Organic solute carrier partner 1

Overview
NameOrganic solute carrier partner 1
Smed IDSMED30019985
Length (bp)1286
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Organic solute carrier partner 1 (SMED30019985) t-SNE clustered cells

Violin plots show distribution of expression levels for Organic solute carrier partner 1 (SMED30019985) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Organic solute carrier partner 1 (SMED30019985) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Organic solute carrier partner 1 (SMED30019985) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019985

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019985SMESG000013444.1 SmedASXL_014442SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019985SMESG000013444.1 dd_Smed_v4_12742_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019985SMESG000013444.1 dd_Smed_v6_12742_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30019985SMESG000013444.1 dd_Smed_v4_12742_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Organic solute carrier partner 1 vs. Ensembl Human
Match: OSCP1 (organic solute carrier partner 1 [Source:HGNC Symbol;Acc:HGNC:29971])

HSP 1 Score: 264.233 bits (674), Expect = 2.536e-84
Identity = 153/386 (39.64%), Postives = 238/386 (61.66%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASG-KLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ-KVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENV-ALKEVMKEMHIDQSS--SNNNEFDLLELMDQ 1155
            M+  +LP+LFLN+GGEMLYI++QRL AQN+  D++ KV+++IISTMF   F++ LF PQ LYSKK+++ ++E LAH+SIMKLN ASM KLYDLMTMA KYQV      +++L VT NHL ++  +I+  P+I +  +  + +  +IY  L   ++  IR+ L+ F QD  IRVS+FLKD +Q  NG+F+  +SG +    E PG I+ ++  G ++KRI +F+    ++   K+ S    GDR  KLG NMY  N+ +ET     +KN A+ ++   ++  P+P +K +L+ L++L+     +        F+LNLF +++EE +AA   P    EE   +++ I A + ++    L  +M E  I +    S +   DLL +MD+
Sbjct:    1 MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSPTILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSMFLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFNNKGEEVKRI-EFKHGGNYVPAPKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLASWTQ---ESIAPNPLAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRP----EELSYEVINIQATQDQQRSEELARIMGEFEITEQPRLSTSKGDDLLAMMDE 378          
BLAST of Organic solute carrier partner 1 vs. Ensembl Human
Match: OSCP1 (organic solute carrier partner 1 [Source:HGNC Symbol;Acc:HGNC:29971])

HSP 1 Score: 255.758 bits (652), Expect = 6.714e-81
Identity = 153/396 (38.64%), Postives = 238/396 (60.10%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNK----------VMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASG-KLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ-KVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENV-ALKEVMKEMHIDQSS--SNNNEFDLLELMDQ 1155
            M+  +LP+LFLN+GGEMLYI++QRL AQN+  D++ K          V+++IISTMF   F++ LF PQ LYSKK+++ ++E LAH+SIMKLN ASM KLYDLMTMA KYQV      +++L VT NHL ++  +I+  P+I +  +  + +  +IY  L   ++  IR+ L+ F QD  IRVS+FLKD +Q  NG+F+  +SG +    E PG I+ ++  G ++KRI +F+    ++   K+ S    GDR  KLG NMY  N+ +ET     +KN A+ ++   ++  P+P +K +L+ L++L+     +        F+LNLF +++EE +AA   P    EE   +++ I A + ++    L  +M E  I +    S +   DLL +MD+
Sbjct:    1 MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSPTILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSMFLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFNNKGEEVKRI-EFKHGGNYVPAPKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLASWTQ---ESIAPNPLAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRP----EELSYEVINIQATQDQQRSEELARIMGEFEITEQPRLSTSKGDDLLAMMDE 388          
BLAST of Organic solute carrier partner 1 vs. Ensembl Human
Match: OSCP1 (organic solute carrier partner 1 [Source:HGNC Symbol;Acc:HGNC:29971])

HSP 1 Score: 206.453 bits (524), Expect = 1.957e-62
Identity = 126/341 (36.95%), Postives = 199/341 (58.36%), Query Frame = 1
Query:  160 MFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASG-KLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ-KVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENV-ALKEVMKEMHIDQSS--SNNNEFDLLELMDQ 1155
            MF   F++ LF PQ LYSKK+++ ++E LAH+SIMKLN ASM KLYDLMTMA KYQV      +++L VT NHL ++  +I+  P+I +  +  + +  +IY  L   ++  IR+ L+ F QD  IRVS+FLKD +Q  NG+F+  +SG +    E PG I+ ++  G ++KRI +F+    ++   K+ S    GDR  KLG NMY  N+ +ET     +KN A+ ++   ++  P+P +K +L+ L++L+     +        F+LNLF +++EE +AA   P    EE   +++ I A + ++    L  +M E  I +    S +   DLL +MD+
Sbjct:    1 MFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSPTILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSMFLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFNNKGEEVKRI-EFKHGGNYVPAPKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLASWTQ---ESIAPNPLAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRP----EELSYEVINIQATQDQQRSEELARIMGEFEITEQPRLSTSKGDDLLAMMDE 333          
BLAST of Organic solute carrier partner 1 vs. Ensembl Human
Match: OSCP1 (organic solute carrier partner 1 [Source:HGNC Symbol;Acc:HGNC:29971])

HSP 1 Score: 189.889 bits (481), Expect = 3.705e-57
Identity = 100/229 (43.67%), Postives = 148/229 (64.63%), Query Frame = 1
Query:  121 DRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASG-KLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ 804
            D++ KV+++IISTMF   F++ LF PQ LYSKK+++ ++E LAH+SIMKLN ASM KLYDLMTMA KYQV      +++L VT NHL ++  +I+  P+I +  +  + +  +IY  L   ++  IR+ L+ F QD  IRVS+FLKD +Q  NG+F+  +SG +    E PG I+ ++  G ++KRI +F+    ++   K+ S    GDR  KLG NMY  N+ +ET 
Sbjct:    3 DKARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSPTILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSMFLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFNNKGEEVKRI-EFKHGGNYVPAPKEGSFELYGDRVLKLGTNMYSVNQPVETH 230          
BLAST of Organic solute carrier partner 1 vs. Ensembl Human
Match: OSCP1 (organic solute carrier partner 1 [Source:HGNC Symbol;Acc:HGNC:29971])

HSP 1 Score: 171.785 bits (434), Expect = 1.504e-50
Identity = 87/178 (48.88%), Postives = 124/178 (69.66%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLK 558
            M+  +LP+LFLN+GGEMLYI++QRL AQN+  D++ KV+++IISTMF   F++ LF PQ LYSKK+++ ++E LAH+SIMKLN ASM KLYDLMTMA KYQV      +++L VT NHL ++  +I+  P+I +  +  + +  +IY  L   ++  IR+ L+ F QD  IR   F K
Sbjct:    1 MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSPTILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRRECFWK 178          
BLAST of Organic solute carrier partner 1 vs. Ensembl Celegans
Match: R10F2.5 (pep chromosome:WBcel235:III:2923662:2924758:-1 gene:WBGene00019996.1 transcript:R10F2.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R10F2.5)

HSP 1 Score: 130.954 bits (328), Expect = 1.361e-35
Identity = 65/192 (33.85%), Postives = 110/192 (57.29%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSID---RSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFI 591
            M+  + P L+LN+G EM+Y+++QRL  Q   ++   +S+KV+ EI+        +D +F      ++  +K  FE +AH SIM+LN  SM KL+DLM M+ K+ +       +++ +T+NHL ++ + + ++  I    E A +     Y PL P  W  +R  L+ F QD  ++VS+F+KD  Q  NG+F+
Sbjct:    1 MSSHAFPALYLNLGVEMMYVLDQRLRVQKERVEDREKSDKVVKEIMLGFLAKKTLDEVFKGHGTPTRVGLKMFFEKVAHCSIMRLNENSMDKLFDLMMMSYKFALMKMTMPEQIMTITVNHLRALLDLVPLDKDIGAAVEHAYTMAFTFYRPLGPMGWFMLRNSLLVFFQDTRVKVSMFIKDCRQLPNGRFV 192          
BLAST of Organic solute carrier partner 1 vs. Ensembl Fly
Match: OSCP1 (gene:FBgn0033685 transcript:FBtr0088019)

