 4.916e-45
Identity = 92/223 (41.26%), Postives = 130/223 (58.30%), Query Frame = 2
Query: 2114 KLLNYSAFCANKKIKE-------NLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            K+L + A    K  +E        L  E    ++E ++  +VK A+++YS D++GLAD+ALES G SVI+TR S TY      LS    PL     S R I+QP    G CW+F G  G AV++LS +I   AVTLEH+P  L  +  I SAPK F I+   E+ Q++  L+G F Y QDG  IQTF    P +A  ++V+  +L+N G+ ++TC+YR R+HG
Sbjct:  491 KILTHVAEMQGKSAREAAASLSLTLQKEGVIGVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHG 713          
BLAST of SUN domain-containing protein 2 vs. Ensembl Human
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:14210])

HSP 1 Score: 176.022 bits (445), Expect = 6.452e-45
Identity = 92/223 (41.26%), Postives = 130/223 (58.30%), Query Frame = 2
Query: 2114 KLLNYSAFCANKKIKE-------NLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            K+L + A    K  +E        L  E    ++E ++  +VK A+++YS D++GLAD+ALES G SVI+TR S TY      LS    PL     S R I+QP    G CW+F G  G AV++LS +I   AVTLEH+P  L  +  I SAPK F I+   E+ Q++  L+G F Y QDG  IQTF    P +A  ++V+  +L+N G+ ++TC+YR R+HG
Sbjct:  512 KILTHVAEMQGKSAREAAASLSLTLQKEGVIGVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHG 734          
BLAST of SUN domain-containing protein 2 vs. Ensembl Human
Match: SUN1 (Sad1 and UNC84 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:18587])

HSP 1 Score: 157.147 bits (396), Expect = 3.067e-39
Identity = 82/207 (39.61%), Postives = 119/207 (57.49%), Query Frame = 2
Query: 2144 NKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTF-LVTTP--KVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            ++ +   +S      ++E + + +V  A++ YS DK G+ DFALES GGS+++TR S TY      +S    PL     S R +IQP    G CW+F GS G+ V++LS  I   A TLEH+P  L   G I SAPK F +Y L    QE+ +L+G F Y QDG ++Q F  +  P     +IV+  + SN G+ ++TC+YR R+HG
Sbjct:  424 SEAVVSAVSEAGASGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHG 630          
BLAST of SUN domain-containing protein 2 vs. Ensembl Human
Match: SUN1 (Sad1 and UNC84 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:18587])

HSP 1 Score: 157.918 bits (398), Expect = 3.127e-39
Identity = 82/207 (39.61%), Postives = 119/207 (57.49%), Query Frame = 2
Query: 2144 NKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTF-LVTTP--KVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            ++ +   +S      ++E + + +V  A++ YS DK G+ DFALES GGS+++TR S TY      +S    PL     S R +IQP    G CW+F GS G+ V++LS  I   A TLEH+P  L   G I SAPK F +Y L    QE+ +L+G F Y QDG ++Q F  +  P     +IV+  + SN G+ ++TC+YR R+HG
Sbjct:  472 SEAVVSAVSEAGASGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHG 678          
BLAST of SUN domain-containing protein 2 vs. Ensembl Celegans
Match: unc-84 (Nuclear migration and anchoring protein unc-84 [Source:UniProtKB/Swiss-Prot;Acc:Q20745])

HSP 1 Score: 116.316 bits (290), Expect = 4.652e-26
Identity = 68/190 (35.79%), Postives = 107/190 (56.32%), Query Frame = 2
Query: 2204 IKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQR---GECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSE-LIGTFDYSQDGPAIQTFLVT-TPKV-ARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            ++ +++  + +Y  DK G  D+ALES GG+V++TR S TY        F   P+   + S R +IQ  ++    GECW F  S G+  ++LSH I V++++ EH+ + +  +G   SAPK   +++  +     S  LIG + Y  DGP +Q FL    P    + V+ +V SN+G   FTC+YRLR+HG
Sbjct:  918 LEAIIRQMIYEYDTDKTGKVDYALESSGGAVVSTRCSETYKSYTRLEKFWDIPIYYFHYSPRVVIQRNSKSLFPGECWCFKESRGYIAVELSHFIDVSSISYEHIGSEVAPEGNRSSAPKGVLVWAYKQIDDLNSRVLIGDYTYDLDGPPLQFFLAKHKPDFPVKFVELEVTSNYG-APFTCLYRLRVHG 1106          
BLAST of SUN domain-containing protein 2 vs. Ensembl Fly
Match: koi (gene:FBgn0265003 transcript:FBtr0335513)

HSP 1 Score: 146.362 bits (368), Expect = 1.698e-35
Identity = 69/192 (35.94%), Postives = 110/192 (57.29%), Query Frame = 2
Query: 2189 LSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVAR---IVQFDVLSNHGNIDFTCVYRLRIHG 2755
            + E +++++VK  +  Y ADK GL DFALES GG +++TR + +Y      +S    PL    ++ R  I P  Q GECW+F G  G  V++L+  + V   TLEH+P  L   G+I SAP+ F ++ L +   ++  L G + +  +G ++Q F V    + R   IV+  + +NHG+  +TC+YR R+HG
Sbjct:  685 IREEEVRQIVKTVLAIYDADKTGLVDFALESAGGQILSTRCTESYQTKSAQISVFGIPLWYPTNTPRVAISPNVQPGECWAFQGFPGFLVLKLNSLVYVTGFTLEHIPKSLSPTGRIESAPRNFTVWGLEQEKDQEPVLFGDYQFEDNGASLQYFAVQNLDIKRPYEIVELRIETNHGHPTYTCLYRFRVHG 876          
BLAST of SUN domain-containing protein 2 vs. Ensembl Fly
Match: koi (gene:FBgn0265003 transcript:FBtr0335514)

HSP 1 Score: 146.747 bits (369), Expect = 1.777e-35
Identity = 69/192 (35.94%), Postives = 110/192 (57.29%), Query Frame = 2
Query: 2189 LSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVAR---IVQFDVLSNHGNIDFTCVYRLRIHG 2755
            + E +++++VK  +  Y ADK GL DFALES GG +++TR + +Y      +S    PL    ++ R  I P  Q GECW+F G  G  V++L+  + V   TLEH+P  L   G+I SAP+ F ++ L +   ++  L G + +  +G ++Q F V    + R   IV+  + +NHG+  +TC+YR R+HG
Sbjct:  769 IREEEVRQIVKTVLAIYDADKTGLVDFALESAGGQILSTRCTESYQTKSAQISVFGIPLWYPTNTPRVAISPNVQPGECWAFQGFPGFLVLKLNSLVYVTGFTLEHIPKSLSPTGRIESAPRNFTVWGLEQEKDQEPVLFGDYQFEDNGASLQYFAVQNLDIKRPYEIVELRIETNHGHPTYTCLYRFRVHG 960          
BLAST of SUN domain-containing protein 2 vs. Ensembl Fly
Match: koi (gene:FBgn0265003 transcript:FBtr0335512)

HSP 1 Score: 146.747 bits (369), Expect = 1.777e-35
Identity = 69/192 (35.94%), Postives = 110/192 (57.29%), Query Frame = 2
Query: 2189 LSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVAR---IVQFDVLSNHGNIDFTCVYRLRIHG 2755
            + E +++++VK  +  Y ADK GL DFALES GG +++TR + +Y      +S    PL    ++ R  I P  Q GECW+F G  G  V++L+  + V   TLEH+P  L   G+I SAP+ F ++ L +   ++  L G + +  +G ++Q F V    + R   IV+  + +NHG+  +TC+YR R+HG
Sbjct:  769 IREEEVRQIVKTVLAIYDADKTGLVDFALESAGGQILSTRCTESYQTKSAQISVFGIPLWYPTNTPRVAISPNVQPGECWAFQGFPGFLVLKLNSLVYVTGFTLEHIPKSLSPTGRIESAPRNFTVWGLEQEKDQEPVLFGDYQFEDNGASLQYFAVQNLDIKRPYEIVELRIETNHGHPTYTCLYRFRVHG 960          
BLAST of SUN domain-containing protein 2 vs. Ensembl Fly
Match: spag4 (gene:FBgn0032368 transcript:FBtr0340563)

HSP 1 Score: 74.3294 bits (181), Expect = 4.427e-14
Identity = 52/171 (30.41%), Postives = 81/171 (47.37%), Query Frame = 2
Query: 2264 DFALESMGGSVIATRS----SPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDG-PAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGIL 2761
            ++A E +G  +I  ++        I     L F  NP     + +RT + PG     C+ F GS     + L+  IIV A+TL H+   +  D  + SAPK F +Y L  +   K EL+G + Y        Q++ V +    R + F   SNHG  + TC+YR+ ++G L
Sbjct:  114 NYASEELGARIINVKAHSIDGTNIIRSLLGLDFSTNP---PVNMIRTGLSPG----SCFGFNGSRATVTLHLARTIIVEAITLTHVAREMTPDLCVKSAPKNFDVYGL-RSENSKRELLGQWSYDNAANKRTQSYSVRSDTFFRNLDFSFNSNHG-ANSTCIYRVEVYGRL 275          
BLAST of SUN domain-containing protein 2 vs. Ensembl Zebrafish
Match: si:dkey-92f12.2 (si:dkey-92f12.2 [Source:ZFIN;Acc:ZDB-GENE-091204-379])

