E3 ubiquitin-protein ligase

Overview
NameE3 ubiquitin-protein ligase
Smed IDSMED30019975
Length (bp)2921
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase (SMED30019975) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase (SMED30019975) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase (SMED30019975) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase (SMED30019975) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019975

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019975SMESG000008708.1 PL08002A1A01ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30019975SMESG000008708.1 dd_Smed_v4_1444_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019975SMESG000008708.1 dd_Smed_v4_1444_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019975SMESG000008708.1 dd_Smed_v4_1444_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019975SMESG000008708.1 dd_Smed_v4_1444_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Human
Match: WWP1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:17004])

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 347/589 (58.91%), Postives = 441/589 (74.87%), Query Frame = 1
Query:  661 AADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX--------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            + + +T+ LP  +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP +  + N + +Q  R +    M+Q  NQRY        A+N        DP G LP GWEKR D+ +R YFVNH  KTT W+DPR Q      PLP GWEIR+T +G+ +FVDH T+TTT         +  +  P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++T++D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GK+   +LK  G +I VTEENK+EYI LM  WRFSRGV EQTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D+ DW+ N++YR YT++S QI WFW+FV +  N+ ++RLLQFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:  343 SGNANTETLPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRRRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQ-FNQRYLYSASMLAAEN--------DPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQGLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYERGFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDNEVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 922          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Human
Match: WWP1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:17004])

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 347/589 (58.91%), Postives = 441/589 (74.87%), Query Frame = 1
Query:  661 AADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX--------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            + + +T+ LP  +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP +  + N + +Q  R +    M+Q  NQRY        A+N        DP G LP GWEKR D+ +R YFVNH  KTT W+DPR Q      PLP GWEIR+T +G+ +FVDH T+TTT         +  +  P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++T++D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GK+   +LK  G +I VTEENK+EYI LM  WRFSRGV EQTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D+ DW+ N++YR YT++S QI WFW+FV +  N+ ++RLLQFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:  343 SGNANTETLPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRRRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQ-FNQRYLYSASMLAAEN--------DPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQGLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYERGFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDNEVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 922          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Human
Match: WWP2 (WW domain containing E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:16804])

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 342/585 (58.46%), Postives = 436/585 (74.53%), Query Frame = 1
Query:  655 LPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPR----LQANPLPPGWEIRFTEDGMAFFVDHEXXXXX--------XXXXXXXXXXAEETQFLRKQSQFYYYCQ-NAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            LPAA  + D LP  +E+R     R Y+VDH TKTT+WE  +PLPPGWE+R D   R YYVDHNTRTTTWQRP    + N + +Q  R +    M Q  +QR+  Q+ + +    DPLG LP GWEKR D N R Y+VNH  +TT W+DPR    +Q   LPPGWE+++T +G+ +FVDH T+TTT         +  +     A +  F  K  QF + C  NA+P  HVKI V R  L EDSF +IM +KP DL++RL+I  + E+GLDYGGI+REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YFRF+GRF+AMA++H KFID+GFT+PFYK+ML KR TL+D+E++D E+YNS+ +I++NN++EC + L F  + E+ GK+   ELK  G  I VTEENK EYI L+ +WRF+RGV EQTKAF+DGFNE+  L WL+ +DE+++EL+LCGMQ+ID+ DW+ ++IYR YTK+S QI+WFW+ V ++ N+++IRLLQFVTGTCRLPVGGF EL+GSNGPQKFCI+K+GKE+WLPRSHTCFNRLDLPPY SYEQL+EKL YA+ ETEGFGQE
Sbjct:  292 LPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWE--RPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAM-QHFSQRFLYQSSSASTDH-DPLGPLPPGWEKRQD-NGRVYYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPS-HVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIKENNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFNRLDLPPYKSYEQLREKLLYAIEETEGFGQE 870          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Human
Match: ITCH (itchy E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:13890])

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 345/629 (54.85%), Postives = 455/629 (72.34%), Query Frame = 1
Query:  535 ASTINIPEEDRPRANATGNLRGSNNSL--PVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQR--YGAQNWAGNIQ--RVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQAN----PLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEET-------QFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            +ST ++P    P    T    G+ + L  P++ S  +  R + P   ++  PLP  +E+R D   R Y+VDH+ K T+W+ P+PLPPGWERR+D   R+YYVDH TRTTTWQRP +  + N + +Q  R++    M+Q  NQR  YG Q+     Q    DPLG LP GWEKRTD+N R YFVNH  + T W+DPR Q      PLP GWE+RFT DG+ +FVDH  +TTT+ DPRT     +          F  K   F ++CQ      H+KI V R  L EDSF +IM   P+DL++RL++ F  E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS+INP+HL+YFRF+GRF+AMA+FH KFID+GF++PFYK++L K + L+D+E++D E+YNSL ++++NNI+ECD+ + FS + E+ G+I+  +LK NG +I VTEENK EYI ++  WR SRGV EQT+AF +GFNEI+   +LQ +D +++E+LLCGMQ+ID+ DW+ ++IYR Y + S QI WFW+FV ++ N++++RLLQFVTGTCRLPVGGF +LMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:  280 SSTGSLP----PTNTNTNTSEGATSGLIIPLTISGGSGPRPLNP---VTQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPEPLPPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQ-FNQRFIYGNQDLFATSQSKEFDPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECDLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYARTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 900          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Human
Match: ITCH (itchy E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:13890])

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 345/629 (54.85%), Postives = 455/629 (72.34%), Query Frame = 1
Query:  535 ASTINIPEEDRPRANATGNLRGSNNSL--PVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQR--YGAQNWAGNIQ--RVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQAN----PLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEET-------QFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            +ST ++P    P    T    G+ + L  P++ S  +  R + P   ++  PLP  +E+R D   R Y+VDH+ K T+W+ P+PLPPGWERR+D   R+YYVDH TRTTTWQRP +  + N + +Q  R++    M+Q  NQR  YG Q+     Q    DPLG LP GWEKRTD+N R YFVNH  + T W+DPR Q      PLP GWE+RFT DG+ +FVDH  +TTT+ DPRT     +          F  K   F ++CQ      H+KI V R  L EDSF +IM   P+DL++RL++ F  E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS+INP+HL+YFRF+GRF+AMA+FH KFID+GF++PFYK++L K + L+D+E++D E+YNSL ++++NNI+ECD+ + FS + E+ G+I+  +LK NG +I VTEENK EYI ++  WR SRGV EQT+AF +GFNEI+   +LQ +D +++E+LLCGMQ+ID+ DW+ ++IYR Y + S QI WFW+FV ++ N++++RLLQFVTGTCRLPVGGF +LMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:  242 SSTGSLP----PTNTNTNTSEGATSGLIIPLTISGGSGPRPLNP---VTQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPEPLPPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQ-FNQRFIYGNQDLFATSQSKEFDPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECDLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYARTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 862          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Celegans
Match: wwp-1 (E3 ubiquitin-protein ligase [Source:UniProtKB/TrEMBL;Acc:V6CJJ8])