HSP 1 Score: 80.8777 bits (198), Expect = 1.241e-16
Identity = 51/180 (28.33%), Postives = 94/180 (52.22%), Query Frame = 1
Query:   73 MLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFT-----PQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKK--LWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFI 591
            MLY+I+QRL AQ ++ D+S +V+H++ S +    F+D+L          L + +  K +   +A  S+M+L+  SMSKL++LMTM  K+Q+  +R    LL +T  HL ++    ++ P  K+  L +   +  L  +        + I +    + Q  + ++S+ ++   Q  +G FI
Sbjct:    1 MLYVIDQRLKAQQIAQDKSVQVIHDVTSVLLEPKFIDSLLNGSKHNSAQLLTAEHCKFMLNDIATCSLMRLDEQSMSKLWNLMTMVYKWQLFVSRHQHHLLEITFRHLEAIN---RLYPDAKRHMLIDFTKNTLLDFWNASGEDAQLSIYQTNRAWLQCFNTKISLLIRMGFQAMDGSFI 177          
BLAST of Organic solute carrier partner 1 vs. Ensembl Zebrafish
Match: OSCP1 (organic solute carrier partner 1b [Source:NCBI gene;Acc:100334608])

HSP 1 Score: 265.003 bits (676), Expect = 1.092e-84
Identity = 149/386 (38.60%), Postives = 235/386 (60.88%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ-KVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKE-NVALKEVMKEM----HIDQSSSNNNEFDLLELMD 1152
            M+  +LP+LF+N+GGEMLYI++QRL AQN+  D++ KVM++II+TMF   F++ LF PQ LYSKK+++ +F+ LAH+SIM+LN ASM KLYDLMTMA KYQV      +++L V+ NH+ ++ +++K  PSI    +    + ++IY  L   ++  IR+ L+ F QD  IRVSIFLKD +Q  NG+F+   SG +    + PG I+ +  SG+  R  +F+    +    ++ S    GDR  KLG NMY  ++ +ET     +KN +  +K +     P+P +K +L+LL++L+     +    ++  F++NLF +++EE +A    P    +E   +++ I A K K+ N  L ++M E         SSS+  + DLL +MD
Sbjct:    1 MSTRTLPLLFINLGGEMLYILDQRLRAQNIPADKAKKVMNDIITTMFNKKFLEELFKPQELYSKKALRTVFDRLAHASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPKDILLVSFNHMDAIRDFVKDTPSILSQVDETNKQLIEIYTSLSGGEFQLIRQTLLIFFQDMHIRVSIFLKDKVQNSNGRFVLPTSGPVPFGTQTPGLIRIFSCSGEEVRRTQFRDGGNYHTALREGSFEMYGDRVIKLGTNMYSVSRPVETHMSGTSKNSSQHTKVN---TTPNPLAKEELNLLARLMGGLEVQKPPSTDSGFRVNLFATDEEEEEAFISRP----DELSYEVINIQATKDKQTNAELAKIMGEFGETGEASPSSSSKGD-DLLAMMD 378          
BLAST of Organic solute carrier partner 1 vs. Ensembl Zebrafish
Match: oscp1a (organic solute carrier partner 1a [Source:ZFIN;Acc:ZDB-GENE-080204-2])

HSP 1 Score: 207.223 bits (526), Expect = 2.317e-62
Identity = 132/398 (33.17%), Postives = 213/398 (53.52%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNK----------VMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS--RNKDVSNKN--FKLNLFQSEQEESKAAT-------GSPVVVFEEPENKIVMIDARKIKENVALKEVMKEMHIDQSSSNNNEFDLLELMDQ 1155
            M+Q +LP+L +N+GGEM+YI++QRL A + S +++ +          VM++I+STMF   F++ L  PQ LYS ++++ +   +AH+SIM+LN ASM KLYDLMTM  KYQ+      ++LL +T NH  ++   +K  PS+      A    +++Y PL   +   IR  L+   QD  IRVSIFLK+ IQ  NG F+   SG +   F+ PG I+ ++A G+     +F +   +       S+   GDR T LG NMY +    E     + N +       D+  P+P +  +L+LL+KL+     + +SN +  F++NL    QEE  + T        S V+  +  ++++   +  +I E     E  +E +  +   N  + DLL +MD+
Sbjct:    1 MSQRTLPLLIINLGGEMIYILDQRLRAPDESDEKTQRGCWTEDDRKRVMNDIVSTMFSKVFLEELLRPQDLYSHRALRTVLTRIAHTSIMRLNPASMDKLYDLMTMTFKYQLVLCPRPQDLLLITFNHTDAIKELVKDNPSLVNQINEAQRLLIEVYTPLSDGELQLIRHTLLLLFQDMQIRVSIFLKEKIQNPNGHFVLQTSGPVPYGFQVPGLIRLFNAKGREVMRTRFPSGGSYTSALNPGSLDLYGDRVTLLGTNMY-STPSPEDMNPSSTNTSRGKPKQADS-TPNPLATEELNLLAKLMGGMEVQKLSNVDAAFRVNLLALNQEEESSGTSEGTDQHSSAVINIQATQDELASTELARIAE-----EFDEEGNQTEELGNKGD-DLLAMMDE 390          
BLAST of Organic solute carrier partner 1 vs. Ensembl Xenopus
Match: oscp1 (organic solute carrier partner 1 [Source:NCBI gene;Acc:493245])

HSP 1 Score: 264.618 bits (675), Expect = 1.629e-84
Identity = 156/385 (40.52%), Postives = 236/385 (61.30%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASG-KLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVN-KNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKE-NVALKEVMKEMHIDQSS--SNNNEFDLLELMD 1152
            M+  +LP+LF+N+GGEMLYI++QRL AQN+  D++ KVM++II+TMF   F++ LF PQ LYSKK+++ +F+ LAH+SIM+LN ASM KLYDLMTMA KYQV      R++L VT NH+ ++ ++I+  PSI    +    + + +Y  L   ++  IR+ L+ F QD  IRVSIFLKD +Q  NG+F+   SG +    E PG I+ ++  G ++KR+ +FQ    +I   ++ S    GDR  KLG NMY  ++ +ET      K+ A+ +K   +   P+P +K +L+LL++L+     +    S+ +F+LNLF  ++EE  AA   P    EE   K++ I A + +E N  L  +M     ++S   S +   DLL LMD
Sbjct:    1 MSLRTLPLLFINLGGEMLYILDQRLRAQNIPPDKAKKVMNDIITTMFNKKFMEELFKPQELYSKKALRTVFDRLAHASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPRDILLVTFNHMDAIKDFIRDSPSILNQVDETFRQLIDMYTCLPSGEFQLIRQTLLIFFQDMHIRVSIFLKDKVQNSNGRFVLPTSGPVPWGTEEPGLIRIFNYKGEEVKRV-QFQNGGSYISPLREGSYDLFGDRVLKLGTNMYSVSRSVETHMSGTLKSSASHTK---ENVAPNPLAKEELNLLAQLMGGLELKKTSGSDHSFRLNLFNDDEEEENAALLRP----EELSYKVISIQANEDQERNKELSRIMGAFQSEESCVQSTSKGDDLLALMD 377          
BLAST of Organic solute carrier partner 1 vs. Ensembl Xenopus
Match: oscp1 (organic solute carrier partner 1 [Source:NCBI gene;Acc:493245])

