SMED30019984

Overview
NameSMED30019984
Smed IDSMED30019984
Length (bp)618
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30019984 (SMED30019984) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30019984 (SMED30019984) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30019984 (SMED30019984) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30019984 (SMED30019984) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019984

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019984SMESG000007248.1 Contig1130GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019984SMESG000063458.1 Contig1130GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30019984SMESG000063458.1 dd_Smed_v4_1836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019984SMESG000063458.1 dd_Smed_v4_1836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30019984 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000115:130849..131509 -3031
Homology
BLAST of SMED30019984 vs. Ensembl Human
Match: ATP6V1G2 (ATPase H+ transporting V1 subunit G2 [Source:HGNC Symbol;Acc:HGNC:862])

HSP 1 Score: 53.5286 bits (127), Expect = 5.677e-9
Identity = 41/115 (35.65%), Postives = 71/115 (61.74%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ +ARKRK RRLKQAKE+A+ E+E Y+ E E +F + ++   G++G     V Q   ++++ ++ S Q+++   L  LL  V ++   +H N++
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of SMED30019984 vs. Ensembl Human
Match: ATP6V1G2 (ATPase H+ transporting V1 subunit G2 [Source:HGNC Symbol;Acc:HGNC:862])

HSP 1 Score: 53.5286 bits (127), Expect = 5.677e-9
Identity = 41/115 (35.65%), Postives = 71/115 (61.74%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ +ARKRK RRLKQAKE+A+ E+E Y+ E E +F + ++   G++G     V Q   ++++ ++ S Q+++   L  LL  V ++   +H N++
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of SMED30019984 vs. Ensembl Human
Match: ATP6V1G2 (ATPase H+ transporting V1 subunit G2 [Source:HGNC Symbol;Acc:HGNC:862])

HSP 1 Score: 53.5286 bits (127), Expect = 5.677e-9
Identity = 41/115 (35.65%), Postives = 71/115 (61.74%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ +ARKRK RRLKQAKE+A+ E+E Y+ E E +F + ++   G++G     V Q   ++++ ++ S Q+++   L  LL  V ++   +H N++
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of SMED30019984 vs. Ensembl Human
Match: ATP6V1G2 (ATPase H+ transporting V1 subunit G2 [Source:HGNC Symbol;Acc:HGNC:862])

HSP 1 Score: 53.5286 bits (127), Expect = 5.677e-9
Identity = 41/115 (35.65%), Postives = 71/115 (61.74%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ +ARKRK RRLKQAKE+A+ E+E Y+ E E +F + ++   G++G     V Q   ++++ ++ S Q+++   L  LL  V ++   +H N++
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of SMED30019984 vs. Ensembl Human
Match: ATP6V1G2 (ATPase H+ transporting V1 subunit G2 [Source:HGNC Symbol;Acc:HGNC:862])

HSP 1 Score: 53.5286 bits (127), Expect = 5.677e-9
Identity = 41/115 (35.65%), Postives = 71/115 (61.74%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ +ARKRK RRLKQAKE+A+ E+E Y+ E E +F + ++   G++G     V Q   ++++ ++ S Q+++   L  LL  V ++   +H N++
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of SMED30019984 vs. Ensembl Celegans
Match: vha-10 (Probable V-type proton ATPase subunit G [Source:UniProtKB/Swiss-Prot;Acc:P91303])

HSP 1 Score: 51.6026 bits (122), Expect = 1.250e-8
Identity = 42/114 (36.84%), Postives = 69/114 (60.53%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNF 420
            +  Q + I  L  AEK AA+KINEARKRK +R KQAK++A++E+E YK++ E +F   E++  G K   E  + +  + ++  +++SV  ++   +  LL  V +I+  LH N 
Sbjct:    1 MASQTQGIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREAEFKAFEQQYLGTKEDIESKIRRDTEDQISGMKQSVAGNKQAVIVRLLQLVCDIKPELHHNL 114          
BLAST of SMED30019984 vs. Ensembl Celegans
Match: vha-10 (Probable V-type proton ATPase subunit G [Source:UniProtKB/Swiss-Prot;Acc:P91303])