HSP 1 Score: 168.703 bits (426), Expect = 1.325e-43
Identity = 90/204 (44.12%), Postives = 120/204 (58.82%), Query Frame = 2
Query: 2147 KKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTF-LVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            + + E L  E     +   +K++V  A+  Y AD +GLAD+ALES G SV+ TR S TY      LS    PL     S RT+IQP    G+CW+F GS G  VI LS+ + +  VTLEH+P  L   G++ SAPK F +Y +  N  E  +L+GTF Y QDG  IQTF L     V  +V+  VLSN G++++TCVYR R+HG
Sbjct:  370 RTVGETLQQEGAGAATIQDVKEIVHRAISLYRADGIGLADYALESSGASVLNTRCSETYKTRSACLSLFGIPLWYHSESPRTVIQPELYPGKCWAFRGSQGFLVISLSYPVAITHVTLEHIPKDLSPTGRLDSAPKDFSVYGV-SNETEDGKLLGTFIYDQDGEPIQTFKLPEVSDVYSMVELRVLSNWGHLEYTCVYRFRVHG 572          
BLAST of SUN domain-containing protein 2 vs. Ensembl Zebrafish
Match: zgc:152977 (zgc:152977 [Source:ZFIN;Acc:ZDB-GENE-060825-353])

HSP 1 Score: 169.474 bits (428), Expect = 1.043e-42
Identity = 84/191 (43.98%), Postives = 121/191 (63.35%), Query Frame = 2
Query: 2189 LSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            LSE  ++ +V  A++ YS D++G+ D+ALES GGS+I+TR S ++      LS    PL     S R +IQP    G CW+F GS G+ VI LS KI+  A TLEH+   L   G I SAP++F +Y L +  QE+ +L+G + Y +DG ++QTFLV+    +  +I++  VLSN GN ++TCVYR R+HG
Sbjct:  647 LSEEHVQLIVTNAIKLYSEDRIGMVDYALESGGGSIISTRCSESFNTKTALLSLFGLPLWYFSQSPRVVIQPEVHPGNCWAFKGSTGYIVIGLSMKIVPTAFTLEHVAKSLSPTGNISSAPREFNVYGLDDEQQEEGQLLGQYVYEEDGDSLQTFLVSDEVSSGFQIIEMRVLSNWGNPEYTCVYRFRVHG 837          
BLAST of SUN domain-containing protein 2 vs. Ensembl Zebrafish
Match: sun1 (Sad1 and UNC84 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050522-551])

HSP 1 Score: 162.54 bits (410), Expect = 8.292e-42
Identity = 79/191 (41.36%), Postives = 119/191 (62.30%), Query Frame = 2
Query: 2189 LSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVT--TPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            +SE +++ +V+ A++ YS D+ G  D+ALES GGSV++TR S TY      +S    PL     S R +IQP    G CW+F GS G+ VI+LS ++I N   LEH+P  L   G I SAP++F +Y L +  Q++ +L+G + Y +DG ++Q F V     K  +I++  VLSN G+ ++TC+YR R+HG
Sbjct:  340 MSEEQVQLIVQRALKLYSEDRTGQVDYALESGGGSVLSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDMYPGNCWAFKGSQGYLVIRLSLRVIPNGFCLEHIPKSLSPSGNISSAPRRFSVYGLDDEYQDEGKLLGDYTYQEDGDSLQNFPVMEENDKAFQIIEMRVLSNWGHPEYTCLYRFRVHG 530          
BLAST of SUN domain-containing protein 2 vs. Ensembl Zebrafish
Match: sun1 (Sad1 and UNC84 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050522-551])

HSP 1 Score: 163.31 bits (412), Expect = 9.597e-41
Identity = 79/191 (41.36%), Postives = 119/191 (62.30%), Query Frame = 2
Query: 2189 LSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVT--TPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            +SE +++ +V+ A++ YS D+ G  D+ALES GGSV++TR S TY      +S    PL     S R +IQP    G CW+F GS G+ VI+LS ++I N   LEH+P  L   G I SAP++F +Y L +  Q++ +L+G + Y +DG ++Q F V     K  +I++  VLSN G+ ++TC+YR R+HG
Sbjct:  664 MSEEQVQLIVQRALKLYSEDRTGQVDYALESGGGSVLSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDMYPGNCWAFKGSQGYLVIRLSLRVIPNGFCLEHIPKSLSPSGNISSAPRRFSVYGLDDEYQDEGKLLGDYTYQEDGDSLQNFPVMEENDKAFQIIEMRVLSNWGHPEYTCLYRFRVHG 854          
BLAST of SUN domain-containing protein 2 vs. Ensembl Zebrafish
Match: sun1 (Sad1 and UNC84 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050522-551])

HSP 1 Score: 163.31 bits (412), Expect = 9.599e-41
Identity = 79/191 (41.36%), Postives = 119/191 (62.30%), Query Frame = 2
Query: 2189 LSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVT--TPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            +SE +++ +V+ A++ YS D+ G  D+ALES GGSV++TR S TY      +S    PL     S R +IQP    G CW+F GS G+ VI+LS ++I N   LEH+P  L   G I SAP++F +Y L +  Q++ +L+G + Y +DG ++Q F V     K  +I++  VLSN G+ ++TC+YR R+HG
Sbjct:  654 MSEEQVQLIVQRALKLYSEDRTGQVDYALESGGGSVLSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDMYPGNCWAFKGSQGYLVIRLSLRVIPNGFCLEHIPKSLSPSGNISSAPRRFSVYGLDDEYQDEGKLLGDYTYQEDGDSLQNFPVMEENDKAFQIIEMRVLSNWGHPEYTCLYRFRVHG 844          
BLAST of SUN domain-containing protein 2 vs. Ensembl Xenopus
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:NCBI gene;Acc:100494901])

HSP 1 Score: 156.762 bits (395), Expect = 7.353e-41
Identity = 85/219 (38.81%), Postives = 125/219 (57.08%), Query Frame = 2
Query: 2105 STEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            +TE+  N  A  A+  +   L       ++  ++ ++V  A++ YS D++G+ D+ALES G SVI TR S T+      LS    PL     S R I+QP    G CW+F GS G+AVI+LS  I   AVT++H+P  L     I SAPK F +Y L E SQ++  L+G F Y+Q G  IQTF +    +   ++V+  + SN G+ ++TC+YR R+HG
Sbjct:  163 ATER--NEWAARAHTSVDRELQAGGLSGITREEVHEIVNRAIQTYSEDRIGMVDYALESSGASVINTRCSETFETKTALLSLFGVPLWYQSQSPRVILQPDLNPGNCWAFRGSQGYAVIRLSSPIHPTAVTIDHIPRSLSPKATISSAPKDFSVYGLEEESQKEGLLLGNFTYNQYGKPIQTFSIQGGDIPTYQLVELRIQSNWGHPEYTCIYRFRVHG 379          
BLAST of SUN domain-containing protein 2 vs. Ensembl Xenopus
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:NCBI gene;Acc:100494901])

HSP 1 Score: 156.377 bits (394), Expect = 2.076e-40
Identity = 85/219 (38.81%), Postives = 125/219 (57.08%), Query Frame = 2
Query: 2105 STEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            +TE+  N  A  A+  +   L       ++  ++ ++V  A++ YS D++G+ D+ALES G SVI TR S T+      LS    PL     S R I+QP    G CW+F GS G+AVI+LS  I   AVT++H+P  L     I SAPK F +Y L E SQ++  L+G F Y+Q G  IQTF +    +   ++V+  + SN G+ ++TC+YR R+HG
Sbjct:  210 ATER--NEWAARAHTSVDRELQAGGLSGITREEVHEIVNRAIQTYSEDRIGMVDYALESSGASVINTRCSETFETKTALLSLFGVPLWYQSQSPRVILQPDLNPGNCWAFRGSQGYAVIRLSSPIHPTAVTIDHIPRSLSPKATISSAPKDFSVYGLEEESQKEGLLLGNFTYNQYGKPIQTFSIQGGDIPTYQLVELRIQSNWGHPEYTCIYRFRVHG 426          
BLAST of SUN domain-containing protein 2 vs. Ensembl Xenopus
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:NCBI gene;Acc:100494901])

