SMED30019976

Overview
NameSMED30019976
Smed IDSMED30019976
Length (bp)1061
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019976

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30019976h1SMcG0021131 Contig37979newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30019976h1SMcG0021131 Contig37979uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30019976h1SMcG0022045 Contig37979newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30019976h1SMcG0022045 Contig37979uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30019976 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001362:31582..32642 +5305
Homology
BLAST of SMED30019976 vs. Ensembl Zebrafish
Match: BX914205.2 (pep chromosome:GRCz11:4:64121772:64123545:-1 gene:ENSDARG00000099590.2 transcript:ENSDART00000170040.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX914205.2)

HSP 1 Score: 73.559 bits (179), Expect = 4.961e-14
Identity = 57/181 (31.49%), Postives = 86/181 (47.51%), Query Frame = -2
Query:  488 KASARYEKEFWPELEQDIKKWIIKERTKCRQVSM**FRSXXXXXXXXXXXXXXXXGDHDS*TDTNYRF--------------ARQLPLD--KDFQLIRKK-NRR*KKTGIKAQHIVNIDKVLVSFNMIRNHTIDYKGAKEVKIISTDHEKSNFTIILCAIRGGGKCTPIVNLKRKIFLPNE 979
            K S R  K  WP+LE  +++WII++RT  R VS     +   +       +              +RF              A+QLP D  +   + R   + +     I+ +HI N+D+V ++F++  NHT++ KGA  V I +T HEKS FT++L     G K  P+V  KRK  LP E
Sbjct:   57 KQSFRGNKARWPQLEDQLEQWIIEQRTAGRSVS-----TVTIRLRATKIAQDMGIEHFQGGPSWCFRFMKRRHLSIRARTTVAQQLPADYKEKLDIFRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSIRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKT-LPKE 231          
BLAST of SMED30019976 vs. Ensembl Zebrafish
Match: CR352209.1 (pep chromosome:GRCz11:24:26088143:26089609:1 gene:ENSDARG00000103972.2 transcript:ENSDART00000171129.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR352209.1)

HSP 1 Score: 73.1738 bits (178), Expect = 7.483e-14
Identity = 57/181 (31.49%), Postives = 86/181 (47.51%), Query Frame = -2
Query:  488 KASARYEKEFWPELEQDIKKWIIKERTKCRQVSM**FRSXXXXXXXXXXXXXXXXGDHDS*TDTNYRF--------------ARQLPLD--KDFQLIRKK-NRR*KKTGIKAQHIVNIDKVLVSFNMIRNHTIDYKGAKEVKIISTDHEKSNFTIILCAIRGGGKCTPIVNLKRKIFLPNE 979
            K S R  K  WP+LE  +++WII++RT  R VS     +   +       +              +RF              A+QLP D  +   + R   + +     I+ +HI N+D+V ++F++  NHT++ KGA  V I +T HEKS FT++L     G K  P+V  KRK  LP E
Sbjct:   57 KQSFRGNKARWPQLEDQLEQWIIEQRTAGRSVS-----TVTIRLRATKIAQDMGIEHFQGGPSWCFRFMKRRHLSIRARTTVAQQLPADYKEKLDIFRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSIRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKT-LPKE 231          
BLAST of SMED30019976 vs. Ensembl Zebrafish
Match: CR354398.1 (pep chromosome:GRCz11:7:64150332:64152087:-1 gene:ENSDARG00000101994.2 transcript:ENSDART00000165234.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR354398.1)