HSP 1 Score: 51.6026 bits (122), Expect = 1.250e-8
Identity = 42/114 (36.84%), Postives = 69/114 (60.53%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNF 420
            +  Q + I  L  AEK AA+KINEARKRK +R KQAK++A++E+E YK++ E +F   E++  G K   E  + +  + ++  +++SV  ++   +  LL  V +I+  LH N 
Sbjct:    1 MASQTQGIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREAEFKAFEQQYLGTKEDIESKIRRDTEDQISGMKQSVAGNKQAVIVRLLQLVCDIKPELHHNL 114          
BLAST of SMED30019984 vs. Ensembl Fly
Match: Vha13 (gene:FBgn0283536 transcript:FBtr0346100)

HSP 1 Score: 44.2838 bits (103), Expect = 6.899e-6
Identity = 40/114 (35.09%), Postives = 67/114 (58.77%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNF 420
            +  Q + I  L  AEK AA+K+ EARKRK RRLKQAK++A  EIE +++E ER F   E +  G++      ++  +  +L  +++++Q  +   +  +L  V NI   +H+N+
Sbjct:    1 MASQTQGIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQERERAFKEFEAKHMGSREGVAAKIDADIRVKLADMDRAIQTRKDPFILEILQYVYNISPEVHKNY 114          
BLAST of SMED30019984 vs. Ensembl Fly
Match: Vha13 (gene:FBgn0283536 transcript:FBtr0083804)

HSP 1 Score: 44.2838 bits (103), Expect = 6.899e-6
Identity = 40/114 (35.09%), Postives = 67/114 (58.77%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNF 420
            +  Q + I  L  AEK AA+K+ EARKRK RRLKQAK++A  EIE +++E ER F   E +  G++      ++  +  +L  +++++Q  +   +  +L  V NI   +H+N+
Sbjct:    1 MASQTQGIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQERERAFKEFEAKHMGSREGVAAKIDADIRVKLADMDRAIQTRKDPFILEILQYVYNISPEVHKNY 114          
BLAST of SMED30019984 vs. Ensembl Zebrafish
Match: atp6v1g1 (ATPase H+ transporting V1 subunit G1 [Source:ZFIN;Acc:ZDB-GENE-030131-6965])

HSP 1 Score: 51.9878 bits (123), Expect = 1.654e-8
Identity = 45/115 (39.13%), Postives = 72/115 (62.61%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ EARKRK RRLKQAKE+A++EIE Y+ + E++F T E    G+ G     V++    ++ +++ S QQ++   L  LL  V +I+  +H N++
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVAEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKTKEAAALGSHGNSAVEVDKETVDKMGRIQGSYQQNKEAVLGNLLKMVCDIKPEIHANYR 115          
BLAST of SMED30019984 vs. Ensembl Zebrafish
Match: atp6v1g1 (ATPase H+ transporting V1 subunit G1 [Source:ZFIN;Acc:ZDB-GENE-030131-6965])

HSP 1 Score: 51.9878 bits (123), Expect = 1.654e-8
Identity = 45/115 (39.13%), Postives = 72/115 (62.61%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ EARKRK RRLKQAKE+A++EIE Y+ + E++F T E    G+ G     V++    ++ +++ S QQ++   L  LL  V +I+  +H N++
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVAEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKTKEAAALGSHGNSAVEVDKETVDKMGRIQGSYQQNKEAVLGNLLKMVCDIKPEIHANYR 115          
BLAST of SMED30019984 vs. Ensembl Xenopus
Match: atp6v1g2 (ATPase H+ transporting V1 subunit G2 [Source:NCBI gene;Acc:780301])

HSP 1 Score: 53.1434 bits (126), Expect = 8.157e-9
Identity = 45/115 (39.13%), Postives = 69/115 (60.00%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +T Q + I  L +AEK AA++++EARKRK RRLKQAKE+A+ EIE Y+ E ER+F   +    G +G     V     + L+ ++ S  +++   L  LL  V N++  LH N++
Sbjct:    1 MTSQSQGIQQLLQAEKRAAERVSEARKRKARRLKQAKEEAQVEIEQYRLEREREFQIQQRTALGTQGDLSSEVEARTRQTLQMVQSSHGKNKEAVLRRLLGLVCNVKAELHPNYR 115          
BLAST of SMED30019984 vs. Ensembl Mouse
Match: Atp6v1g2 (ATPase, H+ transporting, lysosomal V1 subunit G2 [Source:MGI Symbol;Acc:MGI:1913487])