HSP 1 Score: 155.992 bits (393), Expect = 5.014e-40
Identity = 85/219 (38.81%), Postives = 125/219 (57.08%), Query Frame = 2
Query: 2105 STEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            +TE+  N  A  A+  +   L       ++  ++ ++V  A++ YS D++G+ D+ALES G SVI TR S T+      LS    PL     S R I+QP    G CW+F GS G+AVI+LS  I   AVT++H+P  L     I SAPK F +Y L E SQ++  L+G F Y+Q G  IQTF +    +   ++V+  + SN G+ ++TC+YR R+HG
Sbjct:  233 ATER--NEWAARAHTSVDRELQAGGLSGITREEVHEIVNRAIQTYSEDRIGMVDYALESSGASVINTRCSETFETKTALLSLFGVPLWYQSQSPRVILQPDLNPGNCWAFRGSQGYAVIRLSSPIHPTAVTIDHIPRSLSPKATISSAPKDFSVYGLEEESQKEGLLLGNFTYNQYGKPIQTFSIQGGDIPTYQLVELRIQSNWGHPEYTCIYRFRVHG 449          
BLAST of SUN domain-containing protein 2 vs. Ensembl Xenopus
Match: SUN2 (Sad1 and UNC84 domain containing 2 [Source:NCBI gene;Acc:100494901])

HSP 1 Score: 158.303 bits (399), Expect = 2.092e-39
Identity = 83/213 (38.97%), Postives = 121/213 (56.81%), Query Frame = 2
Query: 2123 NYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            N  A  A+  +   L       ++  ++ ++V  A++ YS D++G+ D+ALES G SVI TR S T+      LS    PL     S R I+QP    G CW+F GS G+AVI+LS  I   AVT++H+P  L     I SAPK F +Y L E SQ++  L+G F Y+Q G  IQTF +    +   ++V+  + SN G+ ++TC+YR R+HG
Sbjct:  491 NEWAARAHTSVDRELQAGGLSGITREEVHEIVNRAIQTYSEDRIGMVDYALESSGASVINTRCSETFETKTALLSLFGVPLWYQSQSPRVILQPDLNPGNCWAFRGSQGYAVIRLSSPIHPTAVTIDHIPRSLSPKATISSAPKDFSVYGLEEESQKEGLLLGNFTYNQYGKPIQTFSIQGGDIPTYQLVELRIQSNWGHPEYTCIYRFRVHG 703          
BLAST of SUN domain-containing protein 2 vs. Ensembl Xenopus
Match: SUN1 (Sad1 and UNC84 domain containing 1 [Source:NCBI gene;Acc:100137098])

HSP 1 Score: 148.288 bits (373), Expect = 8.203e-36
Identity = 76/191 (39.79%), Postives = 109/191 (57.07%), Query Frame = 2
Query: 2189 LSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTP--KVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            +S+ + + M+  A+  YS D+ G+ADFALES GGS++ TR S TY      +S    PL     S R +IQP    G CW+F G+ G+ V++LS  I   A ++EH+P  L   G I SAPK F +Y L +  QE  +++    Y Q+G  +Q F +     K  +IV+  + SN G+ DFTC+YR R HG
Sbjct:  679 ISKQETQAMINNALRLYSQDRTGMADFALESGGGSILGTRCSETYGTKTALMSLFGIPLWYFSQSPRVVIQPDMYPGNCWAFKGTQGYLVVRLSRMIYPTAFSIEHIPKSLSPLGNITSAPKDFAVYGLDDEYQEDGQVLIRAVYDQEGEPLQIFHIMEEYKKPFQIVELRIFSNWGHQDFTCLYRFRAHG 869          
BLAST of SUN domain-containing protein 2 vs. Ensembl Mouse
Match: Sun2 (Sad1 and UNC84 domain containing 2 [Source:MGI Symbol;Acc:MGI:2443011])

HSP 1 Score: 176.792 bits (447), Expect = 1.595e-45
Identity = 89/211 (42.18%), Postives = 128/211 (60.66%), Query Frame = 2
Query: 2129 SAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            SA  A   + + L  E    ++E ++ ++VK A+++YS D++G+ D+ALES G SVI+TR S TY      LS    PL     S R I+QP    G CW+F G  G AV++LS +I   AVTLEH+P  L  +  I SAPK F I+   E+ Q++  L+GTF Y QDG  IQTF     K+A  ++V+  +L+N G+ ++TC+YR R+HG
Sbjct:  485 SAREAAASLGQILQKEGIVGVTEEQVHRIVKQALQRYSEDRIGMVDYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGTFAYDQDGEPIQTFYFQASKMATYQVVELRILTNWGHPEYTCIYRFRVHG 695          
BLAST of SUN domain-containing protein 2 vs. Ensembl Mouse
Match: Sun2 (Sad1 and UNC84 domain containing 2 [Source:MGI Symbol;Acc:MGI:2443011])

HSP 1 Score: 176.407 bits (446), Expect = 2.342e-45
Identity = 89/211 (42.18%), Postives = 128/211 (60.66%), Query Frame = 2
Query: 2129 SAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            SA  A   + + L  E    ++E ++ ++VK A+++YS D++G+ D+ALES G SVI+TR S TY      LS    PL     S R I+QP    G CW+F G  G AV++LS +I   AVTLEH+P  L  +  I SAPK F I+   E+ Q++  L+GTF Y QDG  IQTF     K+A  ++V+  +L+N G+ ++TC+YR R+HG
Sbjct:  515 SAREAAASLGQILQKEGIVGVTEEQVHRIVKQALQRYSEDRIGMVDYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGTFAYDQDGEPIQTFYFQASKMATYQVVELRILTNWGHPEYTCIYRFRVHG 725          
BLAST of SUN domain-containing protein 2 vs. Ensembl Mouse
Match: Sun2 (Sad1 and UNC84 domain containing 2 [Source:MGI Symbol;Acc:MGI:2443011])

HSP 1 Score: 176.407 bits (446), Expect = 2.430e-45
Identity = 89/211 (42.18%), Postives = 128/211 (60.66%), Query Frame = 2
Query: 2129 SAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            SA  A   + + L  E    ++E ++ ++VK A+++YS D++G+ D+ALES G SVI+TR S TY      LS    PL     S R I+QP    G CW+F G  G AV++LS +I   AVTLEH+P  L  +  I SAPK F I+   E+ Q++  L+GTF Y QDG  IQTF     K+A  ++V+  +L+N G+ ++TC+YR R+HG
Sbjct:  517 SAREAAASLGQILQKEGIVGVTEEQVHRIVKQALQRYSEDRIGMVDYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGTFAYDQDGEPIQTFYFQASKMATYQVVELRILTNWGHPEYTCIYRFRVHG 727          
BLAST of SUN domain-containing protein 2 vs. Ensembl Mouse
Match: Sun1 (Sad1 and UNC84 domain containing 1 [Source:MGI Symbol;Acc:MGI:1924303])

HSP 1 Score: 157.147 bits (396), Expect = 5.926e-39
Identity = 81/191 (42.41%), Postives = 113/191 (59.16%), Query Frame = 2
Query: 2189 LSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTF--LVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            ++E +   +V  A++ YS DK G+ DFALES GGS+++TR S TY      LS    PL     S R +IQP    G CW+F GS G+ V++LS KI     T+EH+P  L   G I SAPK F +Y L    QE+ + +G F Y Q+G ++Q F  L    +  +IV+  VLSN G+ ++TC+YR R+HG
Sbjct:  563 ITEAQAHIIVNNALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALLSLFGVPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMKIYPTTFTMEHIPKTLSPTGNISSAPKDFAVYGLETEYQEEGQPLGRFTYDQEGDSLQMFHTLERPDQAFQIVELRVLSNWGHPEYTCLYRFRVHG 753          
BLAST of SUN domain-containing protein 2 vs. Ensembl Mouse
Match: Sun1 (Sad1 and UNC84 domain containing 1 [Source:MGI Symbol;Acc:MGI:1924303])

HSP 1 Score: 156.762 bits (395), Expect = 8.863e-39
Identity = 81/191 (42.41%), Postives = 113/191 (59.16%), Query Frame = 2
Query: 2189 LSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTF--LVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            ++E +   +V  A++ YS DK G+ DFALES GGS+++TR S TY      LS    PL     S R +IQP    G CW+F GS G+ V++LS KI     T+EH+P  L   G I SAPK F +Y L    QE+ + +G F Y Q+G ++Q F  L    +  +IV+  VLSN G+ ++TC+YR R+HG
Sbjct:  596 ITEAQAHIIVNNALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALLSLFGVPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMKIYPTTFTMEHIPKTLSPTGNISSAPKDFAVYGLETEYQEEGQPLGRFTYDQEGDSLQMFHTLERPDQAFQIVELRVLSNWGHPEYTCLYRFRVHG 786          
BLAST of SUN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q8BJS4|SUN2_MOUSE (SUN domain-containing protein 2 OS=Mus musculus OX=10090 GN=Sun2 PE=1 SV=3)