HSP 1 Score: 73.1738 bits (178), Expect = 8.407e-14
Identity = 57/181 (31.49%), Postives = 86/181 (47.51%), Query Frame = -2
Query:  488 KASARYEKEFWPELEQDIKKWIIKERTKCRQVSM**FRSXXXXXXXXXXXXXXXXGDHDS*TDTNYRF--------------ARQLPLD--KDFQLIRKK-NRR*KKTGIKAQHIVNIDKVLVSFNMIRNHTIDYKGAKEVKIISTDHEKSNFTIILCAIRGGGKCTPIVNLKRKIFLPNE 979
            K S R  K  WP+LE  +++WII++RT  R VS     +   +       +              +RF              A+QLP D  +   + R   + +     I+ +HI N+D+V ++F++  NHT++ KGA  V I +T HEKS FT++L     G K  P+V  KRK  LP E
Sbjct:   57 KQSFRGNKARWPQLEDQLEQWIIEQRTAGRSVS-----TVTIRLRATKIAQDMGIEHFQGGPSWCFRFMKRRHLSIRARTTVAQQLPADYKEKLDIFRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSIRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKT-LPKE 231          
BLAST of SMED30019976 vs. TrEMBL
Match: A0A3P8Q0X0 (Uncharacterized protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 5.987e-13
Identity = 76/250 (30.40%), Postives = 123/250 (49.20%), Query Frame = -2
Query:  242 SARYEKEFWPELEQDIKKWIIKERTKCRQVSM**FRSXXXXXXXXXXXXXXXXGDHDS*TDTNYRFARQLPLDKDFQLIRKKNRR*KKTG---IKAQHIVNIDKVLVSFNMIRNHTIDYKGAKEVKIISTDHEKSNFTIILCAIRGGGKCTPIVNLKRKIFLPNEFXXXXXXXXXXXVWLIKKSNVSGLKWSGVCEKMLSFKNIAKSFLIWDFVTPRVVEDI*NLFVFGSY*KWVLK---SKDLQLRDYG 973
            S R  K  WPELE+ +++WII++RT  R +S    R       K  +L   +   H S   T    A+QLP D   +L   ++   K  G   I+  HI N+D+V ++F++  +HT++ +G   V I +T HEKS+FT++L     G K  P+V  KRK     +F   +++K N   W+ ++     L+   V  +   F + + S LI D +   +  D+  L    +    V+    +K+LQL D G
Sbjct:   57 SFRGHKARWPELEERLERWIIEQRTSGRSISTVTIR------LKAVSLSLFVKLCHFS-IRTRTTVAQQLPADYKEKLAIFRSYCSKHIGDKNIQPSHITNMDEVPLTFDIPVSHTVEKQGTSTVAICTTGHEKSSFTVVLGCHANGQKLPPMVIFKRKTLPKEKFPAGIIIKANEKGWMDEEMMKEWLREMYV-RRPGGFFHASPSLLICDSMRAHLTADVKKLVKQMNCELAVIPGGLTKELQLLDIG 298          
BLAST of SMED30019976 vs. TrEMBL
Match: A0A3P8QU07 (Uncharacterized protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.040e-12
Identity = 58/165 (35.15%), Postives = 83/165 (50.30%), Query Frame = -2
Query:  488 SARYEKEFWPELEQDIKKWIIKERTKCRQVSM**FRSXXXXXXXXXXXXXXXXGDHDS*TDTNYRFARQLPLDKDFQLIRKKNRR*KKTG---IKAQHIVNIDKVLVSFNMIRNHTIDYKGAKEVKIISTDHEKSNFTIILCAIRGGGKCTPIVNLKRKIFLPNE 973
            S R  K  WPELE+ +++WII++RT  R VS    R K                       T    A+QLP D   +L   ++   K  G   I+  HI N+D+V ++F++  +HT++ KG   V I +T HEKS+FT++L     G K  P+V  KRK  LP E
Sbjct:   57 SFRGHKARWPELEERLERWIIEQRTSGRSVSTVTIRLKAVSLSLFMKRCHFSIR-------TRTTVAQQLPADYKEKLAILRSYCSKHIGDKNIQPSHITNMDEVPLTFDIPVSHTVEKKGTSMVAIRTTGHEKSSFTVVLGCHANGQKLPPMVIFKRKT-LPKE 213          
BLAST of SMED30019976 vs. TrEMBL