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 401/779 (51.48%), Postives = 497/779 (63.80%), Query Frame = 1
Query:  196 KFKVKVKN--LGSHAELYVEYSVDD---APAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKT-LGKADVDLYKIL----CRFLGNLNNQELVVPISSTNSHTHIGDLTVVLKIASTINIPEEDRPRANATGNLRGSNNSLP-----VSDSSPALNRAVLPAADLST----------------------DPLPQHYERRFDNFNRPYFVDHLTKTTSWEPP--QPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDAN-NRTYFVNHVNKTTHWDDPRLQAN---PLPPGWEIRFTEDGMAFFVDHEXXXXXXX----------XXXXXXXXAEETQFLRKQSQFYYYC-QNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            K  VKV N      A+ YVE + D    AP K T  K T  P+W+E  N+     S+I F L+   K    T LG A + L  +       F  ++NN  L+   SS      IG L ++         PE  R  A        S +S       V+ SS A   A      L+                       + LP  +E RFD + R Y+VDH TK+T+WE P  QPLP GWE R D   RVYYVDHNTRTTTWQRP   ML   +  ++W++ R+  M Q   QR+  Q    N    DPLG LP+GWEKR D N +R YFVNHVN+TT W+DPR Q     PLP GWE+RFTE G+ FF+DH++KTTT+                 + A E  F  K +QF Y C  N+VP  HVKI V RN + EDSF EIMR    DL++RL+IQF+ E+GLDYGG++REWFF LSHE+LNPMYCLF YA +NNYSLQINPASF+NP+HL+YF ++GRF+AMA+FH KFI SGFT+PFYKKML K+I L+DIE VD E YNSL +I+DNNIDECDM L F A+YEL G+++  ELK  G +I VTEENK EYI+L+V WRF+RGV +QTKAF  GFN +  L W+Q +DER++ELLLCGMQ +DV DW+ N++YR Y   S Q+ WFW++V  L  +++ RLLQFVTGTCR+PVGGF ELMGS GPQ FCIE++GKE+WLPRSHTCFNRLDLPPY SY+QL EKL+ A+  TEGFG E
Sbjct:   31 KVTVKVVNASFTKAADCYVEITSDTSSAAPKKTTVKKKTMAPEWNEHLNVHANESSTISFRLLQKAKLFDDTCLGMAKLKLSSLTRNENGEFKNDINNISLLAKDSS-----KIGTLNIIFS-----GYPERKRRSAGVRAETAASASSEASTSNGVATSSSARRPATAKRDTLAAPTSTAAAAAAATAGGTPAAGAEEQLPDGWEMRFDQYGRKYYVDHTTKSTTWERPSTQPLPQGWEMRRDPRGRVYYVDHNTRTTTWQRPTADML---EAHEQWQSGRDQAMLQ-WEQRFLLQQ--NNFSADDPLGPLPEGWEKRQDPNTSRMYFVNHVNRTTQWEDPRTQGGSDQPLPDGWEMRFTEQGVPFFIDHQSKTTTYNDPRTGKPVGPLGVVGVQMAMEKSFRWKIAQFRYLCLSNSVP-NHVKITVSRNNVFEDSFQEIMRKNAVDLRRRLYIQFRGEEGLDYGGVAREWFFLLSHEVLNPMYCLFMYAGNNNYSLQINPASFVNPDHLKYFEYIGRFIAMALFHGKFIYSGFTMPFYKKMLNKKIVLKDIEQVDSEIYNSLMWIKDNNIDECDMELYFVADYELLGELKTYELKEGGTEIAVTEENKLEYIELLVEWRFNRGVEQQTKAFFTGFNSVFPLEWMQYFDERELELLLCGMQDVDVDDWQRNTVYRHYAPQSKQVTWFWQWVRSLDQEKRARLLQFVTGTCRVPVGGFSELMGSTGPQLFCIERVGKENWLPRSHTCFNRLDLPPYRSYDQLVEKLSMAIEMTEGFGNE 792          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Celegans
Match: wwp-1 (E3 ubiquitin-protein ligase [Source:UniProtKB/TrEMBL;Acc:V6CJJ8])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 401/781 (51.34%), Postives = 497/781 (63.64%), Query Frame = 1
Query:  196 KFKVKVKN--LGSHAELYVEYSVDD---APAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKT-LGKADVDLYKIL----CRFLGNLNNQELVVPISSTNSHTHIGDLTVVLKIASTINIPEEDRPRANATGNLRGSNNSLP-----VSDSSPALNRAVLPAADLST----------------------DPLPQHYERRFDNFNRPYFVDHLTKTTSWEPP--QPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDAN-NRTYFVNHVNKTTHWDDPRLQA-----NPLPPGWEIRFTEDGMAFFVDHEXXXXXXX----------XXXXXXXXAEETQFLRKQSQFYYYC-QNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            K  VKV N      A+ YVE + D    AP K T  K T  P+W+E  N+     S+I F L+   K    T LG A + L  +       F  ++NN  L+   SS      IG L ++         PE  R  A        S +S       V+ SS A   A      L+                       + LP  +E RFD + R Y+VDH TK+T+WE P  QPLP GWE R D   RVYYVDHNTRTTTWQRP   ML   +  ++W++ R+  M Q   QR+  Q    N    DPLG LP+GWEKR D N +R YFVNHVN+TT W+DPR Q       PLP GWE+RFTE G+ FF+DH++KTTT+                 + A E  F  K +QF Y C  N+VP  HVKI V RN + EDSF EIMR    DL++RL+IQF+ E+GLDYGG++REWFF LSHE+LNPMYCLF YA +NNYSLQINPASF+NP+HL+YF ++GRF+AMA+FH KFI SGFT+PFYKKML K+I L+DIE VD E YNSL +I+DNNIDECDM L F A+YEL G+++  ELK  G +I VTEENK EYI+L+V WRF+RGV +QTKAF  GFN +  L W+Q +DER++ELLLCGMQ +DV DW+ N++YR Y   S Q+ WFW++V  L  +++ RLLQFVTGTCR+PVGGF ELMGS GPQ FCIE++GKE+WLPRSHTCFNRLDLPPY SY+QL EKL+ A+  TEGFG E
Sbjct:   31 KVTVKVVNASFTKAADCYVEITSDTSSAAPKKTTVKKKTMAPEWNEHLNVHANESSTISFRLLQKAKLFDDTCLGMAKLKLSSLTRNENGEFKNDINNISLLAKDSS-----KIGTLNIIFS-----GYPERKRRSAGVRAETAASASSEASTSNGVATSSSARRPATAKRDTLAAPTSTAAAAAAATAGGTPAAGAEEQLPDGWEMRFDQYGRKYYVDHTTKSTTWERPSTQPLPQGWEMRRDPRGRVYYVDHNTRTTTWQRPTADML---EAHEQWQSGRDQAMLQ-WEQRFLLQQ--NNFSADDPLGPLPEGWEKRQDPNTSRMYFVNHVNRTTQWEDPRTQGFRGSDQPLPDGWEMRFTEQGVPFFIDHQSKTTTYNDPRTGKPVGPLGVVGVQMAMEKSFRWKIAQFRYLCLSNSVP-NHVKITVSRNNVFEDSFQEIMRKNAVDLRRRLYIQFRGEEGLDYGGVAREWFFLLSHEVLNPMYCLFMYAGNNNYSLQINPASFVNPDHLKYFEYIGRFIAMALFHGKFIYSGFTMPFYKKMLNKKIVLKDIEQVDSEIYNSLMWIKDNNIDECDMELYFVADYELLGELKTYELKEGGTEIAVTEENKLEYIELLVEWRFNRGVEQQTKAFFTGFNSVFPLEWMQYFDERELELLLCGMQDVDVDDWQRNTVYRHYAPQSKQVTWFWQWVRSLDQEKRARLLQFVTGTCRVPVGGFSELMGSTGPQLFCIERVGKENWLPRSHTCFNRLDLPPYRSYDQLVEKLSMAIEMTEGFGNE 794          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Celegans
Match: wwp-1 (E3 ubiquitin-protein ligase [Source:UniProtKB/TrEMBL;Acc:V6CJJ8])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 305/508 (60.04%), Postives = 379/508 (74.61%), Query Frame = 1
Query:  892 IDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDAN-NRTYFVNHVNKTTHWDDPRLQAN---PLPPGWEIRFTEDGMAFFVDHEXXXXXXX----------XXXXXXXXAEETQFLRKQSQFYYYC-QNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            ++  ++W++ R+  M Q   QR+  Q    N    DPLG LP+GWEKR D N +R YFVNHVN+TT W+DPR Q     PLP GWE+RFTE G+ FF+DH++KTTT+                 + A E  F  K +QF Y C  N+VP  HVKI V RN + EDSF EIMR    DL++RL+IQF+ E+GLDYGG++REWFF LSHE+LNPMYCLF YA +NNYSLQINPASF+NP+HL+YF ++GRF+AMA+FH KFI SGFT+PFYKKML K+I L+DIE VD E YNSL +I+DNNIDECDM L F A+YEL G+++  ELK  G +I VTEENK EYI+L+V WRF+RGV +QTKAF  GFN +  L W+Q +DER++ELLLCGMQ +DV DW+ N++YR Y   S Q+ WFW++V  L  +++ RLLQFVTGTCR+PVGGF ELMGS GPQ FCIE++GKE+WLPRSHTCFNRLDLPPY SY+QL EKL+ A+  TEGFG E
Sbjct:    2 LEAHEQWQSGRDQAMLQ-WEQRFLLQQ--NNFSADDPLGPLPEGWEKRQDPNTSRMYFVNHVNRTTQWEDPRTQGGSDQPLPDGWEMRFTEQGVPFFIDHQSKTTTYNDPRTGKPVGPLGVVGVQMAMEKSFRWKIAQFRYLCLSNSVP-NHVKITVSRNNVFEDSFQEIMRKNAVDLRRRLYIQFRGEEGLDYGGVAREWFFLLSHEVLNPMYCLFMYAGNNNYSLQINPASFVNPDHLKYFEYIGRFIAMALFHGKFIYSGFTMPFYKKMLNKKIVLKDIEQVDSEIYNSLMWIKDNNIDECDMELYFVADYELLGELKTYELKEGGTEIAVTEENKLEYIELLVEWRFNRGVEQQTKAFFTGFNSVFPLEWMQYFDERELELLLCGMQDVDVDDWQRNTVYRHYAPQSKQVTWFWQWVRSLDQEKRARLLQFVTGTCRVPVGGFSELMGSTGPQLFCIERVGKENWLPRSHTCFNRLDLPPYRSYDQLVEKLSMAIEMTEGFGNE 505          