HSP 1 Score: 176.407 bits (446), Expect = 1.700e-44
Identity = 89/211 (42.18%), Postives = 128/211 (60.66%), Query Frame = 2
Query: 2129 SAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            SA  A   + + L  E    ++E ++ ++VK A+++YS D++G+ D+ALES G SVI+TR S TY      LS    PL     S R I+QP    G CW+F G  G AV++LS +I   AVTLEH+P  L  +  I SAPK F I+   E+ Q++  L+GTF Y QDG  IQTF     K+A  ++V+  +L+N G+ ++TC+YR R+HG
Sbjct:  517 SAREAAASLGQILQKEGIVGVTEEQVHRIVKQALQRYSEDRIGMVDYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGTFAYDQDGEPIQTFYFQASKMATYQVVELRILTNWGHPEYTCIYRFRVHG 727          
BLAST of SUN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q9UH99|SUN2_HUMAN (SUN domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUN2 PE=1 SV=3)

HSP 1 Score: 176.022 bits (445), Expect = 2.361e-44
Identity = 92/223 (41.26%), Postives = 130/223 (58.30%), Query Frame = 2
Query: 2114 KLLNYSAFCANKKIKE-------NLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            K+L + A    K  +E        L  E    ++E ++  +VK A+++YS D++GLAD+ALES G SVI+TR S TY      LS    PL     S R I+QP    G CW+F G  G AV++LS +I   AVTLEH+P  L  +  I SAPK F I+   E+ Q++  L+G F Y QDG  IQTF    P +A  ++V+  +L+N G+ ++TC+YR R+HG
Sbjct:  491 KILTHVAEMQGKSAREAAASLSLTLQKEGVIGVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHG 713          
BLAST of SUN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|O94901|SUN1_HUMAN (SUN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUN1 PE=1 SV=3)

HSP 1 Score: 157.147 bits (396), Expect = 6.064e-38
Identity = 82/207 (39.61%), Postives = 119/207 (57.49%), Query Frame = 2
Query: 2144 NKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTF-LVTTP--KVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            ++ +   +S      ++E + + +V  A++ YS DK G+ DFALES GGS+++TR S TY      +S    PL     S R +IQP    G CW+F GS G+ V++LS  I   A TLEH+P  L   G I SAPK F +Y L    QE+ +L+G F Y QDG ++Q F  +  P     +IV+  + SN G+ ++TC+YR R+HG
Sbjct:  602 SEAVVSAVSEAGASGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHG 808          
BLAST of SUN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q9D666|SUN1_MOUSE (SUN domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sun1 PE=1 SV=2)

HSP 1 Score: 156.377 bits (394), Expect = 1.337e-37
Identity = 81/191 (42.41%), Postives = 113/191 (59.16%), Query Frame = 2
Query: 2189 LSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTF--LVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            ++E +   +V  A++ YS DK G+ DFALES GGS+++TR S TY      LS    PL     S R +IQP    G CW+F GS G+ V++LS KI     T+EH+P  L   G I SAPK F +Y L    QE+ + +G F Y Q+G ++Q F  L    +  +IV+  VLSN G+ ++TC+YR R+HG
Sbjct:  719 ITEAQAHIIVNNALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALLSLFGVPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMKIYPTTFTMEHIPKTLSPTGNISSAPKDFAVYGLETEYQEEGQPLGRFTYDQEGDSLQMFHTLERPDQAFQIVELRVLSNWGHPEYTCLYRFRVHG 909          
BLAST of SUN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q0II64|SUN3_BOVIN (SUN domain-containing protein 3 OS=Bos taurus OX=9913 GN=SUN3 PE=2 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 5.598e-33
Identity = 79/229 (34.50%), Postives = 125/229 (54.59%), Query Frame = 2
Query: 2102 DSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYI---------GIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVT--TPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            D  + L NYS    N  I         E + E ++  +V   ++K   D+V +AD+AL+S G SV+   +S +Y          GI GFL++ + P          I+QP    G+CW+F GS GHA+I+L+ KII  AVT+EH+  ++   G I SAPK+F +Y + +  + +   +G F Y++ G  +QTF +    P+    V+  +LSN G+ ++TC+YR R+HG
Sbjct:  139 DMQDGLHNYSW---NADIDPAEGWNHTEVIDE-EMSNLVNYILKKLREDQVQMADYALKSAGASVVEAGTSESYKNNKAKLYWHGI-GFLNYEMPP--------DIILQPDVHPGKCWAFPGSQGHALIKLARKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGVLKQCEGEEIFLGQFVYNKTGTTVQTFALQHEVPEFLLCVKLKILSNWGHPNYTCLYRFRVHG 354          
BLAST of SUN domain-containing protein 2 vs. TrEMBL
Match: A0A4E0QYL7 (SUN domain-containing protein 2 OS=Fasciola hepatica OX=6192 GN=D915_009043 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 4.256e-45
Identity = 88/189 (46.56%), Postives = 127/189 (67.20%), Query Frame = 2
Query: 2204 IKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLV---TTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGIL 2761
            I+ ++ +A+++++AD+ G+ADFALES GG+V+ TR + TY       S    PL R  +S RTI+QPGN  GECW F GS G AVI+LS  ++++AV+LEHLP  L  + ++ SAPK F I  L     E+  ++G F Y+ +GP+IQTF V   T P+  + ++F VLSNHG+  +TCVYRLR+HG +
Sbjct:  584 IQSLIDVALQRFAADRTGMADFALESAGGAVVGTRCTKTYTDGSALFSIFGIPLARLSNSPRTILQPGNNPGECWPFHGSTGQAVIRLSAPVLISAVSLEHLPRSLAPNERLDSAPKDFIIKGLDSEDDEEGIILGNFTYNINGPSIQTFSVHNQTEPR--QYIEFAVLSNHGHPLYTCVYRLRVHGTM 770          
BLAST of SUN domain-containing protein 2 vs. TrEMBL
Match: A0A504Y825 (SUN domain-containing protein 2 OS=Fasciola gigantica OX=46835 GN=FGIG_05680 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 2.177e-44
Identity = 88/189 (46.56%), Postives = 127/189 (67.20%), Query Frame = 2
Query: 2204 IKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLV---TTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGIL 2761
            I+ ++ +A+++++AD+ G+ADFALES GG+V+ TR + TY       S    PL R  +S RTI+QPGN  GECW F GS G AVI+LS  ++++AV+LEHLP  L  + ++ SAPK F I  L     E+  ++G F Y+ +GP+IQTF V   T P+  + ++F VLSNHG+  +TCVYRLR+HG +
Sbjct:  958 IQSLIDVALQRFAADRTGMADFALESAGGAVVGTRCTKTYTDGSALFSIFGIPLARLSNSPRTILQPGNNPGECWPFHGSTGQAVIRLSAPVLISAVSLEHLPRSLAPNERLDSAPKDFIIKGLDSEDDEEGIILGNFTYNINGPSIQTFSVHNQTEPR--QYIEFAVLSNHGHPLYTCVYRLRVHGTM 1144          
BLAST of SUN domain-containing protein 2 vs. TrEMBL
Match: H0V6Q8 (Sad1 and UNC84 domain containing 2 OS=Cavia porcellus OX=10141 GN=SUN2 PE=4 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 2.257e-44
Identity = 92/216 (42.59%), Postives = 132/216 (61.11%), Query Frame = 2
Query: 2114 KLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            K+   SA  A   + + L  E    ++E ++ ++VK A+++YS D++G+ D+ALES G SVI+TR S TY      LS    PL     S R I+QP    G CW+F G  G AV++LS +I   AVTLEH+P  L  +  I SAPK F I+   E+ Q++  L+GTF Y QDG  IQTF   TPK+A  ++V+  +L+N G+ ++TC+YR R+HG
Sbjct:  508 KMQGRSAQEAAALLGQTLQKEGVVGVTEEQVHRIVKQALQRYSEDRIGMVDYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFSIFGFDEDLQQEGSLLGTFTYDQDGEPIQTFYFQTPKMATYQVVELRILTNWGHPEYTCIYRFRVHG 723          
BLAST of SUN domain-containing protein 2 vs. TrEMBL
Match: Q6NT72 (UNC84B protein (Fragment) OS=Homo sapiens OX=9606 GN=UNC84B PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 3.066e-44
Identity = 92/223 (41.26%), Postives = 130/223 (58.30%), Query Frame = 2
Query: 2114 KLLNYSAFCANKKIKE-------NLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            K+L + A    K  +E        L  E    ++E ++  +VK A+++YS D++GLAD+ALES G SVI+TR S TY      LS    PL     S R I+QP    G CW+F G  G AV++LS +I   AVTLEH+P  L  +  I SAPK F I+   E+ Q++  L+G F Y QDG  IQTF    P +A  ++V+  +L+N G+ ++TC+YR R+HG
Sbjct:  216 KILTHVAEMQGKSAREAAASLSLTLQKEGVIGVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHG 438          
BLAST of SUN domain-containing protein 2 vs. TrEMBL
Match: A0A091E028 (SUN domain-containing protein 2 OS=Fukomys damarensis OX=885580 GN=H920_01898 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 8.716e-44
Identity = 91/211 (43.13%), Postives = 129/211 (61.14%), Query Frame = 2
Query: 2129 SAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVA--RIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            SA  A   +   L  E    ++E +++++VK A+++YS D++G+ D+ALES G SVI+TR S TY      LS    PL     S R I+QP    G CW+F G  G AV++LS +I   AVTLEH+P  L  +  I SAPK F I+   E+ Q++  L+GTF Y QDG  IQTF   TPK+A   +V+  +L+N G+ ++TC+YR R+HG
Sbjct:  513 SAREAAALLGRTLQKEGVVGVTEEQVQRIVKQALQRYSEDRIGMVDYALESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFSIFGFDEDLQQEGTLLGTFTYDQDGEPIQTFYFQTPKMADYHVVELRILTNWGHPEYTCIYRFRVHG 723          
BLAST of SUN domain-containing protein 2 vs. Ensembl Cavefish
Match: zgc:152977 (zgc:152977 [Source:ZFIN;Acc:ZDB-GENE-060825-353])