Match: A0A3P9AVH5 (Uncharacterized protein OS=Maylandia zebra OX=106582 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.138e-12
Identity = 61/165 (36.97%), Postives = 88/165 (53.33%), Query Frame = -2
Query:  488 SARYEKEFWPELEQDIKKWIIKERTKCRQVSM**FRSXXXXXXXXXXXXXXXXGDHDS*TDTNYRFARQLPLDKDFQLIRKKNRR*KKTG---IKAQHIVNIDKVLVSFNMIRNHTIDYKGAKEVKIISTDHEKSNFTIILCAIRGGGKCTPIVNLKRKIFLPNE 973
            S R  K  WPELE+ +++WII++RT  R VS    R       K  +L   +   H S   T    A+QLP D   +L   ++   K  G   I+  HI N+D+V ++F++  +HT++ KG   V I +T HEKS+FT++L     G K  P+V  KRK  LP E
Sbjct:   57 SFRGHKARWPELEERLERWIIEQRTSGRSVSTVTIR------LKAVSLSLFMKRCHFS-IRTRTTVAQQLPADYKEKLAIFRSYCSKHIGDKNIQPSHITNMDEVPLTFDIPVSHTVEKKGTSTVAIRTTGHEKSSFTVVLDCHANGQKLPPMVIFKRKT-LPKE 213          
BLAST of SMED30019976 vs. TrEMBL
Match: A0A2G9UMS9 (DDE superfamily endonuclease OS=Teladorsagia circumcincta OX=45464 GN=TELCIR_07348 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.809e-12
Identity = 60/181 (33.15%), Postives = 90/181 (49.72%), Query Frame = -2
Query:  485 SKKASARYEKEFWPELEQDIKKWIIKERTKCRQVSM**FRSXXXXXXXXXXXXXXXXGDHDS*T-----DTNYRFA----RQLPLD-----KDFQLIRKKNRR*KKTGIKAQHIVNIDKVLVSFNMIRNHTIDYKGAKEVKIISTDHEKSNFTIILCAIRGGGKCTPIVNLKRKIFLPNEF 985
            S K + R ++E WPELE ++  W+  ER K  QVS      + +K  +   L   LG  H   +     +   R A    + LPLD      D+ L  ++       GI  + I N+D+V V+F+M    T+D +G + V I++T  EK+NFT++LC +  G KC P+V  KRK      F
Sbjct:   57 STKRANRGKREAWPELENELSTWVRSERNKGAQVSTIRIIREARKIARSLQLDDFLGTPHWCHSFMERKNLTVRRATSVGQSLPLDWEKKVADYHLFFQR----ATAGISQKDIGNMDEVPVAFDMPAARTVDIRGTQNVSIVTTGAEKANFTVVLCVLADGRKCQPMVIFKRKTLPKGPF 233          
BLAST of SMED30019976 vs. TrEMBL
Match: A0A3P8P742 (Uncharacterized protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.868e-12
Identity = 67/222 (30.18%), Postives = 106/222 (47.75%), Query Frame = -2
Query:  317 SARYEKEFWPELEQDIKKWIIKERTKCRQVSM**FRSXXXXXXXXXXXXXXXXGDHDS*TDTNYRFARQLPLDKDFQLIRKKNRR*KKTG---IKAQHIVNIDKVLVSFNMIRNHTIDYKGAKEVKIISTDHEKSNFTIILCAIRGGGKCTPIVNLKRKIFLPNEFXXXXXXXXXXXVWLIKKSNVSGLKWSGVCEKMLSFKNIAKSFLIWDFVTPRVVEDI 973
            S R  K  WPELE+ +++WII++RT  R V     R K                       T    A+QLP D   +L   ++   K  G   I+  HI N+D+V ++F++  +HT++ KG   V I +T HEKS+FT++L     G K  P+V  KRK F   +F   +++K N   W+ ++     L+   V  +   F + + S LI D +   +  D+
Sbjct:   57 SFRGHKARWPELEERLERWIIEQRTSGRSVLTVTIRLKAVSLSLFMKRCHFSIR-------TRTTVAQQLPADYKEKLAIFRSYCSKHIGDKNIQPSHITNMDEVPLTFDIPVSHTVEKKGTSTVAIRTTGHEKSSFTVVLGCHANGQKLPPMVIFKRKTFPKEKFPAGIIIKANEKGWMDEEMMKEWLREVYV-RRPGGFFHASPSLLICDSMRAHLTADV 270          
BLAST of SMED30019976 vs. Planmine SMEST
Match: SMESG000052069.1 (SMESG000052069.1)