HSP 2 Score: 67.0106 bits (162), Expect = 3.506e-11
Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 1
Query:  661 AADLSTDPLPQHYERRFD-NFNRPYFVDHLTKTTSWEPP-------QPLPPGWERRLDTHNRVYYVDHNTRTTTWQRP 870
            +AD    PLP+ +E+R D N +R YFV+H+ +TT WE P       QPLP GWE R       +++DH ++TTT+  P
Sbjct:   31 SADDPLGPLPEGWEKRQDPNTSRMYFVNHVNRTTQWEDPRTQGGSDQPLPDGWEMRFTEQGVPFFIDHQSKTTTYNDP 108          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Celegans
Match: wwp-1 (E3 ubiquitin-protein ligase [Source:UniProtKB/TrEMBL;Acc:V6CJJ8])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 305/508 (60.04%), Postives = 379/508 (74.61%), Query Frame = 1
Query:  892 IDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDAN-NRTYFVNHVNKTTHWDDPRLQAN---PLPPGWEIRFTEDGMAFFVDHEXXXXXXX----------XXXXXXXXAEETQFLRKQSQFYYYC-QNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            ++  ++W++ R+  M Q   QR+  Q    N    DPLG LP+GWEKR D N +R YFVNHVN+TT W+DPR Q     PLP GWE+RFTE G+ FF+DH++KTTT+                 + A E  F  K +QF Y C  N+VP  HVKI V RN + EDSF EIMR    DL++RL+IQF+ E+GLDYGG++REWFF LSHE+LNPMYCLF YA +NNYSLQINPASF+NP+HL+YF ++GRF+AMA+FH KFI SGFT+PFYKKML K+I L+DIE VD E YNSL +I+DNNIDECDM L F A+YEL G+++  ELK  G +I VTEENK EYI+L+V WRF+RGV +QTKAF  GFN +  L W+Q +DER++ELLLCGMQ +DV DW+ N++YR Y   S Q+ WFW++V  L  +++ RLLQFVTGTCR+PVGGF ELMGS GPQ FCIE++GKE+WLPRSHTCFNRLDLPPY SY+QL EKL+ A+  TEGFG E
Sbjct:    2 LEAHEQWQSGRDQAMLQ-WEQRFLLQQ--NNFSADDPLGPLPEGWEKRQDPNTSRMYFVNHVNRTTQWEDPRTQGGSDQPLPDGWEMRFTEQGVPFFIDHQSKTTTYNDPRTGKPVGPLGVVGVQMAMEKSFRWKIAQFRYLCLSNSVP-NHVKITVSRNNVFEDSFQEIMRKNAVDLRRRLYIQFRGEEGLDYGGVAREWFFLLSHEVLNPMYCLFMYAGNNNYSLQINPASFVNPDHLKYFEYIGRFIAMALFHGKFIYSGFTMPFYKKMLNKKIVLKDIEQVDSEIYNSLMWIKDNNIDECDMELYFVADYELLGELKTYELKEGGTEIAVTEENKLEYIELLVEWRFNRGVEQQTKAFFTGFNSVFPLEWMQYFDERELELLLCGMQDVDVDDWQRNTVYRHYAPQSKQVTWFWQWVRSLDQEKRARLLQFVTGTCRVPVGGFSELMGSTGPQLFCIERVGKENWLPRSHTCFNRLDLPPYRSYDQLVEKLSMAIEMTEGFGNE 505          

HSP 2 Score: 67.0106 bits (162), Expect = 3.506e-11
Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 1
Query:  661 AADLSTDPLPQHYERRFD-NFNRPYFVDHLTKTTSWEPP-------QPLPPGWERRLDTHNRVYYVDHNTRTTTWQRP 870
            +AD    PLP+ +E+R D N +R YFV+H+ +TT WE P       QPLP GWE R       +++DH ++TTT+  P
Sbjct:   31 SADDPLGPLPEGWEKRQDPNTSRMYFVNHVNRTTQWEDPRTQGGSDQPLPDGWEMRFTEQGVPFFIDHQSKTTTYNDP 108          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Celegans
Match: wwp-1 (E3 ubiquitin-protein ligase [Source:UniProtKB/TrEMBL;Acc:V6CJJ8])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 305/510 (59.80%), Postives = 379/510 (74.31%), Query Frame = 1
Query:  892 IDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDAN-NRTYFVNHVNKTTHWDDPRLQA-----NPLPPGWEIRFTEDGMAFFVDHEXXXXXXX----------XXXXXXXXAEETQFLRKQSQFYYYC-QNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            ++  ++W++ R+  M Q   QR+  Q    N    DPLG LP+GWEKR D N +R YFVNHVN+TT W+DPR Q       PLP GWE+RFTE G+ FF+DH++KTTT+                 + A E  F  K +QF Y C  N+VP  HVKI V RN + EDSF EIMR    DL++RL+IQF+ E+GLDYGG++REWFF LSHE+LNPMYCLF YA +NNYSLQINPASF+NP+HL+YF ++GRF+AMA+FH KFI SGFT+PFYKKML K+I L+DIE VD E YNSL +I+DNNIDECDM L F A+YEL G+++  ELK  G +I VTEENK EYI+L+V WRF+RGV +QTKAF  GFN +  L W+Q +DER++ELLLCGMQ +DV DW+ N++YR Y   S Q+ WFW++V  L  +++ RLLQFVTGTCR+PVGGF ELMGS GPQ FCIE++GKE+WLPRSHTCFNRLDLPPY SY+QL EKL+ A+  TEGFG E
Sbjct:    2 LEAHEQWQSGRDQAMLQ-WEQRFLLQQ--NNFSADDPLGPLPEGWEKRQDPNTSRMYFVNHVNRTTQWEDPRTQGFRGSDQPLPDGWEMRFTEQGVPFFIDHQSKTTTYNDPRTGKPVGPLGVVGVQMAMEKSFRWKIAQFRYLCLSNSVP-NHVKITVSRNNVFEDSFQEIMRKNAVDLRRRLYIQFRGEEGLDYGGVAREWFFLLSHEVLNPMYCLFMYAGNNNYSLQINPASFVNPDHLKYFEYIGRFIAMALFHGKFIYSGFTMPFYKKMLNKKIVLKDIEQVDSEIYNSLMWIKDNNIDECDMELYFVADYELLGELKTYELKEGGTEIAVTEENKLEYIELLVEWRFNRGVEQQTKAFFTGFNSVFPLEWMQYFDERELELLLCGMQDVDVDDWQRNTVYRHYAPQSKQVTWFWQWVRSLDQEKRARLLQFVTGTCRVPVGGFSELMGSTGPQLFCIERVGKENWLPRSHTCFNRLDLPPYRSYDQLVEKLSMAIEMTEGFGNE 507          