HSP 1 Score: 177.178 bits (448), Expect = 2.604e-45
Identity = 87/207 (42.03%), Postives = 128/207 (61.84%), Query Frame = 2
Query: 2138 CANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVT-TPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            CA    K  L    +  LSET+++ +V+ A++ YS D++GL D+ALES GGSV++TR S TY      +S    PL     S R +IQP    G CW+F GS G+ VI+LS KI+  A ++EH+P  L   G I SAP+ F +Y L +  QE+ +++G + Y +DG  +QT+ VT   K  +I++  VLSN G+ ++TC+YR R+HG
Sbjct:  624 CAETVTKAVLKTTGDAGLSETQVQLIVQNALKLYSQDRIGLVDYALESGGGSVLSTRCSETYETKTALMSLFGLPLWYFSQSPRAVIQPDVHPGNCWAFRGSHGYLVIRLSMKIVPTAFSVEHIPKTLSPTGNISSAPRNFTVYGLEDEQQEEGQILGRYVYQEDGEPLQTYHVTDNTKAYQIIELRVLSNWGHPEYTCLYRFRVHG 830          
BLAST of SUN domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000054157.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:12811942:12822292:-1 gene:ENSAMXG00000039800.1 transcript:ENSAMXT00000054157.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.147 bits (396), Expect = 3.341e-41
Identity = 84/203 (41.38%), Postives = 118/203 (58.13%), Query Frame = 2
Query: 2153 IKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTF--LVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            + E L  E+   L+   +K++V  A+  + AD  G+AD+ALES G  VI +R S +Y G     S    PL  + +S RT+IQP    G+CW+F GS G   I LS  + +  VTLEHLP  L   G I SAPK F +Y +  +  E  +L+G F Y Q+G  IQTF   V+  +V  +V+  +LSN GN ++TC+YR R+HG
Sbjct:  179 VGETLQEEEVRALTIKDVKQIVHRALSVFRADGTGMADYALESSGACVINSRCSESYHGQIACFSIFGIPLFYNTNSPRTVIQPELYPGKCWAFRGSEGFLTISLSSPVKITHVTLEHLPRVLSPTGHINSAPKDFAVYGM-TDENEGGKLLGRFTYDQEGEPIQTFKIPVSANEVYWLVELRILSNWGNPEYTCIYRFRVHG 380          
BLAST of SUN domain-containing protein 2 vs. Ensembl Cavefish
Match: si:dkey-92f12.2 (si:dkey-92f12.2 [Source:ZFIN;Acc:ZDB-GENE-091204-379])

HSP 1 Score: 156.762 bits (395), Expect = 8.201e-40
Identity = 84/186 (45.16%), Postives = 115/186 (61.83%), Query Frame = 2
Query: 2204 IKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTF-LVTTP-KVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            ++++V  A+  Y AD VG+AD+ALES G SVI TR S T+      LS    PL     S RT+ QP    G+CW+F GS G  VI LS+ + +  V+LEH+P  L   G+I SAPK F +Y +     E  EL+ TF Y+QDG  IQTF L  +P +V ++V+  +LSN G+ ++TCVYR R+HG
Sbjct:  361 VERIVNRALSLYRADGVGMADYALESSGASVINTRCSETFHTKTACLSLFGIPLWYQSESPRTVTQPELYPGKCWAFRGSEGFLVIALSYPVRMTHVSLEHVPRSLSPTGRIDSAPKDFAVYGMTGEDAE-GELLATFTYNQDGEPIQTFKLPDSPTEVYQLVELRILSNWGHPEYTCVYRFRVHG 545          
BLAST of SUN domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009801.1 (pep scaffold:Pmarinus_7.0:GL477354:48090:51409:-1 gene:ENSPMAG00000008863.1 transcript:ENSPMAT00000009801.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.673 bits (374), Expect = 4.157e-41
Identity = 77/188 (40.96%), Postives = 109/188 (57.98%), Query Frame = 2
Query: 2201 KIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVAR---IVQFDVLSNHGNIDFTCVYRLRIHG 2755
            ++  +V+ A+  Y  DK+G  DFALES GG+VI+ R S  Y      ++    PL  +  S R IIQP    G+CW+F GS G+  I+LS  I  +  TLEH+P  L   G I SAPK F +Y L E  Q++  L+G + Y + G  +Q F ++   VA    IV+  +LSN GN ++TC+YR R+HG
Sbjct:   15 EVYAIVQSALRLYEEDKIGKFDFALESAGGTVISVRCSEAYSQQIALITLFGVPLWYTSQSPRVIIQPDVYPGDCWAFKGSRGYVAIKLSDTIYPSDFTLEHIPRALSPTGDITSAPKDFAVYGLDEEIQQEGYLLGQYIYDKHGDPLQMFHMSNSTVAHPFGIVELRILSNWGNSEYTCIYRFRVHG 202          
BLAST of SUN domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO40082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8D4])

HSP 1 Score: 147.517 bits (371), Expect = 1.767e-40
Identity = 83/199 (41.71%), Postives = 121/199 (60.80%), Query Frame = 2
Query: 2195 ETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTY-----IGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSD--GKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLV-TTPK--VARIVQFDVLSNHGNIDFTCVYRLRIHGIL 2761
            E  ++  ++ A++KYSADK+G+ D+ALES GG++     S T+      G +G LSF  + +     S R IIQP N+ G+CW+F G  G+ VI+LS  II    TLEH+P+ L ++  GKI +APK F ++   +    +  ++G F Y ++G ++QTF V  TP   V R V+  VLSNHG    TC+YRLR+HG L
Sbjct:    3 EKMLRDNMEAALDKYSADKLGIPDYALESDGGAIHFPHHSTTFNTGTERGWFG-LSFWYDTV-----SPRVIIQPDNKPGQCWAFQGQQGYVVIKLSRAIIPTMFTLEHIPSSLSTNGHGKIPTAPKDFSVWGWADPEGTEKVMLGNFTYKKEGKSLQTFQVKGTPSDAVFRYVELRVLSNHGQATHTCIYRLRVHGDL 195          
BLAST of SUN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000042946.1 (Sad1 and UNC84 domain containing 1 [Source:NCBI gene;Acc:101156977])

HSP 1 Score: 157.147 bits (396), Expect = 1.146e-38
Identity = 78/195 (40.00%), Postives = 120/195 (61.54%), Query Frame = 2
Query: 2177 DNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVT--TPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
             +E L+E ++K +V+ A++ +S D+ G  D+ALES GGS+++TR S TY      +S    PL     S R +IQP    G CW+F GS G+ VI+LS +I+  +  LEH+P  L   G I SAP+ F ++ L +  Q+K +L+G + Y ++G A+Q F V     K  +I++  VLSN G+ ++TC+YR R+HG
Sbjct:  869 SSEGLTEEQVKLIVQNALKLFSQDRTGQVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPGNCWAFKGSQGYLVIRLSLRILPTSFCLEHIPKSLSPTGNITSAPRNFTVFGLDDEYQDKGKLLGHYTYEENGEALQIFPVKEENDKTFQIIEVRVLSNWGHPEYTCLYRFRVHG 1063          
BLAST of SUN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000029699.1 (Sad1 and UNC84 domain containing 1 [Source:NCBI gene;Acc:101156977])