HSP 1 Score: 63.929 bits (154), Expect = 7.932e-12
Identity = 55/177 (31.07%), Postives = 85/177 (48.02%), Query Frame = -2
Query:  497 KKASARYEKEFWPELEQDIKKWIIKERTKCRQVSM**FRSXXXXXXXXXXXXXXXXGDHDS*TDTNYR----------FARQLPLDKDFQLIRKKNRR*KKTGIKAQHIVNIDKVLVSFNMIRNHTIDYKGAKEVKIISTDHEKSNFTIILCAIRGGGKCTPIV-----NLKRKIFL 982
            +  +ARY     PELE  + +WI+ +R +  QVS+  FR +LQ +     +K          TD   +            +QLP D +FQ+ + +N       +    I N D+V V  +M   +T++ KG  EV+I +T HEK  FT+ LC ++ G K  P V     N++R  FL
Sbjct:    9 RGGNARY-----PELETKLHEWILIQRERELQVSV--FRIRLQAQVIAKEMKIEGFAASSQLTDNFMKRKNICVRRTITKQQLPKDWEFQMAKFRN---TIADLLDNQIGNFDEVSVQCDMPLGYTVETKGTNEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVILGTRNIQRLSFL 175          
BLAST of SMED30019976 vs. Planmine SMEST
Match: SMESG000055010.1 (SMESG000055010.1)