HSP 2 Score: 66.2402 bits (160), Expect = 6.350e-11
Identity = 33/80 (41.25%), Postives = 47/80 (58.75%), Query Frame = 1
Query:  661 AADLSTDPLPQHYERRFD-NFNRPYFVDHLTKTTSWEPP---------QPLPPGWERRLDTHNRVYYVDHNTRTTTWQRP 870
            +AD    PLP+ +E+R D N +R YFV+H+ +TT WE P         QPLP GWE R       +++DH ++TTT+  P
Sbjct:   31 SADDPLGPLPEGWEKRQDPNTSRMYFVNHVNRTTQWEDPRTQGFRGSDQPLPDGWEMRFTEQGVPFFIDHQSKTTTYNDP 110          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Fly
Match: Su(dx) (gene:FBgn0003557 transcript:FBtr0077823)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 351/615 (57.07%), Postives = 440/615 (71.54%), Query Frame = 1
Query:  610 SLPVSDSS-PALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-----GAQNWAGNIQRV----DPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA--------NPLPPGWEIRFTEDGMAFFVDHEXXXXX----------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
             LPVS S+ P L     PA D   +PLP  +E R D + R Y+VDH T++T WE P PLPPGWE R D   RVYYVDHNTR TTWQRP+   L    HFQ W+ +R + + Q  NQRY       Q  A   Q      D LG LP GWEK+  ++NR YFVNH N+TT W+DPR Q          PLPPGWEIR+T  G  FFVDH T+ TT                    A E  F  K SQF Y CQ+     H+KI V R  L EDS+++IMR+   +L++RL+I F+ E+GLDYGG+SREWFF LSHE+LNPMYCLFEYA+ NNYSLQINPAS++NP+HLQYF+F+GRF+AMA++H +FI SGFT+PFYK+ML K++T++DIET+D E+YNSL +++DNNIDEC + L FS ++E+ G+I   ELK NG    VTEENK EYI LM  WR +RG+ +QTK F++GFNE+V L WL+ +DER++EL+LCGMQ +DV+DW+ N+IYR Y ++S Q+ WFW+FV +  N+++ RLLQFVTGTCR+PVGGF ELMGSNGPQ+FCIEK+GKE+WLPRSHTCFNRLDLPPY SY+QL EKLT+A+ ETEGF QE
Sbjct:  344 GLPVSQSTDPQLQ--TQPADD---EPLPAGWEIRLDQYGRRYYVDHNTRSTYWEKPTPLPPGWEIRKDGRGRVYYVDHNTRKTTWQRPNSERLM---HFQHWQGQRAHVVSQG-NQRYLYSQQQQQPTAVTAQVTQDDEDALGPLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAPKGAKGVYGVPRAYERSFRWKLSQFRYLCQSNALPSHIKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLFEYANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNKKLTIKDIETIDPEFYNSLIWVKDNNIDECGLELWFSVDFEVLGQIIHHELKENGEKERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQDVDVEDWQRNTIYRHYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGFCQE 949          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Fly
Match: Su(dx) (gene:FBgn0003557 transcript:FBtr0077824)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 351/615 (57.07%), Postives = 440/615 (71.54%), Query Frame = 1
Query:  610 SLPVSDSS-PALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-----GAQNWAGNIQRV----DPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA--------NPLPPGWEIRFTEDGMAFFVDHEXXXXX----------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
             LPVS S+ P L     PA D   +PLP  +E R D + R Y+VDH T++T WE P PLPPGWE R D   RVYYVDHNTR TTWQRP+   L    HFQ W+ +R + + Q  NQRY       Q  A   Q      D LG LP GWEK+  ++NR YFVNH N+TT W+DPR Q          PLPPGWEIR+T  G  FFVDH T+ TT                    A E  F  K SQF Y CQ+     H+KI V R  L EDS+++IMR+   +L++RL+I F+ E+GLDYGG+SREWFF LSHE+LNPMYCLFEYA+ NNYSLQINPAS++NP+HLQYF+F+GRF+AMA++H +FI SGFT+PFYK+ML K++T++DIET+D E+YNSL +++DNNIDEC + L FS ++E+ G+I   ELK NG    VTEENK EYI LM  WR +RG+ +QTK F++GFNE+V L WL+ +DER++EL+LCGMQ +DV+DW+ N+IYR Y ++S Q+ WFW+FV +  N+++ RLLQFVTGTCR+PVGGF ELMGSNGPQ+FCIEK+GKE+WLPRSHTCFNRLDLPPY SY+QL EKLT+A+ ETEGF QE
Sbjct:  344 GLPVSQSTDPQLQ--TQPADD---EPLPAGWEIRLDQYGRRYYVDHNTRSTYWEKPTPLPPGWEIRKDGRGRVYYVDHNTRKTTWQRPNSERLM---HFQHWQGQRAHVVSQG-NQRYLYSQQQQQPTAVTAQVTQDDEDALGPLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAPKGAKGVYGVPRAYERSFRWKLSQFRYLCQSNALPSHIKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLFEYANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNKKLTIKDIETIDPEFYNSLIWVKDNNIDECGLELWFSVDFEVLGQIIHHELKENGEKERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQDVDVEDWQRNTIYRHYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGFCQE 949          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Fly
Match: Su(dx) (gene:FBgn0003557 transcript:FBtr0339529)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 351/615 (57.07%), Postives = 440/615 (71.54%), Query Frame = 1
Query:  610 SLPVSDSS-PALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-----GAQNWAGNIQRV----DPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA--------NPLPPGWEIRFTEDGMAFFVDHEXXXXX----------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
             LPVS S+ P L     PA D   +PLP  +E R D + R Y+VDH T++T WE P PLPPGWE R D   RVYYVDHNTR TTWQRP+   L    HFQ W+ +R + + Q  NQRY       Q  A   Q      D LG LP GWEK+  ++NR YFVNH N+TT W+DPR Q          PLPPGWEIR+T  G  FFVDH T+ TT                    A E  F  K SQF Y CQ+     H+KI V R  L EDS+++IMR+   +L++RL+I F+ E+GLDYGG+SREWFF LSHE+LNPMYCLFEYA+ NNYSLQINPAS++NP+HLQYF+F+GRF+AMA++H +FI SGFT+PFYK+ML K++T++DIET+D E+YNSL +++DNNIDEC + L FS ++E+ G+I   ELK NG    VTEENK EYI LM  WR +RG+ +QTK F++GFNE+V L WL+ +DER++EL+LCGMQ +DV+DW+ N+IYR Y ++S Q+ WFW+FV +  N+++ RLLQFVTGTCR+PVGGF ELMGSNGPQ+FCIEK+GKE+WLPRSHTCFNRLDLPPY SY+QL EKLT+A+ ETEGF QE
Sbjct:  344 GLPVSQSTDPQLQ--TQPADD---EPLPAGWEIRLDQYGRRYYVDHNTRSTYWEKPTPLPPGWEIRKDGRGRVYYVDHNTRKTTWQRPNSERLM---HFQHWQGQRAHVVSQG-NQRYLYSQQQQQPTAVTAQVTQDDEDALGPLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAPKGAKGVYGVPRAYERSFRWKLSQFRYLCQSNALPSHIKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLFEYANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNKKLTIKDIETIDPEFYNSLIWVKDNNIDECGLELWFSVDFEVLGQIIHHELKENGEKERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQDVDVEDWQRNTIYRHYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGFCQE 949          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Fly
Match: Su(dx) (gene:FBgn0003557 transcript:FBtr0077822)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 351/615 (57.07%), Postives = 440/615 (71.54%), Query Frame = 1
Query:  610 SLPVSDSS-PALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-----GAQNWAGNIQRV----DPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA--------NPLPPGWEIRFTEDGMAFFVDHEXXXXX----------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
             LPVS S+ P L     PA D   +PLP  +E R D + R Y+VDH T++T WE P PLPPGWE R D   RVYYVDHNTR TTWQRP+   L    HFQ W+ +R + + Q  NQRY       Q  A   Q      D LG LP GWEK+  ++NR YFVNH N+TT W+DPR Q          PLPPGWEIR+T  G  FFVDH T+ TT                    A E  F  K SQF Y CQ+     H+KI V R  L EDS+++IMR+   +L++RL+I F+ E+GLDYGG+SREWFF LSHE+LNPMYCLFEYA+ NNYSLQINPAS++NP+HLQYF+F+GRF+AMA++H +FI SGFT+PFYK+ML K++T++DIET+D E+YNSL +++DNNIDEC + L FS ++E+ G+I   ELK NG    VTEENK EYI LM  WR +RG+ +QTK F++GFNE+V L WL+ +DER++EL+LCGMQ +DV+DW+ N+IYR Y ++S Q+ WFW+FV +  N+++ RLLQFVTGTCR+PVGGF ELMGSNGPQ+FCIEK+GKE+WLPRSHTCFNRLDLPPY SY+QL EKLT+A+ ETEGF QE
Sbjct:  344 GLPVSQSTDPQLQ--TQPADD---EPLPAGWEIRLDQYGRRYYVDHNTRSTYWEKPTPLPPGWEIRKDGRGRVYYVDHNTRKTTWQRPNSERLM---HFQHWQGQRAHVVSQG-NQRYLYSQQQQQPTAVTAQVTQDDEDALGPLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAPKGAKGVYGVPRAYERSFRWKLSQFRYLCQSNALPSHIKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLFEYANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNKKLTIKDIETIDPEFYNSLIWVKDNNIDECGLELWFSVDFEVLGQIIHHELKENGEKERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQDVDVEDWQRNTIYRHYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGFCQE 949          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Fly
Match: Su(dx) (gene:FBgn0003557 transcript:FBtr0334778)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 351/615 (57.07%), Postives = 440/615 (71.54%), Query Frame = 1
Query:  610 SLPVSDSS-PALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-----GAQNWAGNIQRV----DPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA--------NPLPPGWEIRFTEDGMAFFVDHEXXXXX----------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
             LPVS S+ P L     PA D   +PLP  +E R D + R Y+VDH T++T WE P PLPPGWE R D   RVYYVDHNTR TTWQRP+   L    HFQ W+ +R + + Q  NQRY       Q  A   Q      D LG LP GWEK+  ++NR YFVNH N+TT W+DPR Q          PLPPGWEIR+T  G  FFVDH T+ TT                    A E  F  K SQF Y CQ+     H+KI V R  L EDS+++IMR+   +L++RL+I F+ E+GLDYGG+SREWFF LSHE+LNPMYCLFEYA+ NNYSLQINPAS++NP+HLQYF+F+GRF+AMA++H +FI SGFT+PFYK+ML K++T++DIET+D E+YNSL +++DNNIDEC + L FS ++E+ G+I   ELK NG    VTEENK EYI LM  WR +RG+ +QTK F++GFNE+V L WL+ +DER++EL+LCGMQ +DV+DW+ N+IYR Y ++S Q+ WFW+FV +  N+++ RLLQFVTGTCR+PVGGF ELMGSNGPQ+FCIEK+GKE+WLPRSHTCFNRLDLPPY SY+QL EKLT+A+ ETEGF QE
Sbjct:  344 GLPVSQSTDPQLQ--TQPADD---EPLPAGWEIRLDQYGRRYYVDHNTRSTYWEKPTPLPPGWEIRKDGRGRVYYVDHNTRKTTWQRPNSERLM---HFQHWQGQRAHVVSQG-NQRYLYSQQQQQPTAVTAQVTQDDEDALGPLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAPKGAKGVYGVPRAYERSFRWKLSQFRYLCQSNALPSHIKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLFEYANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNKKLTIKDIETIDPEFYNSLIWVKDNNIDECGLELWFSVDFEVLGQIIHHELKENGEKERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQDVDVEDWQRNTIYRHYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGFCQE 949          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Zebrafish
Match: wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:ZFIN;Acc:ZDB-GENE-131120-84])