HSP 1 Score: 53.5286 bits (127), Expect = 4.230e-9
Identity = 41/115 (35.65%), Postives = 71/115 (61.74%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ +ARKRK RRLKQAKE+A+ E+E Y+ E E++F + ++   G++G     V Q   ++++ ++ S Q+++   L  LL  V  +   +H N++
Sbjct:    1 MASQTQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCEVRPQVHPNYR 115          
BLAST of SMED30019984 vs. Ensembl Mouse
Match: Atp6v1g1 (ATPase, H+ transporting, lysosomal V1 subunit G1 [Source:MGI Symbol;Acc:MGI:1913540])

HSP 1 Score: 47.7506 bits (112), Expect = 4.915e-7
Identity = 44/117 (37.61%), Postives = 72/117 (61.54%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFKSN 429
            +  Q + I  L +AEK AA+K++EARKRK RRLKQAKE+A++EIE Y+ + E++F   E    G+ G     V +   +++  L+   +Q++   L+ LL  V +I   +H+N++ N
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSHGSCSSEVEKETREKMTVLQNYFEQNRDEVLDNLLAFVCDIRPEIHENYRIN 117          
BLAST of SMED30019984 vs. UniProt/SwissProt
Match: sp|Q5TM18|VATG2_MACMU (V-type proton ATPase subunit G 2 OS=Macaca mulatta OX=9544 GN=ATP6V1G2 PE=3 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.372e-8
Identity = 41/115 (35.65%), Postives = 72/115 (62.61%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ +ARKRK RRLKQAKE+A+ E+E Y+ E E++F + ++   G++G     V Q   ++++ ++ S Q+++   L  LL  V ++   +H N++
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of SMED30019984 vs. UniProt/SwissProt
Match: sp|Q9TSV6|VATG2_PIG (V-type proton ATPase subunit G 2 OS=Sus scrofa OX=9823 GN=ATP6V1G2 PE=3 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.445e-8
Identity = 41/115 (35.65%), Postives = 72/115 (62.61%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ +ARKRK RRLKQAKE+A+ E+E Y+ E E++F + ++   G++G     V Q   ++++ ++ S Q+++   L  LL  V ++   +H N++
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of SMED30019984 vs. UniProt/SwissProt
Match: sp|Q5WR09|VATG1_CANLF (V-type proton ATPase subunit G 1 OS=Canis lupus familiaris OX=9615 GN=ATP6V1G1 PE=3 SV=3)