HSP 1 Score: 38.5058 bits (88), Expect = 1.051e-7
Identity = 16/33 (48.48%), Postives = 22/33 (66.67%), Query Frame = -2
Query:  881 KASARYEKEFWPELEQDIKKWIIKERTKCRQVS 979
            K + R+ KEFWPELE  +K W++ ER    +VS
Sbjct:    5 KRARRFRKEFWPELESVLKDWVLSERLNGSRVS 37          

HSP 2 Score: 36.1946 bits (82), Expect = 1.051e-7
Identity = 18/36 (50.00%), Postives = 23/36 (63.89%), Query Frame = -1
Query:  708 W*PRFMNRHQLSVCATTSVGQRLSID*EEKSAIKKD 815
            W  RFM RH+LS+ A TSVGQ L  D +EK    ++
Sbjct:   68 WCIRFMRRHRLSIRAVTSVGQNLPEDWKEKCVFDEE 103          
BLAST of SMED30019976 vs. Planmine SMEST
Match: SMESG000040582.1 (SMESG000040582.1)

HSP 1 Score: 50.8322 bits (120), Expect = 5.566e-7
Identity = 28/77 (36.36%), Postives = 41/77 (53.25%), Query Frame = -2
Query:  494 KTGIKAQHIVNIDKVLVSFNMIRNHTIDYKGAKEVKIISTDHEKSNFTIILCAIRGGGKCTPIVNLKRK----IFLP 712
            K  +    I N D+V +  +M   +T++ KGA EV+I +  HEK  FT+ LC ++ G K  P V L  K     F+P
Sbjct:  148 KKDLPDNQIGNFDEVSIQCDMTLGYTVETKGANEVRIKTKGHEKKRFTVNLCVLKDGTKLPPFVILGTKKHTNTFIP 224          
The following BLAST results are available for this feature:
BLAST of SMED30019976 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019976 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019976 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019976 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
BX914205.24.961e-1431.49pep chromosome:GRCz11:4:64121772:64123545:-1 gene:... [more]
CR352209.17.483e-1431.49pep chromosome:GRCz11:24:26088143:26089609:1 gene:... [more]
CR354398.18.407e-1431.49pep chromosome:GRCz11:7:64150332:64152087:-1 gene:... [more]
back to top
BLAST of SMED30019976 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019976 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019976 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019976 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8Q0X05.987e-1330.40Uncharacterized protein OS=Astatotilapia callipter... [more]
A0A3P8QU071.040e-1235.15Uncharacterized protein OS=Astatotilapia callipter... [more]
A0A3P9AVH51.138e-1236.97Uncharacterized protein OS=Maylandia zebra OX=1065... [more]
A0A2G9UMS91.809e-1233.15DDE superfamily endonuclease OS=Teladorsagia circu... [more]
A0A3P8P7421.868e-1230.18Uncharacterized protein OS=Astatotilapia callipter... [more]
back to top
BLAST of SMED30019976 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019976 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019976 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019976 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019976 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019976 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000052069.17.932e-1231.07SMESG000052069.1[more]
SMESG000055010.11.051e-748.48SMESG000055010.1[more]
SMESG000040582.15.566e-736.36SMESG000040582.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019976 ID=SMED30019976|Name=SMED30019976|organism=Schmidtea mediterranea sexual|type=transcript|length=1061bp
CATGTTGGCACTCAAAGGGTTAATGCTGAATTCAAACATGAAGTAATTAA
ATAGGAGGTAATTGAAAAAAAGTCTATTTAAAAAAATCTTTGAAAGACTT
AATCAAAATCTGTTTCAAATGATTTTCCTATATCAATACGCATAGCCGAT
ACATAATCATTAGGTAACTATTCTTCCGATGTTGTCTCTTCTGCCTCTTC
ATCAGTAGATCTCATTGAATAATTGATGGTGCCATTCACTCTCCGTAGTC
TCGTAATTGTAAATCCTTGCTTTTCAAAACCCATTTTTAATAACTGCCAA
AAACGAACAGGTTTTATATATCTTCAACGACGCGCGGTGTTACAAAGTCC
CATATGAGGAAAGATTTTGCGATATTTTTAAAAGAAAGCATCTTTTCACA
CACACCAGACCACTTCAAGCCACTCACATTTGATTTTTTGATTAACCAAA
CATTAGAATTTACTTTCACAACAACTCTTCTTGAGAACTCATTGGGTAAA
AAAATTTTTCTTTTCAAATTAACAATTGGTGTGCATTTTCCCCCGCCTCT
AATCGCACATAAGATAATAGTGAAATTTGATTTTTCGTGATCTGTTGATA
TAATTTTAACTTCTTTCGCGCCTTTATAATCAATGGTATGATTTCTAATC
ATATTAAAGCTAACCAGCACTTTGTCAATATTCACAATATGTTGTGCCTT
AATGCCTGTCTTTTTTTATCGCCGATTTTTCTTCCTAATCAATTGAAAGT
CTTTGTCCAACGGAAGTTGTCGCGCAAACCGATAATTGGTGTCTGTTCAT
GAATCGTGGTCACCACCGAGAGGTCCTTTTAAATTCGGTTTTTTTTCTTT
TTTTTGCAGCTTTGACCTAAATTATTACATAGACACTTGTCTGCATTTAG
TTCTCTCTTTAATTATCCATTTCTTTATGTCTTGCTCCAACTCTGGCCAA
AATTCCTTTTCATATCTTGCACTCGCTTTCTTGGATTCATCACTTGTTTG
CGCTATTCCTGGACACTCGACTCCCGACAATATACAATCGCGTAGCAGCT
CTGTTACTATG
back to top

protein sequence of SMED30019976-orf-1

>SMED30019976-orf-1 ID=SMED30019976-orf-1|Name=SMED30019976-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=113bp
MIRNHTIDYKGAKEVKIISTDHEKSNFTIILCAIRGGGKCTPIVNLKRKI
FLPNEFSRRVVVKVNSNVWLIKKSNVSGLKWSGVCEKMLSFKNIAKSFLI
WDFVTPRVVEDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