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 373/746 (50.00%), Postives = 499/746 (66.89%), Query Frame = 1
Query:  268 PAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTL-GKADVDLYKILCRFLGNLNNQELVVPISSTNSHTHI--GDLTVVLKIASTIN--IPEEDRPRANATGNL--------------------------RGSNNSLPVSDSSPALNRAVLPAADLST---DPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX-------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            P  +TTT       W     L +   + ++F + +++  +   L G+A +DL   L +  G L N   V+P+++   H  +  G+LTV L   S     +   + P A+ +  +                            ++   P + S+PA +    PA    T   +PLP  +E+R D   R Y+VDH T+TT+WE PQPLP GWERR+D   R+YYVDHNTRTTTWQRP +  + N + +Q  R++    M Q  NQRY       + +  DPLG LP GWE+R D N+R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH T+TTT        +     P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM  KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++ L+D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GKI   +LK +G +++VTEENK EYI LM  WRFSRGV  QTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D++DW+ N++YR YT++S QI WFW+ V ++ N+ ++RL+QFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY S+EQLKEKL +A+ ETEGFGQE
Sbjct:   70 PHPETTT-------WERPQPLNIAPHAPLEFRVWSHHALKADALLGRAALDLIGTLRKHDGKLENVREVLPLTAEGKHGVVSTGELTVFLDGLSLDPQLLHSSNTPTASESACVGESAAADAPCSSSSSPAGGAAAAHTLSAADTHTPAAPSTPAPDGGK-PAQQQPTGGVEPLPPGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPLGWERRVDNRGRIYYVDHNTRTTTWQRPTMESVRNFEQWQSQRSQLQGAMHQ-FNQRYLYSASMMSAEN-DPLGPLPPGWERRVDTNDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVRYFVDHNTRTTTFSDPRTGKSAVTKGPQIAYERSFRWKLAHFRYLCQSNALASHVKITVSRQTLFEDSFQQIMNFKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLILKDLESIDPEFYNSLIWIRDNNIEECGLEMFFSVDMEILGKISSHDLKEDGANVQVTEENKEEYIGLMAEWRFSRGVESQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLQDWQRNTVYRHYTRNSKQIIWFWQLVKEVDNEVRLRLMQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSFEQLKEKLLFAIEETEGFGQE 805          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Zebrafish
Match: wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:ZFIN;Acc:ZDB-GENE-131120-84])

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 348/613 (56.77%), Postives = 452/613 (73.74%), Query Frame = 1
Query:  580 ATGNLRGSNNSLPVSDSSPALNRAVLPAADLST---DPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRV--DPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX-------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            A   L  ++   P + S+PA +    PA    T   +PLP  +E+R D   R Y+VDH T+TT+WE PQPLP GWERR+D   R+YYVDHNTRTTTWQRP +  + N + +Q  R++    M Q  NQRY    ++ ++     DPLG LP GWE+R D N+R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH T+TTT        +     P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM  KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++ L+D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GKI   +LK +G +++VTEENK EYI LM  WRFSRGV  QTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D++DW+ N++YR YT++S QI WFW+ V ++ N+ ++RL+QFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY S+EQLKEKL +A+ ETEGFGQE
Sbjct:  296 AAHTLSAADTHTPAAPSTPAPDGGK-PAQQQPTGGVEPLPPGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPLGWERRVDNRGRIYYVDHNTRTTTWQRPTMESVRNFEQWQSQRSQLQGAMHQ-FNQRY---LYSASMMSAENDPLGPLPPGWERRVDTNDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVRYFVDHNTRTTTFSDPRTGKSAVTKGPQIAYERSFRWKLAHFRYLCQSNALASHVKITVSRQTLFEDSFQQIMNFKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLILKDLESIDPEFYNSLIWIRDNNIEECGLEMFFSVDMEILGKISSHDLKEDGANVQVTEENKEEYIGLMAEWRFSRGVESQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLQDWQRNTVYRHYTRNSKQIIWFWQLVKEVDNEVRLRLMQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSFEQLKEKLLFAIEETEGFGQE 903          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Zebrafish
Match: wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:ZFIN;Acc:ZDB-GENE-131120-84])

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 346/599 (57.76%), Postives = 446/599 (74.46%), Query Frame = 1
Query:  616 PVSDSSPALNRAVLPAADLST---DPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX-------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            P + S+PA +    PA    T   +PLP  +E+R D   R Y+VDH T+TT+WE PQPLP GWERR+D   R+YYVDHNTRTTTWQRP +  + N + +Q  R++    M Q  NQRY       + +  DPLG LP GWE+R D N+R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH T+TTT        +     P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM  KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++ L+D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GKI   +LK +G +++VTEENK EYI LM  WRFSRGV  QTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D++DW+ N++YR YT++S QI WFW+ V ++ N+ ++RL+QFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY S+EQLKEKL +A+ ETEGFGQE
Sbjct:  225 PAAPSTPAPDGGK-PAQQQPTGGVEPLPPGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPLGWERRVDNRGRIYYVDHNTRTTTWQRPTMESVRNFEQWQSQRSQLQGAMHQ-FNQRYLYSASMMSAEN-DPLGPLPPGWERRVDTNDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVRYFVDHNTRTTTFSDPRTGKSAVTKGPQIAYERSFRWKLAHFRYLCQSNALASHVKITVSRQTLFEDSFQQIMNFKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLILKDLESIDPEFYNSLIWIRDNNIEECGLEMFFSVDMEILGKISSHDLKEDGANVQVTEENKEEYIGLMAEWRFSRGVESQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLQDWQRNTVYRHYTRNSKQIIWFWQLVKEVDNEVRLRLMQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSFEQLKEKLLFAIEETEGFGQE 820          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Zebrafish
Match: wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:ZFIN;Acc:ZDB-GENE-131120-84])

HSP 1 Score: 721.079 bits (1860), Expect = 0.000e+0
Identity = 336/569 (59.05%), Postives = 432/569 (75.92%), Query Frame = 1
Query:  697 YERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX-------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            +E+R D   R Y+VDH T+TT+WE PQPLP GWERR+D   R+YYVDHNTRTTTWQRP +  + N + +Q  R++    M Q  NQRY       + +  DPLG LP GWE+R D N+R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH T+TTT        +     P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM  KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++ L+D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GKI   +LK +G +++VTEENK EYI LM  WRFSRGV  QTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D++DW+ N++YR YT++S QI WFW+ V ++ N+ ++RL+QFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY S+EQLKEKL +A+ ETEGFGQE
Sbjct:  291 WEQRKDPHGRTYYVDHNTRTTTWERPQPLPLGWERRVDNRGRIYYVDHNTRTTTWQRPTMESVRNFEQWQSQRSQLQGAMHQ-FNQRYLYSASMMSAEN-DPLGPLPPGWERRVDTNDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVRYFVDHNTRTTTFSDPRTGKSAVTKGPQIAYERSFRWKLAHFRYLCQSNALASHVKITVSRQTLFEDSFQQIMNFKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLILKDLESIDPEFYNSLIWIRDNNIEECGLEMFFSVDMEILGKISSHDLKEDGANVQVTEENKEEYIGLMAEWRFSRGVESQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLQDWQRNTVYRHYTRNSKQIIWFWQLVKEVDNEVRLRLMQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSFEQLKEKLLFAIEETEGFGQE 857          

HSP 2 Score: 71.633 bits (174), Expect = 3.282e-12
Identity = 38/82 (46.34%), Postives = 48/82 (58.54%), Query Frame = 1
Query:  649 AVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQ--------PLPPGWERRLDTHNRVYYVDHNTRTTTWQRP 870
            +++ A +    PLP  +ERR D  +R YFV+H TKTT WE P+        PLP GWE R       Y+VDHNTRTTT+  P
Sbjct:  382 SMMSAENDPLGPLPPGWERRVDTNDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVRYFVDHNTRTTTFSDP 463          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Zebrafish
Match: wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:ZFIN;Acc:ZDB-GENE-131120-84])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 336/569 (59.05%), Postives = 432/569 (75.92%), Query Frame = 1
Query:  697 YERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX-------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            +E+R D   R Y+VDH T+TT+WE PQPLP GWERR+D   R+YYVDHNTRTTTWQRP +  + N + +Q  R++    M Q  NQRY       + +  DPLG LP GWE+R D N+R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH T+TTT        +     P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM  KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++ L+D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GKI   +LK +G +++VTEENK EYI LM  WRFSRGV  QTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D++DW+ N++YR YT++S QI WFW+ V ++ N+ ++RL+QFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY S+EQLKEKL +A+ ETEGFGQE
Sbjct:  307 WEQRKDPHGRTYYVDHNTRTTTWERPQPLPLGWERRVDNRGRIYYVDHNTRTTTWQRPTMESVRNFEQWQSQRSQLQGAMHQ-FNQRYLYSASMMSAEN-DPLGPLPPGWERRVDTNDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVRYFVDHNTRTTTFSDPRTGKSAVTKGPQIAYERSFRWKLAHFRYLCQSNALASHVKITVSRQTLFEDSFQQIMNFKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLILKDLESIDPEFYNSLIWIRDNNIEECGLEMFFSVDMEILGKISSHDLKEDGANVQVTEENKEEYIGLMAEWRFSRGVESQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLQDWQRNTVYRHYTRNSKQIIWFWQLVKEVDNEVRLRLMQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSFEQLKEKLLFAIEETEGFGQE 873          