HSP 1 Score: 54.299 bits (129), Expect = 1.755e-8
Identity = 41/115 (35.65%), Postives = 72/115 (62.61%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ +ARKRK RRLKQAKE+A+ E+E Y+ E E++F + ++   G++G     V Q   ++++ ++ S Q+++   L  LL  V ++   +H N++
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVELYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of SMED30019984 vs. UniProt/SwissProt
Match: sp|O95670|VATG2_HUMAN (V-type proton ATPase subunit G 2 OS=Homo sapiens OX=9606 GN=ATP6V1G2 PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.726e-8
Identity = 41/115 (35.65%), Postives = 71/115 (61.74%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ +ARKRK RRLKQAKE+A+ E+E Y+ E E +F + ++   G++G     V Q   ++++ ++ S Q+++   L  LL  V ++   +H N++
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of SMED30019984 vs. UniProt/SwissProt
Match: sp|Q9WTT4|VATG2_MOUSE (V-type proton ATPase subunit G 2 OS=Mus musculus OX=10090 GN=Atp6v1g2 PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.959e-8
Identity = 41/115 (35.65%), Postives = 71/115 (61.74%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ +ARKRK RRLKQAKE+A+ E+E Y+ E E++F + ++   G++G     V Q   ++++ ++ S Q+++   L  LL  V  +   +H N++
Sbjct:    1 MASQTQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCEVRPQVHPNYR 115          
BLAST of SMED30019984 vs. TrEMBL
Match: A0A194ANT2 (V-type proton ATPase subunit G OS=Pinctada fucata OX=50426 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.098e-9
Identity = 51/115 (44.35%), Postives = 77/115 (66.96%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L KAEK AA+K++EARKRK RRLKQAKE+A++EIE Y+ + E ++   E+   G++G  E  ++Q    ++ +LE +++++Q  AL  LLD VL IE  LH N+K
Sbjct:    1 MASQSQGIQQLLKAEKQAAEKVSEARKRKARRLKQAKEEAQAEIEQYRTQRENQYKKYEQSVLGSRGDMESKIDQSTKVKIVELEDNMKKNQEYALKKLLDMVLLIEPELHINYK 115          
BLAST of SMED30019984 vs. TrEMBL
Match: A0A1I7ZCQ3 (V-type proton ATPase subunit G OS=Steinernema glaseri OX=37863 PE=3 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.375e-9
Identity = 48/115 (41.74%), Postives = 74/115 (64.35%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L  AEK AA+KINEARKRK +RLKQAK++A++EIE Y++E E +F   E++  G KG  E  + +  +++LE +++SV Q++   +  LL  V +I   LH N +
Sbjct:    1 MASQTQGIQKLLAAEKRAAEKINEARKRKAQRLKQAKQEAQAEIEKYRQEREHQFKEYEQKYLGTKGDIEAKIREDTNEQLEAMQRSVAQNKQAVIVRLLQLVCDIRPELHHNLQ 115          
BLAST of SMED30019984 vs. TrEMBL
Match: A0A0B1THN4 (V-type ATPase, G subunit OS=Oesophagostomum dentatum OX=61180 GN=OESDEN_02970 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.461e-9
Identity = 48/127 (37.80%), Postives = 76/127 (59.84%), Query Frame = 1
Query:   40 FVV*SLIFVMSNTLTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNF 420
            F V + + V  + +  Q + I  L  AEK AA+KINEARKRK +R+KQAK++A++E+E Y++E E+KF   E+   G K   E  + +  + E+E ++K+V   +   +  LL  V +I+  LH N 
Sbjct: 1115 FKVPNTLAVTCSGMASQTQGIQQLLAAEKRAAEKINEARKRKFQRMKQAKQEAQAEVEKYRQEREQKFKQYEQTYLGTKEDIESKIRRDTENEIEAMKKNVAAHKQQVIVRLLQLVCDIKPELHHNL 1241          
BLAST of SMED30019984 vs. TrEMBL
Match: R7TGP4 (V-type proton ATPase subunit G OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_150810 PE=3 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 8.749e-9
Identity = 47/116 (40.52%), Postives = 80/116 (68.97%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFKS 426
            +  Q  +I  L  AEK AA+K++EARKRK +RLKQAKE+A++EIE YK+E ER++   E++  G+KG  E  ++Q    ++++LE+++  ++  A+  LL  V +I+  LH+N+++
Sbjct:    1 MASQNTAIQQLLNAEKRAAEKVSEARKRKGKRLKQAKEEAQNEIEGYKQERERQYRQHEQQILGSKGDMESKIDQTTHVKMQELEQNMAANKEKAMQRLLMLVCDIKPELHENYRA 116          
BLAST of SMED30019984 vs. TrEMBL
Match: K1R0T1 (V-type proton ATPase subunit G OS=Crassostrea gigas OX=29159 GN=CGI_10026004 PE=3 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.010e-8
Identity = 47/115 (40.87%), Postives = 77/115 (66.96%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q   I  L KAEK AA+K+++ARKRK +RLKQAKE+A+ EIE Y+ + E ++   E+   G++G  E  ++     +L++LE ++ +++ +AL  LLD VL+I+  LH+N+K
Sbjct:    1 MASQSTGIQQLLKAEKQAAEKVSDARKRKAKRLKQAKEEAQQEIEQYRAQREAQYKKYEQSVLGSRGDMESKIDVTTKIKLKELETNMSKNKEVALKRLLDIVLDIKPELHENWK 115          
BLAST of SMED30019984 vs. Ensembl Cavefish
Match: ENSAMXT00000006945.2 (ATPase H+ transporting V1 subunit G1 [Source:NCBI gene;Acc:103024358])

HSP 1 Score: 51.6026 bits (122), Expect = 1.521e-8
Identity = 45/115 (39.13%), Postives = 73/115 (63.48%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L +AEK AA+K+ +ARKRK RRLKQAKE+A++EIE Y+ + E++F T E    G+ G     V++    +++++E S  Q++   LN LL  V +I+  +H N++
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKTKEAAALGSHGNSAVEVDKETLDKMKRIETSYHQNREAVLNNLLKMVCDIKPEIHVNYR 115          
BLAST of SMED30019984 vs. Ensembl Nematostella
Match: EDO34520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP62])