HSP 1 Score: 243.817 bits (621), Expect = 2.512e-76
Identity = 149/386 (38.60%), Postives = 231/386 (59.84%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVK-YQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASG-KLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVN-KNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKE-NVALKEVMKEMHIDQSS--SNNNEFDLLELMD 1152
            M+  +LP+LF+N+GGEMLYI++QRL AQN+  D++ KVM++II+TMF   F++ LF PQ LYSKK+++ +F+ LAH+SIM+LN ASM K+   M +  K YQV      R++L VT NH+ ++ ++I+  PSI    +    + + +Y  L   ++  IR+ L+ F QD  IRVSIFLKD +Q  NG+F+   SG +    E PG I+ ++  G ++KR+ +FQ    +I   ++ S    GDR  KLG NMY  ++ +ET      K+ A+ +K   +   P+P +K +L+LL++L+     +    S+ +F+LNLF  ++EE  AA   P    EE   K++ I A + +E N  L  +M     ++S   S +   DLL LMD
Sbjct:    1 MSLRTLPLLFINLGGEMLYILDQRLRAQNIPPDKAKKVMNDIITTMFNKKFMEELFKPQELYSKKALRTVFDRLAHASIMRLNQASMDKVSYRMELCFKSYQVLLCPRPRDILLVTFNHMDAIKDFIRDSPSILNQVDETFRQLIDMYTCLPSGEFQLIRQTLLIFFQDMHIRVSIFLKDKVQNSNGRFVLPTSGPVPWGTEEPGLIRIFNYKGEEVKRV-QFQNGGSYISPLREGSYDLFGDRVLKLGTNMYSVSRSVETHMSGTLKSSASHTK---ENVAPNPLAKEELNLLAQLMGGLELKKTSGSDHSFRLNLFNDDEEEENAALLRP----EELSYKVISIQANEDQERNKELSRIMGAFQSEESCVQSTSKGDDLLALMD 378          
BLAST of Organic solute carrier partner 1 vs. Ensembl Xenopus
Match: oscp1 (organic solute carrier partner 1 [Source:NCBI gene;Acc:493245])

HSP 1 Score: 229.565 bits (584), Expect = 6.303e-71
Identity = 147/395 (37.22%), Postives = 225/395 (56.96%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNK----------VMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASG-KLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVN-KNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKE-NVALKEVMKEMHIDQSS--SNNNEFDLLELMD 1152
            M+  +LP+LF+N+GGEMLYI++QRL AQN+  D++ K          VM++II+TMF   F++ LF PQ LYSKK+++ +F+ LAH             LYDLMTMA KYQV      R++L VT NH+ ++ ++I+  PSI    +    + + +Y  L   ++  IR+ L+ F QD  IRVSIFLKD +Q  NG+F+   SG +    E PG I+ ++  G ++KR+ +FQ    +I   ++ S    GDR  KLG NMY  ++ +ET      K+ A+ +K   +   P+P +K +L+LL++L+     +    S+ +F+LNLF  ++EE  AA   P    EE   K++ I A + +E N  L  +M     ++S   S +   DLL LMD
Sbjct:    1 MSLRTLPLLFINLGGEMLYILDQRLRAQNIPPDKAKKAGWTDQDRKRVMNDIITTMFNKKFMEELFKPQELYSKKALRTVFDRLAH-------------LYDLMTMAFKYQVLLCPRPRDILLVTFNHMDAIKDFIRDSPSILNQVDETFRQLIDMYTCLPSGEFQLIRQTLLIFFQDMHIRVSIFLKDKVQNSNGRFVLPTSGPVPWGTEEPGLIRIFNYKGEEVKRV-QFQNGGSYISPLREGSYDLFGDRVLKLGTNMYSVSRSVETHMSGTLKSSASHTK---ENVAPNPLAKEELNLLAQLMGGLELKKTSGSDHSFRLNLFNDDEEEENAALLRP----EELSYKVISIQANEDQERNKELSRIMGAFQSEESCVQSTSKGDDLLALMD 374          
BLAST of Organic solute carrier partner 1 vs. Ensembl Mouse
Match: Oscp1 (organic solute carrier partner 1 [Source:MGI Symbol;Acc:MGI:1916308])

HSP 1 Score: 270.781 bits (691), Expect = 5.700e-87
Identity = 150/387 (38.76%), Postives = 235/387 (60.72%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ-KVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKE-NVALKEVMKEMHI----DQSSSNNNEFDLLELMDQ 1155
            M+  +LP+LFLN+GGEMLY+++QRL AQN+  D++ KV+++IISTMF   F+D LF PQ LYSKK+++ +++ LAH+SIM+LN ASM KLYDLMTMA KYQV      +++L VT NHL ++  +++  P++    +    +  ++Y  L   ++  IR+ L+NF QD  IRVS FLKD +Q  NG+F+  +SG +    E PG I+ +   GK  +  KF+    ++  QK+ S    GDR  KLG NMY  ++ +ET     +KN A+ ++ +     P+P +K +L+ L++L+     +        F+LNLF +++EE  AA   P    EE   +++ I A + ++ N  L  +M E  I    +Q++S  +  DLL +MD+
Sbjct:    1 MSVRTLPLLFLNLGGEMLYVLDQRLRAQNIPGDKARKVLNDIISTMFNRKFMDELFKPQELYSKKALRTVYDRLAHASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDAIKGFVQDSPTVIHQVDETFRQLSEVYGKLSEGEFQLIRQTLLNFFQDLHIRVSTFLKDKVQNSNGRFVLPVSGPVPWGTEVPGVIRVFSVKGKEVKKMKFRHGGDYVAAQKEGSFELYGDRVLKLGTNMYSASRPVETHMSATSKNAASRAQENI---VPNPLAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEHAALSRP----EELSYEVISIQATQDQQRNEELARIMGEFEITEQLEQNTSKGD--DLLAMMDR 378          
BLAST of Organic solute carrier partner 1 vs. Ensembl Mouse
Match: Oscp1 (organic solute carrier partner 1 [Source:MGI Symbol;Acc:MGI:1916308])