HSP 1 Score: 157.147 bits (396), Expect = 1.270e-38
Identity = 78/195 (40.00%), Postives = 120/195 (61.54%), Query Frame = 2
Query: 2177 DNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVT--TPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
             +E L+E ++K +V+ A++ +S D+ G  D+ALES GGS+++TR S TY      +S    PL     S R +IQP    G CW+F GS G+ VI+LS +I+  +  LEH+P  L   G I SAP+ F ++ L +  Q+K +L+G + Y ++G A+Q F V     K  +I++  VLSN G+ ++TC+YR R+HG
Sbjct:  808 SSEGLTEEQVKLIVQNALKLFSQDRTGQVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPGNCWAFKGSQGYLVIRLSLRILPTSFCLEHIPKSLSPTGNITSAPRNFTVFGLDDEYQDKGKLLGHYTYEENGEALQIFPVKEENDKTFQIIEVRVLSNWGHPEYTCLYRFRVHG 1002          
BLAST of SUN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000010709.2 (Sad1 and UNC84 domain containing 1 [Source:NCBI gene;Acc:101156977])

HSP 1 Score: 157.147 bits (396), Expect = 1.328e-38
Identity = 78/195 (40.00%), Postives = 120/195 (61.54%), Query Frame = 2
Query: 2177 DNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVT--TPKVARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
             +E L+E ++K +V+ A++ +S D+ G  D+ALES GGS+++TR S TY      +S    PL     S R +IQP    G CW+F GS G+ VI+LS +I+  +  LEH+P  L   G I SAP+ F ++ L +  Q+K +L+G + Y ++G A+Q F V     K  +I++  VLSN G+ ++TC+YR R+HG
Sbjct:  858 SSEGLTEEQVKLIVQNALKLFSQDRTGQVDYALESGGGSILSTRCSETYETKTALMSLFGLPLWYFSQSPRVVIQPDVYPGNCWAFKGSQGYLVIRLSLRILPTSFCLEHIPKSLSPTGNITSAPRNFTVFGLDDEYQDKGKLLGHYTYEENGEALQIFPVKEENDKTFQIIEVRVLSNWGHPEYTCLYRFRVHG 1052          
BLAST of SUN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000034186.1 (uncharacterized LOC101162344 [Source:NCBI gene;Acc:101162344])

HSP 1 Score: 143.665 bits (361), Expect = 3.530e-35
Identity = 81/175 (46.29%), Postives = 108/175 (61.71%), Query Frame = 2
Query: 2243 ADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQ--PGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPK--VARIVQFDVLSNHGNIDFTCVYRLRIHG 2755
            ADK  +ADFALE+ G SVI+TR S TY      L+    PL     S RT+IQ  P    G+CW+F G  G  VI LSH I ++ VTL+HLP      G+I SAPK FQ+Y + +N  E+  L+G F Y ++G + QTF +  P   V RIV+  VLSN G++++TC+YR R+HG
Sbjct:  455 ADK--MADFALETQGASVISTRCSETYRIRSACLTLFGFPLWYPSESPRTVIQGFPVLLPGKCWAFHGVQGTLVISLSHPIRISHVTLDHLPRYNAPTGRIDSAPKDFQVYGM-KNDTEEGMLLGAFTYDENGESSQTFELPNPSDVVYRIVELRVLSNWGHMEYTCLYRFRVHG 626          
BLAST of SUN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000020187.1 (SMESG000020187.1)

HSP 1 Score: 1686.77 bits (4367), Expect = 0.000e+0
Identity = 893/893 (100.00%), Postives = 893/893 (100.00%), Query Frame = 2
Query:  113 MENHINLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLGENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDEDGVIIDENLSNKCEYDLCKXXXXXXXXXXXXXXTFSCAYGKLKRYSWLGFHYAWNIILAIFSMIAFTINLPFILLRFLFFQITRYLNFLKFFLIPILLVKRXXXXXXXXXXWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVXXXXXXXXXXXXXXXXPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMXXXXXXXXXXXPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVXXXXXXXXXXXXGFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP 2791
            MENHINLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLGENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDEDGVIIDENLSNKCEYDLCKNNLNLNIDFNDNQNTFSCAYGKLKRYSWLGFHYAWNIILAIFSMIAFTINLPFILLRFLFFQITRYLNFLKFFLIPILLVKRFFSKIISFFKWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVLEKVIIDISIDIVKLEPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMKDLKDDLDKSKPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVKSQKSRQIIKSSGFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP
Sbjct:    1 MENHINLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLGENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDEDGVIIDENLSNKCEYDLCKNNLNLNIDFNDNQNTFSCAYGKLKRYSWLGFHYAWNIILAIFSMIAFTINLPFILLRFLFFQITRYLNFLKFFLIPILLVKRFFSKIISFFKWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVLEKVIIDISIDIVKLEPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMKDLKDDLDKSKPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVKSQKSRQIIKSSGFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP 893          
BLAST of SUN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000020187.1 (SMESG000020187.1)

HSP 1 Score: 1683.31 bits (4358), Expect = 0.000e+0
Identity = 893/899 (99.33%), Postives = 894/899 (99.44%), Query Frame = 2
Query:  101 RKYKMEN--HINLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLGENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDEDGVIIDENLSNKCEYDLCKXXXXXXXXXXXXXXTFSCAYGKLKRYSWLGFHYAWNIILAIFSMIAFTINLPFILLRFLFFQITRYLNFLKFFLIPILLVKRXXXXXXXXXXWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVXXXXXXXXXXXXXXXXPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMXXXXXXXXXXXPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVXXXXXXXXXXXXGFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP 2791
            RK  +EN   INLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLGENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDEDGVIIDENLSNKCEYDLCKNNLNLNIDFNDNQNTFSCAYGKLKRYSWLGFHYAWNIILAIFSMIAFTINLPFILLRFLFFQITRYLNFLKFFLIPILLVKRFFSKIISFFKWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVLEKVIIDISIDIVKLEPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMKDLKDDLDKSKPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVKSQKSRQIIKSSGFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP
Sbjct:   44 RKTLLENFLQINLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLGENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDEDGVIIDENLSNKCEYDLCKNNLNLNIDFNDNQNTFSCAYGKLKRYSWLGFHYAWNIILAIFSMIAFTINLPFILLRFLFFQITRYLNFLKFFLIPILLVKRFFSKIISFFKWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVLEKVIIDISIDIVKLEPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMKDLKDDLDKSKPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVKSQKSRQIIKSSGFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP 942          
BLAST of SUN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000020187.1 (SMESG000020187.1)

HSP 1 Score: 1629.77 bits (4219), Expect = 0.000e+0
Identity = 871/893 (97.54%), Postives = 871/893 (97.54%), Query Frame = 2
Query:  113 MENHINLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLGENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDEDGVIIDENLSNKCEYDLCKXXXXXXXXXXXXXXTFSCAYGKLKRYSWLGFHYAWNIILAIFSMIAFTINLPFILLRFLFFQITRYLNFLKFFLIPILLVKRXXXXXXXXXXWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVXXXXXXXXXXXXXXXXPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMXXXXXXXXXXXPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVXXXXXXXXXXXXGFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP 2791
            MENHINLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLGENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDEDGVIIDENLSNKCEYDLCKNNLNLNIDFNDNQNTFSCAYGKLKRYSWLGFHYAWNIILAIF                      RYLNFLKFFLIPILLVKRFFSKIISFFKWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVLEKVIIDISIDIVKLEPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMKDLKDDLDKSKPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVKSQKSRQIIKSSGFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP
Sbjct:    1 MENHINLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLGENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDEDGVIIDENLSNKCEYDLCKNNLNLNIDFNDNQNTFSCAYGKLKRYSWLGFHYAWNIILAIF----------------------RYLNFLKFFLIPILLVKRFFSKIISFFKWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVLEKVIIDISIDIVKLEPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMKDLKDDLDKSKPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVKSQKSRQIIKSSGFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP 871          
BLAST of SUN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000020187.1 (SMESG000020187.1)

HSP 1 Score: 1624.76 bits (4206), Expect = 0.000e+0
Identity = 871/899 (96.89%), Postives = 872/899 (97.00%), Query Frame = 2
Query:  101 RKYKMEN--HINLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLGENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDEDGVIIDENLSNKCEYDLCKXXXXXXXXXXXXXXTFSCAYGKLKRYSWLGFHYAWNIILAIFSMIAFTINLPFILLRFLFFQITRYLNFLKFFLIPILLVKRXXXXXXXXXXWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVXXXXXXXXXXXXXXXXPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMXXXXXXXXXXXPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVXXXXXXXXXXXXGFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP 2791
            RK  +EN   INLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLGENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDEDGVIIDENLSNKCEYDLCKNNLNLNIDFNDNQNTFSCAYGKLKRYSWLGFHYAWNIILAIF                      RYLNFLKFFLIPILLVKRFFSKIISFFKWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVLEKVIIDISIDIVKLEPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMKDLKDDLDKSKPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVKSQKSRQIIKSSGFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP
Sbjct:   44 RKTLLENFLQINLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLGENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDEDGVIIDENLSNKCEYDLCKNNLNLNIDFNDNQNTFSCAYGKLKRYSWLGFHYAWNIILAIF----------------------RYLNFLKFFLIPILLVKRFFSKIISFFKWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVLEKVIIDISIDIVKLEPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMKDLKDDLDKSKPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVKSQKSRQIIKSSGFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKKMVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNPLGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLPARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVTTPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP 920          
BLAST of SUN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000001462.1 (SMESG000001462.1)