HSP 2 Score: 70.8626 bits (172), Expect = 6.726e-12
Identity = 38/82 (46.34%), Postives = 48/82 (58.54%), Query Frame = 1
Query:  649 AVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQ--------PLPPGWERRLDTHNRVYYVDHNTRTTTWQRP 870
            +++ A +    PLP  +ERR D  +R YFV+H TKTT WE P+        PLP GWE R       Y+VDHNTRTTT+  P
Sbjct:  398 SMMSAENDPLGPLPPGWERRVDTNDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVRYFVDHNTRTTTFSDP 479          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Xenopus
Match: wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100038255])

HSP 1 Score: 746.117 bits (1925), Expect = 0.000e+0
Identity = 383/797 (48.06%), Postives = 512/797 (64.24%), Query Frame = 1
Query:  178 LNILIKKFKVKVKNLGSHAELYVEYSVDDAPAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTL-GKADVDLYKILCRFLGNLN--NQELVVPISSTNSHTHIGDLTVVL-----------------------------------------KIASTINIPEEDRPRANATGNLRGSNNSLPVSDSSPALNRAVL-----PAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            L++ +   K+K K       +Y E +VD    K   + S+ NP W E   + V  +++++F + +++  +   L GK  VDL + L      L    ++L + +   +     G+LTV+L                                         ++ +T ++P  +   +  T      N  +   D + + +R        PA +  T      +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP +  + N + +Q  R +    M+Q  NQRY        A+N        DPLG LP GWE+R D+ +R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH TKTTT             P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++T++D+E++D E+YNSL +IRDNNI+EC++ + FS + E+ GK+   +LK  G +I VTEENK EYI LM  WRFSRGV EQTKAF+DGFN +V L WLQ +DE+++E++LCGMQ++D+ DW+ N++YR YT++S QI WFW+FV ++ N+ ++RLLQFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:   19 LHVTVSCAKLKRKKNWFGTTVYTELAVDGETKKTAKSSSSSNPKWEERLTVSVTPQTTLEFKVWSHHSWKADALLGKTAVDLKQALETHNRKLERVKEQLKLSLDGKHGTVQTGELTVILDGLNVEPESLATFNSTATPAREIQQNGDAVRENGGETSLEARVGATCDMP--NGTASETTSEQNAFNTQIANIDGTHSPSRVAARPKNTPAPNPLTGDRTGRWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQ-FNQRYLYSASMLSAEN--------DPLGPLPPGWERRVDSTDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVKYFVDHNTKTTTFSDPRTGKSAVKGPQIAYERSFRWKLAHFRYLCQSNALPSHVKITVSRQTLFEDSFQQIMALKPYDLRRRLYVMFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDPEFYNSLIWIRDNNIEECNLEMYFSVDMEILGKVTSHDLKPEGSNILVTEENKEEYIGLMAEWRFSRGVEEQTKAFLDGFNAVVPLQWLQYFDEKELEVMLCGMQEVDLSDWQRNTVYRHYTRNSKQIIWFWQFVKEMDNEVRLRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 804          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Xenopus
Match: wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100038255])

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 383/795 (48.18%), Postives = 510/795 (64.15%), Query Frame = 1
Query:  184 ILIKKFKVKVKNLGSHAELYVEYSVDDAPAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTL-GKADVDLYKILCRFLGNLN--NQELVVPISSTNSHTHIGDLTVVL-----------------------------------------KIASTINIPEEDRPRANATGNLRGSNNSLPVSDSSPALNRAVL-----PAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
             L+   K+K K       +Y E +VD    K   + S+ NP W E   + V  +++++F + +++  +   L GK  VDL + L      L    ++L + +   +     G+LTV+L                                         ++ +T ++P  +   +  T      N  +   D + + +R        PA +  T      +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP +  + N + +Q  R +    M+Q  NQRY        A+N        DPLG LP GWE+R D+ +R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH TKTTT             P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++T++D+E++D E+YNSL +IRDNNI+EC++ + FS + E+ GK+   +LK  G +I VTEENK EYI LM  WRFSRGV EQTKAF+DGFN +V L WLQ +DE+++E++LCGMQ++D+ DW+ N++YR YT++S QI WFW+FV ++ N+ ++RLLQFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:   13 FLVSCAKLKRKKNWFGTTVYTELAVDGETKKTAKSSSSSNPKWEERLTVSVTPQTTLEFKVWSHHSWKADALLGKTAVDLKQALETHNRKLERVKEQLKLSLDGKHGTVQTGELTVILDGLNVEPESLATFNSTATPAREIQQNGDAVRENGGETSLEARVGATCDMP--NGTASETTSEQNAFNTQIANIDGTHSPSRVAARPKNTPAPNPLTGDRTGRWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQ-FNQRYLYSASMLSAEN--------DPLGPLPPGWERRVDSTDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVKYFVDHNTKTTTFSDPRTGKSAVKGPQIAYERSFRWKLAHFRYLCQSNALPSHVKITVSRQTLFEDSFQQIMALKPYDLRRRLYVMFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDPEFYNSLIWIRDNNIEECNLEMYFSVDMEILGKVTSHDLKPEGSNILVTEENKEEYIGLMAEWRFSRGVEEQTKAFLDGFNAVVPLQWLQYFDEKELEVMLCGMQEVDLSDWQRNTVYRHYTRNSKQIIWFWQFVKEMDNEVRLRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 796          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Xenopus
Match: wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100038255])

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 385/804 (47.89%), Postives = 512/804 (63.68%), Query Frame = 1
Query:  178 LNILIKKFKVKVKNLGSHAELYVEYSVDDAPAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTL-GKADVDLYKIL------CRFLGNLNNQELVVPISSTNS-----------------------HTHIGDLTVVL-------------------------KIASTINIPEEDRPRANATGNLRGSNNSLPVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX-------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            L++ +   K+K K       +Y E +VD    K   + S+ NP W E   + V  +++++F + +++  +   L GK  VDL + L      C++   +N  ++    S  NS                        T  G +++ L                           A+  N P+  +PR  ++          P S + P  +        L     P+ +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP +  + N + +Q  R +    M+Q  NQRY        A+N        DPLG LP GWE+R D+ +R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH TKTTT        +     P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++T++D+E++D E+YNSL +IRDNNI+EC++ + FS + E+ GK+   +LK  G +I VTEENK EYI LM  WRFSRGV EQTKAF+DGFN +V L WLQ +DE+++E++LCGMQ++D+ DW+ N++YR YT++S QI WFW+FV ++ N+ ++RLLQFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:   19 LHVTVSCAKLKRKKNWFGTTVYTELAVDGETKKTAKSSSSSNPKWEERLTVSVTPQTTLEFKVWSHHSWKADALLGKTAVDLKQALETHNRKCKWQLCVNTDKVFDATSEANSTPSHEALPSPAGAPSSDSIEMMDSTSDGPVSIPLDSGTSAESSSAGASSEPVRAADSGPSPAAGSNSPDAAKPRQASSTGSGDPVRQQPSSAAEPLPSGYAEKYCALVIIIEPRIWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQ-FNQRYLYSASMLSAEN--------DPLGPLPPGWERRVDSTDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVKYFVDHNTKTTTFSDPRTGKSAVSKGPQIAYERSFRWKLAHFRYLCQSNALPSHVKITVSRQTLFEDSFQQIMALKPYDLRRRLYVMFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDPEFYNSLIWIRDNNIEECNLEMYFSVDMEILGKVTSHDLKPEGSNILVTEENKEEYIGLMAEWRFSRGVEEQTKAFLDGFNAVVPLQWLQYFDEKELEVMLCGMQEVDLSDWQRNTVYRHYTRNSKQIIWFWQFVKEMDNEVRLRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 813          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Xenopus
Match: wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100038255])

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 354/612 (57.84%), Postives = 449/612 (73.37%), Query Frame = 1
Query:  598 GSNN---SLPVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX-------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            GSN+   + P   SS      V      + +PLP  +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP +  + N + +Q  R +    M+Q  NQRY        A+N        DPLG LP GWE+R D+ +R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH TKTTT        +     P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++T++D+E++D E+YNSL +IRDNNI+EC++ + FS + E+ GK+   +LK  G +I VTEENK EYI LM  WRFSRGV EQTKAF+DGFN +V L WLQ +DE+++E++LCGMQ++D+ DW+ N++YR YT++S QI WFW+FV ++ N+ ++RLLQFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:  312 GSNSPDAAKPRQASSTGSGDPVRQQPSSAAEPLPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQ-FNQRYLYSASMLSAEN--------DPLGPLPPGWERRVDSTDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVKYFVDHNTKTTTFSDPRTGKSAVSKGPQIAYERSFRWKLAHFRYLCQSNALPSHVKITVSRQTLFEDSFQQIMALKPYDLRRRLYVMFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDPEFYNSLIWIRDNNIEECNLEMYFSVDMEILGKVTSHDLKPEGSNILVTEENKEEYIGLMAEWRFSRGVEEQTKAFLDGFNAVVPLQWLQYFDEKELEVMLCGMQEVDLSDWQRNTVYRHYTRNSKQIIWFWQFVKEMDNEVRLRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 914          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Xenopus
Match: wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100038255])