HSP 1 Score: 262.692 bits (670), Expect = 1.178e-83
Identity = 150/397 (37.78%), Postives = 235/397 (59.19%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNK----------VMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ-KVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKE-NVALKEVMKEMHI----DQSSSNNNEFDLLELMDQ 1155
            M+  +LP+LFLN+GGEMLY+++QRL AQN+  D++ K          V+++IISTMF   F+D LF PQ LYSKK+++ +++ LAH+SIM+LN ASM KLYDLMTMA KYQV      +++L VT NHL ++  +++  P++    +    +  ++Y  L   ++  IR+ L+NF QD  IRVS FLKD +Q  NG+F+  +SG +    E PG I+ +   GK  +  KF+    ++  QK+ S    GDR  KLG NMY  ++ +ET     +KN A+ ++ +     P+P +K +L+ L++L+     +        F+LNLF +++EE  AA   P    EE   +++ I A + ++ N  L  +M E  I    +Q++S  +  DLL +MD+
Sbjct:    1 MSVRTLPLLFLNLGGEMLYVLDQRLRAQNIPGDKARKDEWTEVDRKRVLNDIISTMFNRKFMDELFKPQELYSKKALRTVYDRLAHASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDAIKGFVQDSPTVIHQVDETFRQLSEVYGKLSEGEFQLIRQTLLNFFQDLHIRVSTFLKDKVQNSNGRFVLPVSGPVPWGTEVPGVIRVFSVKGKEVKKMKFRHGGDYVAAQKEGSFELYGDRVLKLGTNMYSASRPVETHMSATSKNAASRAQENI---VPNPLAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEHAALSRP----EELSYEVISIQATQDQQRNEELARIMGEFEITEQLEQNTSKGD--DLLAMMDR 388          
BLAST of Organic solute carrier partner 1 vs. UniProt/SwissProt
Match: sp|Q29S00|OSCP1_BOVIN (Protein OSCP1 OS=Bos taurus OX=9913 GN=OSCP1 PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 3.339e-87
Identity = 157/385 (40.78%), Postives = 238/385 (61.82%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ-KVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKE-NVALKEVMKEMHI-DQS-SSNNNEFDLLELMDQ 1155
            M+  +LP+LFLN+GGEMLYI++QRL AQN+  D++ KVM++IISTMF   F+D LF PQ LYSKK+++ +++ LAH+SIM+LN ASM KLYDLMTMA KYQV      +++L VTLNHL ++   I+  P+I    +    +   IY  L   ++  IR+ L+ F QD  IRVSIFLKD +Q  +G+F+  +SG +    E PG I++++  GK  +  +F+    ++   K+ S+   GDR  KLG NMY  N+ +ET     +KN A+ ++   ++  P+P +K +L+LL++L+     +        F+LNLF +++EE +AA   P    EE   K++ I A + ++ N  L  +M E  I DQS  S++   D L +MD+
Sbjct:    1 MSMRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKVMNDIISTMFNQKFMDELFKPQELYSKKALRTVYDRLAHASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTLNHLDAIKGLIQDSPTILHQVDKTFRQLTDIYGGLSAGEFQLIRQTLLIFFQDLHIRVSIFLKDKVQNSSGRFVLPVSGPVPWGTEVPGLIRTFNNKGKEVKRTEFKHGGSYVAAPKEGSLELYGDRVLKLGTNMYSVNRPVETHMSAASKNLASQTQ---ESIVPNPLAKEELNLLARLIGGMEIQKPSGPEPGFRLNLFTTDEEEEQAALTRP----EELSYKVINIQATQDQQTNQELVRIMGEFEITDQSRQSSSKGDDWLAMMDE 378          
BLAST of Organic solute carrier partner 1 vs. UniProt/SwissProt
Match: sp|Q8BHW2|OSCP1_MOUSE (Protein OSCP1 OS=Mus musculus OX=10090 GN=Oscp1 PE=1 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 3.987e-86
Identity = 150/387 (38.76%), Postives = 235/387 (60.72%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ-KVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKE-NVALKEVMKEMHI----DQSSSNNNEFDLLELMDQ 1155
            M+  +LP+LFLN+GGEMLY+++QRL AQN+  D++ KV+++IISTMF   F+D LF PQ LYSKK+++ +++ LAH+SIM+LN ASM KLYDLMTMA KYQV      +++L VT NHL ++  +++  P++    +    +  ++Y  L   ++  IR+ L+NF QD  IRVS FLKD +Q  NG+F+  +SG +    E PG I+ +   GK  +  KF+    ++  QK+ S    GDR  KLG NMY  ++ +ET     +KN A+ ++ +     P+P +K +L+ L++L+     +        F+LNLF +++EE  AA   P    EE   +++ I A + ++ N  L  +M E  I    +Q++S  +  DLL +MD+
Sbjct:    1 MSVRTLPLLFLNLGGEMLYVLDQRLRAQNIPGDKARKVLNDIISTMFNRKFMDELFKPQELYSKKALRTVYDRLAHASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDAIKGFVQDSPTVIHQVDETFRQLSEVYGKLSEGEFQLIRQTLLNFFQDLHIRVSTFLKDKVQNSNGRFVLPVSGPVPWGTEVPGVIRVFSVKGKEVKKMKFRHGGDYVAAQKEGSFELYGDRVLKLGTNMYSASRPVETHMSATSKNAASRAQENI---VPNPLAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEHAALSRP----EELSYEVISIQATQDQQRNEELARIMGEFEITEQLEQNTSKGD--DLLAMMDR 378          
BLAST of Organic solute carrier partner 1 vs. UniProt/SwissProt
Match: sp|Q4QQS3|OSCP1_RAT (Protein OSCP1 OS=Rattus norvegicus OX=10116 GN=Oscp1 PE=2 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 7.761e-83
Identity = 148/386 (38.34%), Postives = 232/386 (60.10%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASG-KLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ-KVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENV-ALKEVMKEMHIDQSSSNNNE--FDLLELMDQ 1155
            M+  +LP+LFLN+GGEMLY+++QRL AQN+  D++ KV+++IISTMF   F + LF PQ LYSKK+++ +++ LAH+SIM+LN ASM KLYDLMTMA KYQV      +++L VT NHL S+  +I+  P+I    +    +  +IY  L   ++  IR+ L+ F QD  IRVS FLKD +Q  NG+F+  +SG +    E PG I+ ++  G ++KR+ +F+    ++   K+ S    GDR  KLG NMY  ++ +ET     +KN A+ ++ +     P+P +K +L+ L++L+     +        F+LNLF +++EE  AA   P    EE   +++ I A + ++    L  +M+E  + +    N     DLL +MD+
Sbjct:    1 MSVRTLPLLFLNLGGEMLYVLDQRLRAQNIPGDKARKVLNDIISTMFNRKFTEELFKPQELYSKKALRTVYDRLAHASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDSIKGFIQDSPTIIHQVDETFRQLTEIYGSLSAGEFQLIRQTLLIFFQDLHIRVSTFLKDKVQNSNGRFVLPVSGPVPWGIEVPGVIRVFNDKGDEVKRM-EFRHGGDYVAAHKEGSFELYGDRVLKLGTNMYSASRPVETHMSATSKNSASRAQENI---APNPLAKEELNFLARLIGGMEIKKPSGPEPGFRLNLFTTDEEEEHAALSRP----EELSYEVISIQATQDQQRSEELARIMEEFEMTEQPERNTSKGDDLLAMMDR 378          
BLAST of Organic solute carrier partner 1 vs. UniProt/SwissProt
Match: sp|Q8WVF1|OSCP1_HUMAN (Protein OSCP1 OS=Homo sapiens OX=9606 GN=OSCP1 PE=1 SV=4)