HSP 1 Score: 162.925 bits (411), Expect = 2.191e-41
Identity = 123/460 (26.74%), Postives = 239/460 (51.96%), Query Frame = 2
Query:  797 TKIHGINSNNNASDEFCEITKRSSFCLYAFCTAIVIG-CLF---IHCGINPESKVCTPNSIVKYIQLTLCDILNEIYILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDIGFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVXXXXXXXXXXXXXXXXPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMKNIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDSTFQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLLSDELRDHNKILQRTECLCNKQMXXXXXXXXXXXPEFTCFIKNMVDDEADKIHAHLQKEISETFYEKTTEISKAIAEDALNKYVXXXXXXXXXXXX-GFLTDFQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKE 2161
            T I   N+N N+S+        +S C+      +VIG CL    +HC +   SK+    S  +Y++       + I++LPGENCM+AG CC GFLE  FRW +C+ T PIR ILT W R+          ++ I++ +++I  ++ + K   N  +E+   ++  +  LE ++ + +  + KL P+++ L+  +Q  +  +   +  +  ++ +K+  +++++S++  + ++   +KS +  ++     +Q  L+++IE L++LL ++Q K      +   +IQ ++   K    EI+ +I+SL K   K K+ S++L  ++      E+  H ++ +RTE +C    + L +DL K+K    CFI   +  E++ ++  L+KEIS+  +++T E ++   + AL K  K++          G L+   K+     TC  D  E L++ S  C  ++ K+
Sbjct:  193 TNIFRGNNNFNSSE--------TSECITGGFICLVIGLCLIPVILHCSLYSTSKISEFQSNFQYVKSKFLKYSDLIFLLPGENCMRAGNCCKGFLEGVFRWSSCVGTSPIRLILTIWHRRNGNVMAKNSGLSRIQYHLERIYEDIDQTKEHINYLDELFFHIQTSIINLELIVNEKANFLEKLSPKIEKLAKVLQNFKSQVENSIISLKKVMNLKEETYKMIDSIRKDSEESLTHVKSSLGSMRHGNEAKQQRLITQIEILENLLKEDQMKTGGKNSRFIQRIQSEISSTKYVLQEIRKRISSLFKIQTKYKQTSDSLNKEIRNKFHGEMVHHEQMSKRTEKMCLSNAEKLNNDLIKAKNNLACFINKTIFGESNNMYIKLRKEISDVLHDQTVETAQMAVDQALIKKAKNEIRISRNIKKCGILSYLFKLNEKDQTCLKDE-ELLVDPSVLCGPEQSKD 643          
The following BLAST results are available for this feature:
BLAST of SUN domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SUN24.916e-4541.26Sad1 and UNC84 domain containing 2 [Source:HGNC Sy... [more]
SUN24.916e-4541.26Sad1 and UNC84 domain containing 2 [Source:HGNC Sy... [more]
SUN26.452e-4541.26Sad1 and UNC84 domain containing 2 [Source:HGNC Sy... [more]
SUN13.067e-3939.61Sad1 and UNC84 domain containing 1 [Source:HGNC Sy... [more]
SUN13.127e-3939.61Sad1 and UNC84 domain containing 1 [Source:HGNC Sy... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
unc-844.652e-2635.79Nuclear migration and anchoring protein unc-84 [S... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
koi1.698e-3535.94gene:FBgn0265003 transcript:FBtr0335513[more]
koi1.777e-3535.94gene:FBgn0265003 transcript:FBtr0335514[more]
koi1.777e-3535.94gene:FBgn0265003 transcript:FBtr0335512[more]
spag44.427e-1430.41gene:FBgn0032368 transcript:FBtr0340563[more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-92f12.21.325e-4344.12si:dkey-92f12.2 [Source:ZFIN;Acc:ZDB-GENE-091204-3... [more]
zgc:1529771.043e-4243.98zgc:152977 [Source:ZFIN;Acc:ZDB-GENE-060825-353][more]
sun18.292e-4241.36Sad1 and UNC84 domain containing 1 [Source:ZFIN;Ac... [more]
sun19.597e-4141.36Sad1 and UNC84 domain containing 1 [Source:ZFIN;Ac... [more]
sun19.599e-4141.36Sad1 and UNC84 domain containing 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SUN27.353e-4138.81Sad1 and UNC84 domain containing 2 [Source:NCBI ge... [more]
SUN22.076e-4038.81Sad1 and UNC84 domain containing 2 [Source:NCBI ge... [more]
SUN25.014e-4038.81Sad1 and UNC84 domain containing 2 [Source:NCBI ge... [more]
SUN22.092e-3938.97Sad1 and UNC84 domain containing 2 [Source:NCBI ge... [more]
SUN18.203e-3639.79Sad1 and UNC84 domain containing 1 [Source:NCBI ge... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sun21.595e-4542.18Sad1 and UNC84 domain containing 2 [Source:MGI Sym... [more]
Sun22.342e-4542.18Sad1 and UNC84 domain containing 2 [Source:MGI Sym... [more]
Sun22.430e-4542.18Sad1 and UNC84 domain containing 2 [Source:MGI Sym... [more]
Sun15.926e-3942.41Sad1 and UNC84 domain containing 1 [Source:MGI Sym... [more]
Sun18.863e-3942.41Sad1 and UNC84 domain containing 1 [Source:MGI Sym... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BJS4|SUN2_MOUSE1.700e-4442.18SUN domain-containing protein 2 OS=Mus musculus OX... [more]
sp|Q9UH99|SUN2_HUMAN2.361e-4441.26SUN domain-containing protein 2 OS=Homo sapiens OX... [more]
sp|O94901|SUN1_HUMAN6.064e-3839.61SUN domain-containing protein 1 OS=Homo sapiens OX... [more]
sp|Q9D666|SUN1_MOUSE1.337e-3742.41SUN domain-containing protein 1 OS=Mus musculus OX... [more]
sp|Q0II64|SUN3_BOVIN5.598e-3334.50SUN domain-containing protein 3 OS=Bos taurus OX=9... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0QYL74.256e-4546.56SUN domain-containing protein 2 OS=Fasciola hepati... [more]
A0A504Y8252.177e-4446.56SUN domain-containing protein 2 OS=Fasciola gigant... [more]
H0V6Q82.257e-4442.59Sad1 and UNC84 domain containing 2 OS=Cavia porcel... [more]
Q6NT723.066e-4441.26UNC84B protein (Fragment) OS=Homo sapiens OX=9606 ... [more]
A0A091E0288.716e-4443.13SUN domain-containing protein 2 OS=Fukomys damaren... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1529772.604e-4542.03zgc:152977 [Source:ZFIN;Acc:ZDB-GENE-060825-353][more]
ENSAMXT00000054157.13.341e-4141.38pep primary_assembly:Astyanax_mexicanus-2.0:14:128... [more]
si:dkey-92f12.28.201e-4045.16si:dkey-92f12.2 [Source:ZFIN;Acc:ZDB-GENE-091204-3... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009801.14.157e-4140.96pep scaffold:Pmarinus_7.0:GL477354:48090:51409:-1 ... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO400821.767e-4041.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000042946.11.146e-3840.00Sad1 and UNC84 domain containing 1 [Source:NCBI ge... [more]
ENSORLT00000029699.11.270e-3840.00Sad1 and UNC84 domain containing 1 [Source:NCBI ge... [more]
ENSORLT00000010709.21.328e-3840.00Sad1 and UNC84 domain containing 1 [Source:NCBI ge... [more]
ENSORLT00000034186.13.530e-3546.29uncharacterized LOC101162344 [Source:NCBI gene;Acc... [more]
back to top
BLAST of SUN domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020187.10.000e+0100.00SMESG000020187.1[more]
SMESG000020187.10.000e+099.33SMESG000020187.1[more]
SMESG000020187.10.000e+097.54SMESG000020187.1[more]
SMESG000020187.10.000e+096.89SMESG000020187.1[more]
SMESG000001462.12.191e-4126.74SMESG000001462.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019991 ID=SMED30019991|Name=SUN domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2971bp
CTTGATTAATTATATAAACATTCAATAATTAATGTAACTTATTAATAATA
AGAAGTAAAATTATAATCTTGGAATTTATTGATAAGATAGATTCAACTCA
AGAAAATATAAAATGGAAAATCATATAAACTTAAATGATATTTTAAAGAA
AAACCTTGTTGGATCCTTTAACGAAGATTTAAAATATTTAAATTCAAATT
CGAATAATTTTGCTGGACGAGAAACCAATGACATTTCGGACTGGGAGGAT
TTCAGTCTAGGAGAAAATGAAGGTGCTGCTGAATTAATAGACCGTCCACA
TTCCAGTGACGATATATTAGAAACTTCTAATATAAAATATCGAGGGAAAA
GGTTAGATGACACCGGGAGTGGTGGAGAAAATTTTGAAATCATGGTCTCG
GATGACGAAGATGGGGTAATCATTGACGAAAATTTATCCAACAAATGTGA
ATATGATTTATGCAAAAACAACCTGAATTTGAATATCGATTTCAATGACA
ATCAAAATACATTCTCATGTGCTTATGGGAAATTGAAACGATATTCATGG
CTAGGTTTTCACTACGCCTGGAATATTATCTTGGCAATATTTAGTATGAT
TGCATTTACTATAAACTTGCCATTCATATTGCTAAGATTTTTGTTTTTTC
AAATAACAAGATATCTGAATTTTTTGAAATTCTTTCTAATACCAATTTTG
TTAGTTAAAAGATTTTTCAGCAAAATAATTTCGTTCTTCAAATGGAAAGA
TACTAAAATACTTCAAAGTGAAGATTGTATATTAAATACTGAAGAAACTA
AGATTCATGGAATAAACTCAAATAACAATGCCAGTGACGAGTTTTGTGAA
ATAACAAAACGATCATCATTTTGCCTGTACGCATTTTGTACTGCTATAGT
AATTGGATGTCTTTTTATTCATTGTGGGATCAATCCGGAATCAAAAGTTT
GTACACCGAATTCAATAGTAAAATATATTCAATTGACGCTATGCGACATT
TTAAATGAAATTTATATTCTACCCGGAGAAAATTGCATGAAAGCCGGGAG
ATGTTGTAATGGGTTCCTTGAAGCAACATTTCGTTGGTTAAACTGTTTAC
TCACATTACCAATACGATCCATACTGACCGCATGGCCCCGTCAACCTGTT
CAAAAGGACATTGGGTTTGAAAATATGAATGACATAAAATTTCAAGTTAA
GAAAATTGTCGGAGAACTAACGAAAGCAAAGGGTCAAACAAATAAACAAG
AAGAAGTATTAATAAAATTGCGCCGTCAAGTCAGAGTTCTGGAGAAAGTT
ATTATTGACATATCCATAGATATTGTCAAATTGGAACCACAACTTAAATA
TTTATCAAGTGAAGTTCAGAGACTGAGACAGAATATTACATTCGGTATGA
ATGGGATGGCAAATATTATTACTATCAAGGATAATTACCATGAACTGATG
GAATCTATGAAAAACATAGCCAGTGATGCCACGAATTCCATCAAATCCTT
AATTTCAAAGGTCCAAATAAAAGTCAATGTCGAACAAAATCTCTTGGTTT
CACGAATAGAGTCACTCCAGTCTCTTCTCAGTGATAATCAAAACAAGGAA
ACCGATTCAACATTTCAGATCTTCAATAAGATTCAAGAAGATTTGGATTT
TTTAAAAATAAGTCAAGATGAAATTAAATCAAAAATTAATTCACTAGAAA
AGTTTTCTCATAAATCTAAGAAAATTTCAGAAACTTTAAAAACTGATGTT
AATAAACTGCTTAGTGATGAACTAAGGGACCACAATAAGATATTACAAAG
AACTGAATGCCTCTGCAATAAACAAATGAAAGATTTGAAGGATGACCTAG
ACAAATCTAAACCTGAATTCACTTGCTTCATTAAGAATATGGTTGATGAC
GAAGCTGATAAAATACATGCTCATTTACAAAAAGAAATCTCAGAAACATT
CTATGAAAAAACTACAGAAATTTCCAAAGCGATTGCCGAAGATGCCTTAA
ATAAATACGTGAAAAGTCAAAAAAGTCGACAAATAATAAAAAGTAGTGGA
TTTTTGACAGATTTTCAAAAGATTCAACCATTTCCATATACATGTCAATC
AGACAGCACCGAGAAATTGCTAAACTATTCCGCCTTTTGTGCCAACAAGA
AAATTAAAGAGAACTTATCGAATGAAGACAATGAGTGCTTGTCAGAAACC
AAGATTAAAAAAATGGTGAAAATTGCAATGGAAAAGTATTCGGCGGATAA
AGTCGGTCTAGCAGATTTTGCTTTAGAATCAATGGGAGGATCTGTGATAG
CGACGCGCAGCTCACCTACATATATCGGCATCTATGGCTTCCTTTCGTTC
TTGGTAAATCCGTTGGGACGATCATATAGTTCTTTAAGGACAATTATACA
GCCAGGAAATCAGCGGGGAGAATGTTGGTCGTTCGCTGGCTCTGTTGGCC
ACGCTGTGATACAGTTATCTCACAAAATTATTGTTAATGCTGTCACCCTT
GAACATTTGCCAGCTCGCTTGCACTCCGACGGAAAGATTTTATCTGCTCC
AAAGAAATTCCAAATTTATAGCTTGTTTGAAAATTCTCAAGAAAAATCTG
AACTAATTGGAACATTTGACTATTCACAAGACGGTCCAGCTATTCAAACA
TTTTTGGTTACTACACCGAAAGTAGCTCGAATCGTTCAATTTGATGTTCT
TAGTAATCATGGAAACATTGACTTCACGTGCGTCTATCGTCTGAGAATCC
ACGGAATTCTCTACAATGCAGGGGAGTCCTCCACACCGCCTTGATTAACA
AGAAATTTATTTTTCAAAATCTAATATATTTTACAAGTTTCAATAAGCTA
GATCTTATTTATTTATAAAAAAATATTTATTGACTTATCTTTATTTAGTA
AACAATAAAATATTATGTATGAGTTTCTTTTTTATTTCATACCAAGCAAG
GTTATTTTTATTCTTTAGAAG
back to top