HSP 1 Score: 56.6102 bits (135), Expect = 7.884e-11
Identity = 45/115 (39.13%), Postives = 71/115 (61.74%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +  Q + I  L  AEK AAD + +ARKRK ++LKQAKE A +EI+ YK E E++F   ++E  G+K  ++  + +    +L+++E  V Q + L +  LL  V +I+  LHQNF+
Sbjct:    1 MASQSQGIQQLLVAEKKAADLVADARKRKTKKLKQAKEQAVAEIDNYKSEREKQFLEYQKEHMGSKDDFQAKIEEATKSQLDQMEDDVNQHKDLVIERLLSLVYDIKPELHQNFR 115          
BLAST of SMED30019984 vs. Ensembl Medaka
Match: atp6v1g1 (V-type proton ATPase subunit G 1 [Source:NCBI gene;Acc:101172700])

HSP 1 Score: 46.595 bits (109), Expect = 2.494e-6
Identity = 43/117 (36.75%), Postives = 71/117 (60.68%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFKSN 429
            +  Q + I  L +AEK AA+K+ EARKRK RRLKQAKE+A++EIE Y+ + E++F T E    G+ G     V++   + + +++ S + ++   L  LL +V +I+   H + +S 
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVAEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKTKEAAALGSHGNSAVEVDRDTVERMARIQDSYRSNREAVLGELLRRVCDIQPEFHNHSRST 117          
BLAST of SMED30019984 vs. Planmine SMEST
Match: SMESG000063458.1 (SMESG000063458.1)

HSP 1 Score: 215.312 bits (547), Expect = 2.228e-72
Identity = 121/121 (100.00%), Postives = 121/121 (100.00%), Query Frame = 1
Query:   67 MSNTLTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFKSN 429
            MSNTLTPQFRSIDALRKAEKNAADKINEARKRKQRRLKQAKEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFKSN
Sbjct:    1 MSNTLTPQFRSIDALRKAEKNAADKINEARKRKQRRLKQAKEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFKSN 121          
BLAST of SMED30019984 vs. Planmine SMEST
Match: SMESG000078548.1 (SMESG000078548.1)