HSP 1 Score: 255.758 bits (652), Expect = 3.224e-80
Identity = 153/396 (38.64%), Postives = 238/396 (60.10%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNK----------VMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASG-KLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ-KVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENV-ALKEVMKEMHIDQSS--SNNNEFDLLELMDQ 1155
            M+  +LP+LFLN+GGEMLYI++QRL AQN+  D++ K          V+++IISTMF   F++ LF PQ LYSKK+++ ++E LAH+SIMKLN ASM KLYDLMTMA KYQV      +++L VT NHL ++  +I+  P+I +  +  + +  +IY  L   ++  IR+ L+ F QD  IRVS+FLKD +Q  NG+F+  +SG +    E PG I+ ++  G ++KRI +F+    ++   K+ S    GDR  KLG NMY  N+ +ET     +KN A+ ++   ++  P+P +K +L+ L++L+     +        F+LNLF +++EE +AA   P    EE   +++ I A + ++    L  +M E  I +    S +   DLL +MD+
Sbjct:    1 MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSPTILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSMFLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFNNKGEEVKRI-EFKHGGNYVPAPKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLASWTQ---ESIAPNPLAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRP----EELSYEVINIQATQDQQRSEELARIMGEFEITEQPRLSTSKGDDLLAMMDE 388          
BLAST of Organic solute carrier partner 1 vs. TrEMBL
Match: V4BAX9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_224648 PE=4 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 4.169e-98
Identity = 156/359 (43.45%), Postives = 232/359 (64.62%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENVALKEVMKEMHI 1101
            M+  +LP+LF+N+GGEM+YI++QRL AQN+   ++ KV+H+I+STMF   F++ LF PQ LYSKK+++ +F+ LAH+SIM+LNAASM KLYDLMTMA+KYQ+      ++++  TLNH+ ++ NY++  PSIK+  +      ++ Y P+   +   +R+ L+NF QD  IRVSIFLKD +Q  NG+FI  + G L    E PGTI+ +   G+ K   +F     +I+ +K+ S   +GDR TK G NMY  ++ +ET  +  KN  T   SD DT  P+P +K  LDLLS+L+          F+LNLF++++EESKAA   P+   E  E+++V IDA K  +N  L  +M E+ +
Sbjct:    1 MSMKTLPLLFINLGGEMVYILDQRLRAQNIPDSKAAKVLHDIVSTMFSKRFMEELFKPQTLYSKKAMRTVFDRLAHASIMRLNAASMDKLYDLMTMAIKYQISICYRPKDIILSTLNHMDAIRNYVEEAPSIKQQVDYIYRMLIETYIPMSAGECHLMRQTLLNFFQDMHIRVSIFLKDKVQNNNGRFILPIGGPLPYGTEVPGTIRLFTDDGRTKN-DQFPAGGSYILSKKEGSFDMKGDRVTKFGTNMYSTSRPVETTVIQPKN--TIPSSDLDTSNPNPLAKAHLDLLSQLIGTKLMKDKSEFRLNLFKTDEEESKAAAIRPI---ETTESQVVKIDASKKAKNPELSRIMGELSV 353          
BLAST of Organic solute carrier partner 1 vs. TrEMBL
Match: A0A3S0ZZB3 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_005527 PE=4 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.922e-97
Identity = 161/360 (44.72%), Postives = 235/360 (65.28%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQK-VVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENVALKEVMKEMHI 1101
            M+  +LP+LF+N+GGEM+YI++QRL AQN+  ++S KV+++I++TMF   F++ LF PQ LYSKK+++ +F+ LAH+SIM+LNAASM KLYDLMTMA KYQV  A   +++L +TLNH+ ++ +Y++  P+++   E       + Y  L   ++  IR+ L+NF QD  IRVSIFLKD +Q  NG+F+    G L    EAPG I+S+DASGK + I  F     + I   + S    GDR TKLG NMY  ++ +ET    V+K+      SD DT  PDP +K  LDLLS+L+  N  V+   F+LNLF+++QEE +AA+  P+   E  E+++V IDA K  +   L ++M EM +
Sbjct:    1 MSLKTLPLLFINLGGEMMYILDQRLRAQNIPTEKSKKVLNDIVATMFNKRFMEELFKPQTLYSKKAMRTVFDRLAHASIMRLNAASMDKLYDLMTMAFKYQVSLALRPKDILLITLNHMDTMRSYVEDSPNVRSQVENVYRMLSETYASLSQGEFQLIRQTLLNFFQDMHIRVSIFLKDKVQNNNGRFVLKSGGTLPYGTEAPGLIRSFDASGKSRNIA-FAPGANYTIAGCEGSFDMRGDRITKLGCNMYSASRPVETSGPSVSKSVM--QGSDMDTSNPDPLAKAHLDLLSRLIGAN--VTKNEFRLNLFKNDQEEDEAASIQPI---EVAESQVVNIDASKGGKTSELTKIMGEMSV 352          
BLAST of Organic solute carrier partner 1 vs. TrEMBL
Match: A0A2T7P7A1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11876 PE=4 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 3.340e-97
Identity = 162/379 (42.74%), Postives = 239/379 (63.06%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENVALKEVMKEMHIDQSSSNNNEFDLLELMDQAN 1161
            M+  +LP+LFLN+GGEM+YI++QRL AQNV+ +++ KV+++I++TMF   F+D LF PQ LYSKK+++ +F+ LAH+SIM+LNAASM KLYDLMTMA KYQV      +++L +T NH+  ++ Y++  P++++  E      ++ Y  L   ++  IR+ L++F QD  IRVSIFLKD +Q   G+FI  LSG+L    E PG I+++D SG  K    F      +   ++ S    GDR TKLG NMY   +  E   V      T   SD D+ QPDP +K  LDLLS+L+  +  V+   F+LNLF +++EE  AA    V + E+ E+++V IDA K   +  L  +M EM + +S +  +  DLL+LMD A+
Sbjct:    1 MSVKTLPLLFLNLGGEMMYILDQRLRAQNVAEEKAQKVLNDIVATMFNKRFMDELFKPQLLYSKKAMRTVFDRLAHASIMRLNAASMDKLYDLMTMAFKYQVSLCLQPKDVLLITFNHMDVIHKYVENAPAVRQQVEMVYRMLIETYASLSAGEFQLIRQTLLSFFQDMHIRVSIFLKDKVQNNTGRFILPLSGQLPWGTEPPGIIRTFDESGNCKET-SFPAPVGNVKAAREGSFDMTGDRVTKLGTNMYSATRPTEALGVQKSGKTT--VSDIDSAQPDPLAKAHLDLLSQLIGAS--VTRAEFRLNLFNTDKEEEHAAA---VKLTEKTESQVVKIDASKEHRSTELNRIMGEMTVSESGACGDT-DLLDLMDSAS 370          
BLAST of Organic solute carrier partner 1 vs. TrEMBL
Match: A0A210PRT6 (Protein OSCP1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07167 PE=4 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 1.854e-93
Identity = 151/363 (41.60%), Postives = 234/363 (64.46%), Query Frame = 1
Query:   37 SLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDVSNKNFKLNLFQSEQEESKA--ATGSPVVVFEEPENKIVMIDARKIKENVALKEVMKEMHIDQSSSN 1119
            +LP+LF+N+GGEM+YI++QRL AQN++ +++ KV+H+II+TM+   F++ LF PQ LYSKK+++ +F+ LAH+SIM+LNAASM KLYDLMTMA K+QV  +   ++++  TLNH+ ++ + +   P +++  +      ++ +  L   ++  IR+ L+NF QD  IRVSIFLKD +Q  NG+F+   SG L  + E+PGTI+ YDASG ++   +F     F+   ++ S   +G R TKLG NMY   + +ET     +    +  SD ++  PDP +K QLDLLS L+   K  S +  +LNLF ++QEE  A  AT  P+   E  E+K+V IDA K +    L ++M E+++  S+S+
Sbjct:    5 TLPLLFINLGGEMIYILDQRLRAQNIADEKAKKVLHDIIATMYHKRFMEELFKPQPLYSKKAMRTVFDRLAHASIMRLNAASMDKLYDLMTMAFKFQVSLSLRPKDIILTTLNHIDAIKSLLDGAPQVQQQVDHVYRLLIETFGSLSLGEFQLIRQTLLNFFQDMHIRVSIFLKDKVQSSNGRFVLPDSGTLPWKTESPGTIRLYDASGNVRNTSQFPANGNFVPALQEGSFDIKGSRVTKLGTNMYSVVRTVETISSGVQRRQANVVSDIESNTPDPLAKAQLDLLSTLIGGRKSASKQEIRLNLFNNDQEEDDAAEATMKPI---EMAESKVVKIDASKKQRGAELNKIMGELNVQDSASH 364          
BLAST of Organic solute carrier partner 1 vs. TrEMBL
Match: K1PW99 (Protein OSCP1 OS=Crassostrea gigas OX=29159 GN=CGI_10016507 PE=4 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 6.811e-92
Identity = 161/380 (42.37%), Postives = 237/380 (62.37%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDVSNKNFKLNLFQSEQEESKA--ATGSPVVVFEEPENKIVMIDARKIKENVALKEVMKEMHIDQSSSNNNEFDLLELMDQA 1158
            M+  +LP+LF+N+GGEM+YI++QRL AQN+  ++S KV+H+IISTMF   F++ LF PQ LYSKK+++ +F+ LAH+SIM+LNA SM KLYDLMTMA KYQV      +E++ +TLNH+ ++  +++ +P+IK+  +      ++ +  L   ++  IR+ L+NF QD  IRVSIFLKD +Q  NG+F+    G +    E PGTIK ++ASG   +   F     +   Q   S+   G+R T LG NMY  ++ +ET      + +  + SD D+  PDP +K QLDLL +L+  +   S    +LNLF++++EE +A  AT  PV   E  ++K+V ID +K K N  L  +  E+ I Q   N  E DLL LMD A
Sbjct:    1 MSYKTLPLLFINLGGEMIYILDQRLRAQNIPNEKSRKVLHDIISTMFHKRFMEELFKPQPLYSKKAMRTVFDRLAHASIMRLNAPSMDKLYDLMTMAFKYQVSLCLRPKEIILITLNHMDAIRAFVEGQPNIKQQVDHVYRLLIQTFGSLSNGEFQLIRQTLLNFFQDMHIRVSIFLKDKVQNSNGRFVLPTGGAVPYGAEVPGTIKLFNASGAEVKTSSFNPGGSYQPPQGDGSLDIVGNRITTLGTNMYSVSRPVETSGSHRISKSAPTVSDIDSATPDPMAKAQLDLLCQLIGSSAPKS--EIRLNLFKTDEEEEQASVATIQPV---EHAQSKVVNIDLKKNK-NDELSRIAGELSI-QGDQNEAEDDLLNLMDSA 373          
BLAST of Organic solute carrier partner 1 vs. Ensembl Cavefish
Match: OSCP1 (organic solute carrier partner 1 [Source:NCBI gene;Acc:103033623])