HSP 1 Score: 741.11 bits (1912), Expect = 0.000e+0
Identity = 384/797 (48.18%), Postives = 511/797 (64.12%), Query Frame = 1
Query:  184 ILIKKFKVKVKNLGSHAELYVEYSVDDAPAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTL-GKADVDLYKIL------CRFLGNLNNQEL-----VVPISSTNSH--------------------THIGDLTVVL-------------------------KIASTINIPEEDRPRANATGNLRGSNNSLPVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX-------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
             L+   K+K K       +Y E +VD    K   + S+ NP W E   + V  +++++F + +++  +   L GK  VDL + L      C++   +N  ++         +ST SH                    T  G +++ L                           A+  N P+  +PR  ++          P S + P  +        L     P+ +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP +  + N + +Q  R +    M+Q  NQRY       + +  DPLG LP GWE+R D+ +R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH TKTTT        +     P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++T++D+E++D E+YNSL +IRDNNI+EC++ + FS + E+ GK+   +LK  G +I VTEENK EYI LM  WRFSRGV EQTKAF+DGFN +V L WLQ +DE+++E++LCGMQ++D+ DW+ N++YR YT++S QI WFW+FV ++ N+ ++RLLQFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:   20 FLVSCAKLKRKKNWFGTTVYTELAVDGETKKTAKSSSSSNPKWEERLTVSVTPQTTLEFKVWSHHSWKADALLGKTAVDLKQALETHNRKCKWQLCVNTDKVFESYATSEANSTPSHEALPSPAGAPSSDSIEMMDSTSDGPVSIPLDSGTSAESSSAGASSEPVRAADSGPSPAAGSNSPDAAKPRQASSTGSGDPVRQQPSSAAEPLPSGYAEKYCALVIIIEPRIWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQ-FNQRYLYSASMLSAEN-DPLGPLPPGWERRVDSTDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVKYFVDHNTKTTTFSDPRTGKSAVSKGPQIAYERSFRWKLAHFRYLCQSNALPSHVKITVSRQTLFEDSFQQIMALKPYDLRRRLYVMFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDPEFYNSLIWIRDNNIEECNLEMYFSVDMEILGKVTSHDLKPEGSNILVTEENKEEYIGLMAEWRFSRGVEEQTKAFLDGFNAVVPLQWLQYFDEKELEVMLCGMQEVDLSDWQRNTVYRHYTRNSKQIIWFWQFVKEMDNEVRLRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 814          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Mouse
Match: Wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:1861728])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 347/589 (58.91%), Postives = 441/589 (74.87%), Query Frame = 1
Query:  661 AADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX--------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            + + +T+ LP  +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP +  + N + +Q  R +    M+Q  NQRY        A+N        DP G LP GWEKR D+ +R YFVNH  KTT W+DPR Q      PLP GWEIR+T +G+ +FVDH T+TTT         +  +  P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++T++D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GK+   +LK  G +I VTEENK+EYI LM  WRFSRGV EQTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D+ DW+ N++YR YT++S QI WFW+FV +  N+ ++RLLQFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:  339 SGNTNTEALPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQ-FNQRYLYSASMLAAEN--------DPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQGLPNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYERSFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDNEVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 918          

HSP 2 Score: 72.4034 bits (176), Expect = 2.088e-12
Identity = 38/82 (46.34%), Postives = 50/82 (60.98%), Query Frame = 1
Query:  649 AVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPP--------QPLPPGWERRLDTHNRVYYVDHNTRTTTWQRP 870
            ++L A +    PLP  +E+R D+ +R YFV+H TKTT WE P        +PLP GWE R       Y+VDHNTRTTT++ P
Sbjct:  442 SMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQGLPNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDP 523          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Mouse
Match: Wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:1861728])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 347/589 (58.91%), Postives = 441/589 (74.87%), Query Frame = 1
Query:  661 AADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX--------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            + + +T+ LP  +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP +  + N + +Q  R +    M+Q  NQRY        A+N        DP G LP GWEKR D+ +R YFVNH  KTT W+DPR Q      PLP GWEIR+T +G+ +FVDH T+TTT         +  +  P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++T++D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GK+   +LK  G +I VTEENK+EYI LM  WRFSRGV EQTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D+ DW+ N++YR YT++S QI WFW+FV +  N+ ++RLLQFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:  339 SGNTNTEALPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQ-FNQRYLYSASMLAAEN--------DPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQGLPNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYERSFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDNEVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 918          

HSP 2 Score: 72.4034 bits (176), Expect = 2.088e-12
Identity = 38/82 (46.34%), Postives = 50/82 (60.98%), Query Frame = 1
Query:  649 AVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPP--------QPLPPGWERRLDTHNRVYYVDHNTRTTTWQRP 870
            ++L A +    PLP  +E+R D+ +R YFV+H TKTT WE P        +PLP GWE R       Y+VDHNTRTTT++ P
Sbjct:  442 SMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQGLPNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDP 523          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Mouse
Match: Wwp2 (WW domain containing E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:1914144])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 385/810 (47.53%), Postives = 508/810 (62.72%), Query Frame = 1
Query:  178 LNILIKKFKVKVKNLGSHAELYVEYSVDDAPAK-KTTTKSTWNPD--WSEECNLLVEAKSSIKFILINNYKSQKKTLGKADVDLYKILCRFLGNLN-------NQELVVPIS-----STN-------SHTHIGDLTVVLKIASTINIPEEDRPR-----ANATGNLRGSNNSLPVSDSSPALNRAV----------------------------------------LPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPR----LQANPLPPGWEIRFTEDGMAFFVDHEXXXXX--------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            L + +   K KV N       YVE +VD  P++ K T K   + +  W+E   L V A+S +   + + +  + + LG A V+L  +L    G  +       +   + P +     STN       +H H G        AS  +    +R R     ++++G   G+ N  P   S P  +  V                                        LPAA  + D LP  +E+R     R Y+VDH TKTT+WE  +PLPPGWE+R D   R YYVDHNTRTTTWQRP    + N + +Q  R +    M Q  +QR+  Q+ + +    DPLG LP GWEKR D N R Y+VNH  +TT W+DPR    +Q   LPPGWE+++T +G+ +FVDH T+TTT         +  +     A +  F  K  QF + C +     HVKI V R  L EDSF +IM +KP DL++RL+I  + E+GLDYGGI+REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YFRF+GRF+AMA++H KFID+GFT+PFYK+ML KR TL+D+E++D E+YNS+ +I++NN++EC + L F  + E+ GK+   ELK  G +I VTEENK EYI L+ +WRF+RGV EQTKAF+DGFNE+  L WL+ +DE+++EL+LCGMQ+ID+ DW+ N+IYR YTK S QI+WFW+ V ++ N+++IRLLQFVTGTCRLPVGGF EL+GSNGPQKFCI+++GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL YA+ ETEGFGQE
Sbjct:   20 LTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIVLNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKRSQPPSRESSGTAIAPETRHQPPSTNCFGGRSRTHRHSGGSARTATAASEQSPGARNRHRQPVKNSSSSGLANGTVNEEPTPASEPEESSVVGVTSLPAAALSVSSNPNTTSLPAQSTPAEGEEASTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWE--RPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAM-QHFSQRFLYQSSSASTDH-DPLGPLPPGWEKRQD-NGRVYYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIKENNLEECGLELFFIQDMEILGKVTTHELKEGGENIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKNAIYRHYTKSSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDRVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLYAIEETEGFGQE 824          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Mouse
Match: Wwp2 (WW domain containing E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:1914144])

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 351/621 (56.52%), Postives = 449/621 (72.30%), Query Frame = 1
Query:  568 PRANATGNLRGSNNSLPVSDSSPALNRAV-------LPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPR----LQANPLPPGWEIRFTEDGMAFFVDHEXXXXX--------XXXXXXXXXXAEETQFLRKQSQFYYYCQ-NAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            P A  + +   +  SLP + S+PA            LPAA  + D LP  +E+R     R Y+VDH TKTT+WE  +PLPPGWE+R D   R YYVDHNTRTTTWQRP    + N + +Q  R +    M Q  +QR+  Q+ + +    DPLG LP GWEKR D N R Y+VNH  +TT W+DPR    +Q   LPPGWE+++T +G+ +FVDH T+TTT         +  +     A +  F  K  QF + C  NA+P  HVKI V R  L EDSF +IM +KP DL++RL+I  + E+GLDYGGI+REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YFRF+GRF+AMA++H KFID+GFT+PFYK+ML KR TL+D+E++D E+YNS+ +I++NN++EC + L F  + E+ GK+   ELK  G +I VTEENK EYI L+ +WRF+RGV EQTKAF+DGFNE+  L WL+ +DE+++EL+LCGMQ+ID+ DW+ N+IYR YTK S QI+WFW+ V ++ N+++IRLLQFVTGTCRLPVGGF EL+GSNGPQKFCI+++GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL YA+ ETEGFGQE
Sbjct:  257 PAAALSVSSNPNTTSLP-AQSTPAEGEEASTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWE--RPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAM-QHFSQRFLYQSSSASTDH-DPLGPLPPGWEKRQD-NGRVYYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPS-HVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIKENNLEECGLELFFIQDMEILGKVTTHELKEGGENIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKNAIYRHYTKSSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDRVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLYAIEETEGFGQE 870          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Mouse
Match: Itch (itchy, E3 ubiquitin protein ligase [Source:MGI Symbol;Acc:MGI:1202301])