HSP 1 Score: 57.3806 bits (137), Expect = 9.864e-11
Identity = 46/115 (40.00%), Postives = 73/115 (63.48%), Query Frame = 1
Query:   79 LTPQFRSIDALRKAEKNAADKINEXXXXXXXXXXXXXEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 423
            +T +   I  L  AEK AA K+NEARK+K  +L++AKE A+ EIE  K  MER+F T +E+  G++  YE  + +  DK++ ++ + V  ++  A+  LL+ VL+IE  +H NF+
Sbjct:    1 MTSENDGIQKLLAAEKEAAKKVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 115          
The following BLAST results are available for this feature:
BLAST of SMED30019984 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP6V1G25.677e-935.65ATPase H+ transporting V1 subunit G2 [Source:HGNC ... [more]
ATP6V1G25.677e-935.65ATPase H+ transporting V1 subunit G2 [Source:HGNC ... [more]
ATP6V1G25.677e-935.65ATPase H+ transporting V1 subunit G2 [Source:HGNC ... [more]
ATP6V1G25.677e-935.65ATPase H+ transporting V1 subunit G2 [Source:HGNC ... [more]
ATP6V1G25.677e-935.65ATPase H+ transporting V1 subunit G2 [Source:HGNC ... [more]
back to top
BLAST of SMED30019984 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vha-101.250e-836.84Probable V-type proton ATPase subunit G [Source:U... [more]
vha-101.250e-836.84Probable V-type proton ATPase subunit G [Source:U... [more]
back to top
BLAST of SMED30019984 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Vha136.899e-635.09gene:FBgn0283536 transcript:FBtr0346100[more]
Vha136.899e-635.09gene:FBgn0283536 transcript:FBtr0083804[more]
back to top
BLAST of SMED30019984 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
atp6v1g11.654e-839.13ATPase H+ transporting V1 subunit G1 [Source:ZFIN;... [more]
atp6v1g11.654e-839.13ATPase H+ transporting V1 subunit G1 [Source:ZFIN;... [more]
back to top
BLAST of SMED30019984 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp6v1g28.157e-939.13ATPase H+ transporting V1 subunit G2 [Source:NCBI ... [more]
back to top
BLAST of SMED30019984 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Atp6v1g24.230e-935.65ATPase, H+ transporting, lysosomal V1 subunit G2 [... [more]
Atp6v1g14.915e-737.61ATPase, H+ transporting, lysosomal V1 subunit G1 [... [more]
back to top
BLAST of SMED30019984 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5TM18|VATG2_MACMU1.372e-835.65V-type proton ATPase subunit G 2 OS=Macaca mulatta... [more]
sp|Q9TSV6|VATG2_PIG1.445e-835.65V-type proton ATPase subunit G 2 OS=Sus scrofa OX=... [more]
sp|Q5WR09|VATG1_CANLF1.755e-835.65V-type proton ATPase subunit G 1 OS=Canis lupus fa... [more]
sp|O95670|VATG2_HUMAN2.726e-835.65V-type proton ATPase subunit G 2 OS=Homo sapiens O... [more]
sp|Q9WTT4|VATG2_MOUSE2.959e-835.65V-type proton ATPase subunit G 2 OS=Mus musculus O... [more]
back to top
BLAST of SMED30019984 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A194ANT21.098e-944.35V-type proton ATPase subunit G OS=Pinctada fucata ... [more]
A0A1I7ZCQ32.375e-941.74V-type proton ATPase subunit G OS=Steinernema glas... [more]
A0A0B1THN45.461e-937.80V-type ATPase, G subunit OS=Oesophagostomum dentat... [more]
R7TGP48.749e-940.52V-type proton ATPase subunit G OS=Capitella teleta... [more]
K1R0T12.010e-840.87V-type proton ATPase subunit G OS=Crassostrea giga... [more]
back to top
BLAST of SMED30019984 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000006945.21.521e-839.13ATPase H+ transporting V1 subunit G1 [Source:NCBI ... [more]
back to top
BLAST of SMED30019984 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019984 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019984 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO345207.884e-1139.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30019984 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp6v1g12.494e-636.75V-type proton ATPase subunit G 1 [Source:NCBI gene... [more]
back to top
BLAST of SMED30019984 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000063458.12.228e-72100.00SMESG000063458.1[more]
SMESG000078548.19.864e-1140.00SMESG000078548.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019984 ID=SMED30019984|Name=SMED30019984|organism=Schmidtea mediterranea sexual|type=transcript|length=618bp
ATTCAAATATTAAGAAATTATTCGGAATTTATCTATATTTTTGTCGTTTA
ATCACTAATTTTCGTCATGTCAAATACTTTAACACCACAATTTAGAAGCA
TTGATGCATTACGAAAAGCTGAAAAAAATGCTGCTGATAAAATTAATGAA
GCTAGAAAAAGAAAACAGAGACGATTGAAACAAGCAAAAGAGGATGCTAA
GAGCGAAATAGAAGCTTACAAAGAAGAAATGGAGCGTAAATTTCATACAC
TCGAAGAAGAAGAGACTGGTAACAAGGGCCAATATGAAGGCTTTGTAAAT
CAAATGATGGACAAAGAGTTGGAAAAGCTAGAAAAATCAGTTCAACAGAG
CCAGCATTTAGCATTAAATATTTTGTTAGATAAAGTATTGAATATCGAAA
CGAGTCTCCACCAAAATTTTAAATCAAATTGAAAGATTCTACTGAAGATC
CAGATCCGCGATTTTTGACGCAGTTGATTAGCATAATAACAATAGATTAA
TTTTAATGATAAATTTGTTGTGTATTTATTATCGATTTTCATGAATCAAT
CAGTGTGATTTTATCAACTCGAGATTGAGTCATTTTTGCGAAATATAATT
TATGATTGTGGAAAACAA
back to top

protein sequence of SMED30019984-orf-1

>SMED30019984-orf-1 ID=SMED30019984-orf-1|Name=SMED30019984-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=122bp
MSNTLTPQFRSIDALRKAEKNAADKINEARKRKQRRLKQAKEDAKSEIEA
YKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLAL
NILLDKVLNIETSLHQNFKSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005124V-ATPase_G
Vocabulary: molecular function
TermDefinition
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0016820hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0015992proton transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016471vacuolar proton-transporting V-type ATPase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 12..65
NoneNo IPR availableCOILSCoilCoilcoord: 78..98
NoneNo IPR availableGENE3DG3DSA:1.20.5.620coord: 5..63
e-value: 3.1E-16
score: 61.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 23..45
IPR005124Vacuolar (H+)-ATPase G subunitTIGRFAMTIGR01147TIGR01147coord: 9..117
e-value: 8.1E-25
score: 85.5
IPR005124Vacuolar (H+)-ATPase G subunitPFAMPF03179V-ATPase_Gcoord: 10..110
e-value: 4.0E-23
score: 81.9
IPR005124Vacuolar (H+)-ATPase G subunitPANTHERPTHR12713VACUOLAR ATP SYNTHASE SUBUNIT Gcoord: 11..111