HSP 1 Score: 263.848 bits (673), Expect = 2.520e-84
Identity = 146/363 (40.22%), Postives = 228/363 (62.81%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASG-KLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ-KVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKE-NVALKEVMKE 1092
            M+  +LP+LF+N+GGEMLYI++QRL AQN+  D++ KVM++II+TMF   F++ LF PQ LYSKK+++ +F+ LAH+SIM+LN ASM KLYDLMTMA KYQV      +++L VT NH+ ++ ++++  PSI    +    + L+IY  L   ++  IR+ L+ F QD  IRVSIFLKD +Q  NG+F+   SG +    + PG I+ +  SG ++KR+ +F+    +    ++ S    GDR TKLG NMY  ++ +ET     +KN +  +K +     P+P +K +L+LL+KL+     +    ++  F++NLF +++EE +A    P    EE   +++ I A K K+ N  L ++M E
Sbjct:    1 MSTRTLPLLFINLGGEMLYILDQRLRAQNIPSDKAKKVMNDIITTMFNKKFLEELFKPQELYSKKALRTVFDRLAHASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPKDILLVTFNHMDAIKDFVRDTPSILSQVDETYRQLLEIYTSLSGGEFQLIRQTLLIFFQDMHIRVSIFLKDKVQNSNGRFVLPTSGPVPYGTQTPGLIRMFSCSGEEIKRV-QFRDGGNYTAALREGSFELFGDRVTKLGTNMYSVSRPVETHMSGTSKNSSQHTKVN---TLPNPLAKEELNLLAKLMGGLEVQKPSHTDSGFRVNLFATDEEEEEALITRP----EELSYEVINIQATKDKQANAELAKIMGE 355          
BLAST of Organic solute carrier partner 1 vs. Ensembl Cavefish
Match: OSCP1 (organic solute carrier partner 1 [Source:NCBI gene;Acc:103033623])

HSP 1 Score: 253.062 bits (645), Expect = 6.037e-80
Identity = 146/379 (38.52%), Postives = 228/379 (60.16%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKV----------------MHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASG-KLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQ-KVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKE-NVALKEVMKE 1092
            M+  +LP+LF+N+GGEMLYI++QRL AQN+  D++ KV                M++II+TMF   F++ LF PQ LYSKK+++ +F+ LAH+SIM+LN ASM KLYDLMTMA KYQV      +++L VT NH+ ++ ++++  PSI    +    + L+IY  L   ++  IR+ L+ F QD  IRVSIFLKD +Q  NG+F+   SG +    + PG I+ +  SG ++KR+ +F+    +    ++ S    GDR TKLG NMY  ++ +ET     +KN +  +K +     P+P +K +L+LL+KL+     +    ++  F++NLF +++EE +A    P    EE   +++ I A K K+ N  L ++M E
Sbjct:    1 MSTRTLPLLFINLGGEMLYILDQRLRAQNIPSDKAKKVFVATVAEWIEEDRKRVMNDIITTMFNKKFLEELFKPQELYSKKALRTVFDRLAHASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPKDILLVTFNHMDAIKDFVRDTPSILSQVDETYRQLLEIYTSLSGGEFQLIRQTLLIFFQDMHIRVSIFLKDKVQNSNGRFVLPTSGPVPYGTQTPGLIRMFSCSGEEIKRV-QFRDGGNYTAALREGSFELFGDRVTKLGTNMYSVSRPVETHMSGTSKNSSQHTKVN---TLPNPLAKEELNLLAKLMGGLEVQKPSHTDSGFRVNLFATDEEEEEALITRP----EELSYEVINIQATKDKQANAELAKIMGE 371          
BLAST of Organic solute carrier partner 1 vs. Ensembl Cavefish
Match: oscp1a (organic solute carrier partner 1a [Source:ZFIN;Acc:ZDB-GENE-080204-2])

HSP 1 Score: 233.032 bits (593), Expect = 2.125e-72
Identity = 135/385 (35.06%), Postives = 220/385 (57.14%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSR----NKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKE-NVALKEVMKEMHIDQSS---SNNNEFDLLELMDQ 1155
            M+  +LP+L LNMGGEMLYI++QRL AQ+ + D++ +V+++I+ +MF   F++ L  PQ LYS+++++ +   LAH+SIM+LN ASM +LYDLM MA KYQ+      R+LL +T NH+ +V + +K  P +      A  + L++Y PL   +  +IR+ L++  QD  +RVSIFLK+ IQ  +G+F+   SG +    + PG I+ +++ G+  R  +F +   +    ++ S    GDR T+LG NMY      E  +  + +  T       +  P+P +K +L+LL+KL+      N   ++   K+NLF SEQEE      S     +EP   ++ I A +  + N  L  + +E+ + Q      +N   DLL +MD+
Sbjct:    1 MSLRTLPLLVLNMGGEMLYILDQRLRAQHETDDKTQRVLNDIVRSMFSKAFMEELMKPQDLYSQRALRCVLTRLAHTSIMRLNPASMDRLYDLMMMAFKYQLLLCPRPRDLLLITCNHVDAVRDMVKDSPCLINQINDAQRQILEMYTPLSDGELQFIRQTLLSLFQDVHVRVSIFLKEKIQNPDGRFVLPTSGPVPHGSDVPGLIRWFNSRGREVRRREFPSGGCYCSSLREGSFDVAGDRVTRLGTNMYCTTLS-EDARTSDSSKNTCKTKQQASVDPNPLAKEELNLLAKLMGGMEVWNLASADGGVKVNLFLSEQEEDDGGISSG---GDEPAFGVINIQATQDHQVNTELTRIAEELLVQQDQPELPSNKGDDLLAMMDE 381          
BLAST of Organic solute carrier partner 1 vs. Ensembl Nematostella
Match: EDO33556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRX4])

HSP 1 Score: 234.187 bits (596), Expect = 5.728e-74
Identity = 131/330 (39.70%), Postives = 190/330 (57.58%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKV-----VNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDVSNKN--------FKLNLFQSEQEE 975
            M+  +LP+LFLN+GGEMLYI++QRL AQ++  +++ KVMH+I+ TMF   F++ LF PQ  YSKK+++ +F+ LAH+SIM+LN+ASM KLYDLMTMA KYQV       ++L VT NH+ ++  ++   P+I    E       + Y  L   Q+  IR+ L+ F QD  IRVSIFLKD +Q  NGKF+    G +  + E PG I+ +   G + +   F T  +  +  K  S    GDR  KLG NMY   + IET        V K+ A+ + S          +K +L+LL+ L+       + N        F+LNLF +++EE
Sbjct:    1 MSLRTLPILFLNLGGEMLYILDQRLRAQSIPDEKARKVMHDIVGTMFNKRFMEELFKPQDTYSKKAMRTVFDRLAHASIMRLNSASMDKLYDLMTMAFKYQVSLCLRPSDVLLVTYNHMDAIRGFVSDNPAISAQVENVYKHLYETYADLTMGQFQIIRQTLLTFFQDMHIRVSIFLKDKVQTANGKFVLPTDGPVPWDTEVPGAIRYFGDDGSVMKTTHFTTTCQHELADKPGSFELLGDRVIKLGRNMYTVARPIETSSAPSLPNVKKSPASSTASALSVL-----AKEELNLLAHLVGGGVLRLSCNPYCFLFTAFRLNLFSTDEEE 325          
BLAST of Organic solute carrier partner 1 vs. Ensembl Medaka
Match: OSCP1 (protein OSCP1 [Source:NCBI gene;Acc:101166985])