protein sequence of SMED30019991-orf-1

>SMED30019991-orf-1 ID=SMED30019991-orf-1|Name=SMED30019991-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=894bp
MENHINLNDILKKNLVGSFNEDLKYLNSNSNNFAGRETNDISDWEDFSLG
ENEGAAELIDRPHSSDDILETSNIKYRGKRLDDTGSGGENFEIMVSDDED
GVIIDENLSNKCEYDLCKNNLNLNIDFNDNQNTFSCAYGKLKRYSWLGFH
YAWNIILAIFSMIAFTINLPFILLRFLFFQITRYLNFLKFFLIPILLVKR
FFSKIISFFKWKDTKILQSEDCILNTEETKIHGINSNNNASDEFCEITKR
SSFCLYAFCTAIVIGCLFIHCGINPESKVCTPNSIVKYIQLTLCDILNEI
YILPGENCMKAGRCCNGFLEATFRWLNCLLTLPIRSILTAWPRQPVQKDI
GFENMNDIKFQVKKIVGELTKAKGQTNKQEEVLIKLRRQVRVLEKVIIDI
SIDIVKLEPQLKYLSSEVQRLRQNITFGMNGMANIITIKDNYHELMESMK
NIASDATNSIKSLISKVQIKVNVEQNLLVSRIESLQSLLSDNQNKETDST
FQIFNKIQEDLDFLKISQDEIKSKINSLEKFSHKSKKISETLKTDVNKLL
SDELRDHNKILQRTECLCNKQMKDLKDDLDKSKPEFTCFIKNMVDDEADK
IHAHLQKEISETFYEKTTEISKAIAEDALNKYVKSQKSRQIIKSSGFLTD
FQKIQPFPYTCQSDSTEKLLNYSAFCANKKIKENLSNEDNECLSETKIKK
MVKIAMEKYSADKVGLADFALESMGGSVIATRSSPTYIGIYGFLSFLVNP
LGRSYSSLRTIIQPGNQRGECWSFAGSVGHAVIQLSHKIIVNAVTLEHLP
ARLHSDGKILSAPKKFQIYSLFENSQEKSELIGTFDYSQDGPAIQTFLVT
TPKVARIVQFDVLSNHGNIDFTCVYRLRIHGILYNAGESSTPP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002030early male germ cell
Vocabulary: INTERPRO
TermDefinition
IPR008979Galactose-bd-like_sf
IPR019774Aromatic-AA_hydroxylase_C
IPR012919SUN_dom
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012919SUN domainPFAMPF07738Sad1_UNCcoord: 756..881
e-value: 3.3E-34
score: 117.7
IPR012919SUN domainPROSITEPS51469SUNcoord: 725..884
score: 32.001
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 616..883
e-value: 8.3E-59
score: 200.5
NoneNo IPR availablePANTHERPTHR12911SAD1/UNC-84-LIKE PROTEIN-RELATEDcoord: 288..882
NoneNo IPR availableTMHMMTMhelixcoord: 252..274
NoneNo IPR availableTMHMMTMhelixcoord: 176..198
NoneNo IPR availableTMHMMTMhelixcoord: 150..172