HSP 1 Score: 255.373 bits (651), Expect = 2.439e-81
Identity = 137/354 (38.70%), Postives = 219/354 (61.86%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENVAL 1074
            M+  +LP+LF+N+GGEMLYI++QRL AQN+  D++ KVM++II+TMF   F++ LF PQ LYSKK+++ +F+ LAH+SIM+LN ASM KLYDLMTMA KYQV      +++L V+ NH+ ++ +++K  PSI    +    + +++Y PL   ++  IR+ L+ F QD  IRVSIFLKD +Q  NG+F    SG +    + PG I+ +  +G+ K   +F     +    ++ S    GDR TKLG NMY  ++ +ET  +   + ++   +  +T  P+P +K +L++L++L+     +    S+  F++NLF +++EE +A    P    +E    I+ I A K+ +N  L
Sbjct:    1 MSSRTLPLLFINLGGEMLYILDQRLRAQNIPADKAKKVMNDIITTMFNKKFLEELFKPQELYSKKALRTVFDRLAHASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPKDILLVSFNHMDAIKDFVKDTPSILSQVDETYQQLIEMYTPLCNGEFQLIRQTLLIFFQDMHIRVSIFLKDKVQNSNGRFGLPTSGPVPHGTQVPGLIRIFSCTGEEKTRLQFNNGGNYTSAIREGSFEIFGDRVTKLGTNMYSVSRPVETH-MSGTSKSSTQHTKVNT-APNPLAKEELNMLARLMGGLEVQKAGSSDTAFRVNLFATDEEEEEALITRP----DELSYGIINIQATKVNKNTLL 348          
BLAST of Organic solute carrier partner 1 vs. Ensembl Medaka
Match: OSCP1 (protein OSCP1 [Source:NCBI gene;Acc:101166985])

HSP 1 Score: 242.662 bits (618), Expect = 6.074e-76
Identity = 148/399 (37.09%), Postives = 235/399 (58.90%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNK--------------VMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLS----RNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENVA-LKEVMKEM----HIDQSSSNNNEFDLLELMD 1152
            M+  +LP+LF+N+GGEMLYI++QRL AQN+  D++ K              VM++II+TMF   F++ LF PQ LYSKK+++ +F+ LAH+SIM+LN ASM KLYDLMTMA KYQV      +++L V+ NH+ ++ +++K  PSI    +    + +++Y PL   ++  IR+ L+ F QD  IRVSIFLKD +Q  NG+F    SG +    + PG I+ +  +G+ K   +F     +    ++ S    GDR TKLG NMY  ++ +ET  +   + ++   +  +T  P+P +K +L++L++L+     +    S+  F++NLF +++EE +A    P    +E    I+ I A K ++  A L ++M E     H   SSS+  + DLL +MD
Sbjct:    1 MSSRTLPLLFINLGGEMLYILDQRLRAQNIPADKAKKDSTIAGWIEEDRRRVMNDIITTMFNKKFLEELFKPQELYSKKALRTVFDRLAHASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPKDILLVSFNHMDAIKDFVKDTPSILSQVDETYQQLIEMYTPLCNGEFQLIRQTLLIFFQDMHIRVSIFLKDKVQNSNGRFGLPTSGPVPHGTQVPGLIRIFSCTGEEKTRLQFNNGGNYTSAIREGSFEIFGDRVTKLGTNMYSVSRPVETH-MSGTSKSSTQHTKVNT-APNPLAKEELNMLARLMGGLEVQKAGSSDTAFRVNLFATDEEEEEALITRP----DELSYGIINIQATKDQQVSAELTKIMGEFTDSGHQSPSSSSKGD-DLLAMMD 392          
BLAST of Organic solute carrier partner 1 vs. Ensembl Medaka
Match: oscp1a (protein OSCP1-like [Source:NCBI gene;Acc:101168383])

HSP 1 Score: 233.032 bits (593), Expect = 2.399e-72
Identity = 138/395 (34.94%), Postives = 218/395 (55.19%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNK----------VMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDV----SNKNFKLNLFQSEQEESKAATGSP-----VVVFEEPENKIVMIDARKIKENVALKEVMKEMHIDQSSSNNNEFDLLELMD 1152
            M+  +LP++F+N+GGEMLYI++QRL AQN S+D + K          VM++II TMF   F+D L  PQ LYS K++K +   LAH+SIM+LN ASM KLY+LM MA KYQV      ++LL +T NH+ ++  +++  P++    +    K +++Y PL   ++  +R+ L+ F QD  +RVS+FLK+ IQ  NG+F    SG +    + PG I+ +   G+     +F +   +    ++ S    GDR  +LG+NMY  N   ET    N     D         P+  +K +L+LL++++   K V    +  +F+LNLF S++EE +A T        V+  +  +++    +  +I    A +E+    H DQ SS  +E  LL +MD
Sbjct:    1 MSTRTLPLVFINLGGEMLYILDQRLQAQNTSVDNTEKGVWSEKDRKRVMNDIIGTMFSKAFMDELLKPQQLYSHKTMKTVLTRLAHTSIMRLNPASMEKLYELMVMAFKYQVYLCPRPKDLLLITYNHMDAIREFVRDTPAVANQVDETHRKLIEVYAPLSEGEFQLLRQTLLIFFQDMHVRVSLFLKNQIQNPNGRFTLTTSGPVPHGGDVPGLIRLFSVKGREVSRCEFPSGGSYSSAVREGSFDLHGDRVLRLGVNMYTMNHPEETHTSRNTCAQPDDV-------PNLLAKEELNLLARIMGSMKTVPVHTTEGSFRLNLFASDREEEEAGTSGGAQDFDVINIQAMQDEQASAELARIAAQFAEEEL---KHEDQGSSKGDE--LLAMMD 383          
BLAST of Organic solute carrier partner 1 vs. Planmine SMEST
Match: SMESG000013444.1 (SMESG000013444.1)

HSP 1 Score: 781.941 bits (2018), Expect = 0.000e+0
Identity = 379/379 (100.00%), Postives = 379/379 (100.00%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENVALKEVMKEMHIDQSSSNNNEFDLLELMDQAN 1161
            MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENVALKEVMKEMHIDQSSSNNNEFDLLELMDQAN
Sbjct:    1 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENVALKEVMKEMHIDQSSSNNNEFDLLELMDQAN 379          
BLAST of Organic solute carrier partner 1 vs. Planmine SMEST
Match: SMESG000013444.1 (SMESG000013444.1)

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 367/367 (100.00%), Postives = 367/367 (100.00%), Query Frame = 1
Query:   61 MGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENVALKEVMKEMHIDQSSSNNNEFDLLELMDQAN 1161
            MGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENVALKEVMKEMHIDQSSSNNNEFDLLELMDQAN
Sbjct:    1 MGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPLKPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEFEAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNMYKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKDVSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENVALKEVMKEMHIDQSSSNNNEFDLLELMDQAN 367          
BLAST of Organic solute carrier partner 1 vs. Planmine SMEST
Match: SMESG000013444.1 (SMESG000013444.1)

HSP 1 Score: 297.36 bits (760), Expect = 6.656e-101
Identity = 145/145 (100.00%), Postives = 145/145 (100.00%), Query Frame = 1
Query:   25 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLK 459
            MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLK
Sbjct:    1 MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLK 145          
BLAST of Organic solute carrier partner 1 vs. Planmine SMEST
Match: SMESG000013444.1 (SMESG000013444.1)

HSP 1 Score: 273.863 bits (699), Expect = 7.346e-92
Identity = 133/133 (100.00%), Postives = 133/133 (100.00%), Query Frame = 1
Query:   61 MGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLK 459
            MGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLK
Sbjct:    1 MGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSDFVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKYQVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLK 133          
The following BLAST results are available for this feature:
BLAST of Organic solute carrier partner 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OSCP12.536e-8439.64organic solute carrier partner 1 [Source:HGNC Symb... [more]
OSCP16.714e-8138.64organic solute carrier partner 1 [Source:HGNC Symb... [more]
OSCP11.957e-6236.95organic solute carrier partner 1 [Source:HGNC Symb... [more]
OSCP13.705e-5743.67organic solute carrier partner 1 [Source:HGNC Symb... [more]
OSCP11.504e-5048.88organic solute carrier partner 1 [Source:HGNC Symb... [more]
back to top
BLAST of Organic solute carrier partner 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R10F2.51.361e-3533.85pep chromosome:WBcel235:III:2923662:2924758:-1 gen... [more]
back to top
BLAST of Organic solute carrier partner 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
OSCP11.241e-1628.33gene:FBgn0033685 transcript:FBtr0088019[more]
back to top
BLAST of Organic solute carrier partner 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
OSCP11.092e-8438.60organic solute carrier partner 1b [Source:NCBI gen... [more]
oscp1a2.317e-6233.17organic solute carrier partner 1a [Source:ZFIN;Acc... [more]
back to top
BLAST of Organic solute carrier partner 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
oscp11.629e-8440.52organic solute carrier partner 1 [Source:NCBI gene... [more]
oscp12.512e-7638.60organic solute carrier partner 1 [Source:NCBI gene... [more]
oscp16.303e-7137.22organic solute carrier partner 1 [Source:NCBI gene... [more]
back to top
BLAST of Organic solute carrier partner 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Oscp15.700e-8738.76organic solute carrier partner 1 [Source:MGI Symbo... [more]
Oscp11.178e-8337.78organic solute carrier partner 1 [Source:MGI Symbo... [more]
back to top
BLAST of Organic solute carrier partner 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q29S00|OSCP1_BOVIN3.339e-8740.78Protein OSCP1 OS=Bos taurus OX=9913 GN=OSCP1 PE=2 ... [more]
sp|Q8BHW2|OSCP1_MOUSE3.987e-8638.76Protein OSCP1 OS=Mus musculus OX=10090 GN=Oscp1 PE... [more]
sp|Q4QQS3|OSCP1_RAT7.761e-8338.34Protein OSCP1 OS=Rattus norvegicus OX=10116 GN=Osc... [more]
sp|Q8WVF1|OSCP1_HUMAN3.224e-8038.64Protein OSCP1 OS=Homo sapiens OX=9606 GN=OSCP1 PE=... [more]
back to top
BLAST of Organic solute carrier partner 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4BAX94.169e-9843.45Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A3S0ZZB31.922e-9744.72Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A2T7P7A13.340e-9742.74Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A210PRT61.854e-9341.60Protein OSCP1 OS=Mizuhopecten yessoensis OX=6573 G... [more]
K1PW996.811e-9242.37Protein OSCP1 OS=Crassostrea gigas OX=29159 GN=CGI... [more]
back to top
BLAST of Organic solute carrier partner 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
OSCP12.520e-8440.22organic solute carrier partner 1 [Source:NCBI gene... [more]
OSCP16.037e-8038.52organic solute carrier partner 1 [Source:NCBI gene... [more]
oscp1a2.125e-7235.06organic solute carrier partner 1a [Source:ZFIN;Acc... [more]
back to top
BLAST of Organic solute carrier partner 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Organic solute carrier partner 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Organic solute carrier partner 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO335565.728e-7439.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Organic solute carrier partner 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
OSCP12.439e-8138.70protein OSCP1 [Source:NCBI gene;Acc:101166985][more]
OSCP16.074e-7637.09protein OSCP1 [Source:NCBI gene;Acc:101166985][more]
oscp1a2.399e-7234.94protein OSCP1-like [Source:NCBI gene;Acc:101168383... [more]
back to top
BLAST of Organic solute carrier partner 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000013444.10.000e+0100.00SMESG000013444.1[more]
SMESG000013444.10.000e+0100.00SMESG000013444.1[more]
SMESG000013444.16.656e-101100.00SMESG000013444.1[more]
SMESG000013444.17.346e-92100.00SMESG000013444.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019985 ID=SMED30019985|Name=Organic solute carrier partner 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1286bp
ATTTAATAGTATAAATTCATTAAAATGACTCAATTAAGCTTGCCTGTTTT
ATTTTTAAACATGGGAGGTGAAATGCTGTATATAATTGAACAAAGATTAA
GTGCTCAGAATGTTTCAATCGATAGATCTAACAAAGTAATGCACGAGATT
ATCAGCACAATGTTTCGATCAGACTTTGTCGATACACTATTTACACCACA
ATATTTATATTCAAAAAAGTCAATCAAAGAATTGTTTGAGAGTTTGGCTC
ATTCGTCAATAATGAAACTAAATGCTGCATCTATGTCGAAGCTGTATGAT
TTAATGACAATGGCAGTCAAATATCAGGTTTGTTCAGCACGGTCGGGAAG
GGAACTGTTATTTGTAACGTTAAATCATTTATACTCGGTTTACAACTACA
TCAAAATGGAACCATCTATTAAGAAATTATGGGAAGCGGCAGTTAGCAAA
TTTTTAAAGATTTATGAGCCACTGAAGCCGCATCAATGGATATGGATTCG
TCGCTGCCTGATGAATTTTTGTCAAGATGAATCAATTAGAGTGTCTATTT
TTTTGAAAGACAATATTCAAAAGCAAAACGGAAAGTTTATTTACATTTTG
TCAGGAGAGCTTGAGATTGAGTTCGAAGCACCTGGGACTATTAAATCTTA
CGATGCTTCGGGAAAACTGAAACGAATTGGAAAATTTCAAACTGAAGAGA
AATTTATAATTCAACAAAAGAAACCTTCTATACATCAAGAAGGTGATAGA
CACACAAAATTAGGATTAAATATGTACAAAAATAATAAAGGAATAGAAAC
TCAGAAAGTTGTCAATAAAAACTACGCAACTGATTCAAAGTCTGATTTTG
ACACATATCAACCTGATCCAGCTTCGAAAAATCAGTTAGATCTTCTTTCG
AAATTACTCTCTAGAAATAAGGATGTATCAAACAAAAATTTTAAATTAAA
TTTATTCCAATCAGAACAGGAAGAGAGTAAGGCCGCCACAGGAAGTCCAG
TGGTAGTATTTGAGGAACCAGAAAACAAGATCGTAATGATTGACGCTAGA
AAGATTAAAGAAAACGTTGCCTTAAAAGAAGTAATGAAGGAGATGCACAT
TGATCAATCTTCATCTAATAACAACGAATTCGATCTACTGGAGCTGATGG
ATCAGGCCAATTAGCAAGTGCAAATCACTACAATTGTTACTTTGTGTTTA
TTTTTGTGTTAATCAATCAAGACCTTATGAATGTGTATTTTTTCTGTTTT
GCAATTAAATAATTTGTTTGTTTTTCAGATCGGAAG
back to top

protein sequence of SMED30019985-orf-1

>SMED30019985-orf-1 ID=SMED30019985-orf-1|Name=SMED30019985-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=380bp
MTQLSLPVLFLNMGGEMLYIIEQRLSAQNVSIDRSNKVMHEIISTMFRSD
FVDTLFTPQYLYSKKSIKELFESLAHSSIMKLNAASMSKLYDLMTMAVKY
QVCSARSGRELLFVTLNHLYSVYNYIKMEPSIKKLWEAAVSKFLKIYEPL
KPHQWIWIRRCLMNFCQDESIRVSIFLKDNIQKQNGKFIYILSGELEIEF
EAPGTIKSYDASGKLKRIGKFQTEEKFIIQQKKPSIHQEGDRHTKLGLNM
YKNNKGIETQKVVNKNYATDSKSDFDTYQPDPASKNQLDLLSKLLSRNKD
VSNKNFKLNLFQSEQEESKAATGSPVVVFEEPENKIVMIDARKIKENVAL
KEVMKEMHIDQSSSNNNEFDLLELMDQAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0009925basal plasma membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:1990961drug transmembrane export
GO:0006810transport
GO:1903955positive regulation of protein targeting to mitochondrion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR019332OSCP1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019332Organic solute carrier protein 1PFAMPF10188Oscp1coord: 17..188
e-value: 5.3E-65
score: 218.8
IPR019332Organic solute carrier protein 1PANTHERPTHR21439OXIDORED-NITRO DOMAIN-CONTAINING PROTEINcoord: 1..377