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 335/586 (57.17%), Postives = 435/586 (74.23%), Query Frame = 1
Query:  658 PAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQR--YGAQNWAGNIQ--RVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQAN----PLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEET-------QFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            P   +S  PLP  +E+R D   R Y+VDH+ K T+W+ P+PLPPGWERR+D   R+YYVDH TRTTTWQRP +  + N + +Q  R++    M+Q  NQR  YG Q+     Q    DPLG LP GWEKRTD+N R YFVNH  + T W+DPR Q      PLP GWE+RFT DG+ +FVDH  + TT+ DPRT     +          F  K   F ++CQ      H+KI V R  L EDSF +IM   P+DL++RL++ F  E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS+INP+HL+YFRF+GRF+AMA+FH KFID+GF++PFYK++L K + L+D+E++D E+YNSL ++++NNI+EC + + FS + E+ G+I+  +LK NG +I VTEENK EYI ++  WR SRGV EQT+AF +GFNEI+   +LQ +D +++E+LLCGMQ+ID+ DW+ ++IYR YT+ S QI WFW+FV ++ N++++RLLQFVTGTCRLPVGGF +LMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:  280 PLNTVSQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPEPLPPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQ-FNQRFIYGNQDLFATSQNKEFDPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEGWEMRFTVDGIPYFVDHNRRATTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECGLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYTRTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 864          
BLAST of E3 ubiquitin-protein ligase vs. UniProt/SwissProt
Match: sp|Q8BZZ3|WWP1_MOUSE (NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Mus musculus OX=10090 GN=Wwp1 PE=1 SV=2)

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 347/589 (58.91%), Postives = 441/589 (74.87%), Query Frame = 1
Query:  661 AADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX--------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            + + +T+ LP  +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP +  + N + +Q  R +    M+Q  NQRY        A+N        DP G LP GWEKR D+ +R YFVNH  KTT W+DPR Q      PLP GWEIR+T +G+ +FVDH T+TTT         +  +  P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++T++D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GK+   +LK  G +I VTEENK+EYI LM  WRFSRGV EQTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D+ DW+ N++YR YT++S QI WFW+FV +  N+ ++RLLQFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:  339 SGNTNTEALPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQ-FNQRYLYSASMLAAEN--------DPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQGLPNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYERSFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDNEVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 918          

HSP 2 Score: 72.4034 bits (176), Expect = 1.461e-11
Identity = 38/82 (46.34%), Postives = 50/82 (60.98%), Query Frame = 1
Query:  649 AVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPP--------QPLPPGWERRLDTHNRVYYVDHNTRTTTWQRP 870
            ++L A +    PLP  +E+R D+ +R YFV+H TKTT WE P        +PLP GWE R       Y+VDHNTRTTT++ P
Sbjct:  442 SMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQGLPNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDP 523          
BLAST of E3 ubiquitin-protein ligase vs. UniProt/SwissProt
Match: sp|Q9H0M0|WWP1_HUMAN (NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens OX=9606 GN=WWP1 PE=1 SV=1)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 347/589 (58.91%), Postives = 441/589 (74.87%), Query Frame = 1
Query:  661 AADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX--------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            + + +T+ LP  +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP +  + N + +Q  R +    M+Q  NQRY        A+N        DP G LP GWEKR D+ +R YFVNH  KTT W+DPR Q      PLP GWEIR+T +G+ +FVDH T+TTT         +  +  P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++T++D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GK+   +LK  G +I VTEENK+EYI LM  WRFSRGV EQTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D+ DW+ N++YR YT++S QI WFW+FV +  N+ ++RLLQFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:  343 SGNANTETLPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRRRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQ-FNQRYLYSASMLAAEN--------DPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQGLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQIAYERGFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDNEVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 922          
BLAST of E3 ubiquitin-protein ligase vs. UniProt/SwissProt
Match: sp|Q9Y0H4|SUDX_DROME (E3 ubiquitin-protein ligase Su(dx) OS=Drosophila melanogaster OX=7227 GN=Su(dx) PE=1 SV=1)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 351/615 (57.07%), Postives = 440/615 (71.54%), Query Frame = 1
Query:  610 SLPVSDSS-PALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-----GAQNWAGNIQRV----DPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA--------NPLPPGWEIRFTEDGMAFFVDHEXXXXX----------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
             LPVS S+ P L     PA D   +PLP  +E R D + R Y+VDH T++T WE P PLPPGWE R D   RVYYVDHNTR TTWQRP+   L    HFQ W+ +R + + Q  NQRY       Q  A   Q      D LG LP GWEK+  ++NR YFVNH N+TT W+DPR Q          PLPPGWEIR+T  G  FFVDH T+ TT                    A E  F  K SQF Y CQ+     H+KI V R  L EDS+++IMR+   +L++RL+I F+ E+GLDYGG+SREWFF LSHE+LNPMYCLFEYA+ NNYSLQINPAS++NP+HLQYF+F+GRF+AMA++H +FI SGFT+PFYK+ML K++T++DIET+D E+YNSL +++DNNIDEC + L FS ++E+ G+I   ELK NG    VTEENK EYI LM  WR +RG+ +QTK F++GFNE+V L WL+ +DER++EL+LCGMQ +DV+DW+ N+IYR Y ++S Q+ WFW+FV +  N+++ RLLQFVTGTCR+PVGGF ELMGSNGPQ+FCIEK+GKE+WLPRSHTCFNRLDLPPY SY+QL EKLT+A+ ETEGF QE
Sbjct:  344 GLPVSQSTDPQLQ--TQPADD---EPLPAGWEIRLDQYGRRYYVDHNTRSTYWEKPTPLPPGWEIRKDGRGRVYYVDHNTRKTTWQRPNSERLM---HFQHWQGQRAHVVSQG-NQRYLYSQQQQQPTAVTAQVTQDDEDALGPLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAPKGAKGVYGVPRAYERSFRWKLSQFRYLCQSNALPSHIKITVTRQTLFEDSYHQIMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLFEYANKNNYSLQINPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNKKLTIKDIETIDPEFYNSLIWVKDNNIDECGLELWFSVDFEVLGQIIHHELKENGEKERVTEENKEEYITLMTEWRMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQDVDVEDWQRNTIYRHYNRNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYKSYDQLVEKLTFAIEETEGFCQE 949          
BLAST of E3 ubiquitin-protein ligase vs. UniProt/SwissProt
Match: sp|Q9DBH0|WWP2_MOUSE (NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus musculus OX=10090 GN=Wwp2 PE=1 SV=1)

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 351/621 (56.52%), Postives = 449/621 (72.30%), Query Frame = 1
Query:  568 PRANATGNLRGSNNSLPVSDSSPALNRAV-------LPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPR----LQANPLPPGWEIRFTEDGMAFFVDHEXXXXX--------XXXXXXXXXXAEETQFLRKQSQFYYYCQ-NAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            P A  + +   +  SLP + S+PA            LPAA  + D LP  +E+R     R Y+VDH TKTT+WE  +PLPPGWE+R D   R YYVDHNTRTTTWQRP    + N + +Q  R +    M Q  +QR+  Q+ + +    DPLG LP GWEKR D N R Y+VNH  +TT W+DPR    +Q   LPPGWE+++T +G+ +FVDH T+TTT         +  +     A +  F  K  QF + C  NA+P  HVKI V R  L EDSF +IM +KP DL++RL+I  + E+GLDYGGI+REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YFRF+GRF+AMA++H KFID+GFT+PFYK+ML KR TL+D+E++D E+YNS+ +I++NN++EC + L F  + E+ GK+   ELK  G +I VTEENK EYI L+ +WRF+RGV EQTKAF+DGFNE+  L WL+ +DE+++EL+LCGMQ+ID+ DW+ N+IYR YTK S QI+WFW+ V ++ N+++IRLLQFVTGTCRLPVGGF EL+GSNGPQKFCI+++GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL YA+ ETEGFGQE
Sbjct:  257 PAAALSVSSNPNTTSLP-AQSTPAEGEEASTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWE--RPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAM-QHFSQRFLYQSSSASTDH-DPLGPLPPGWEKRQD-NGRVYYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPS-HVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIKENNLEECGLELFFIQDMEILGKVTTHELKEGGENIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKNAIYRHYTKSSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDRVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLYAIEETEGFGQE 870          
BLAST of E3 ubiquitin-protein ligase vs. UniProt/SwissProt
Match: sp|O00308|WWP2_HUMAN (NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens OX=9606 GN=WWP2 PE=1 SV=2)

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 342/585 (58.46%), Postives = 436/585 (74.53%), Query Frame = 1
Query:  655 LPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPR----LQANPLPPGWEIRFTEDGMAFFVDHEXXXXX--------XXXXXXXXXXAEETQFLRKQSQFYYYCQ-NAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            LPAA  + D LP  +E+R     R Y+VDH TKTT+WE  +PLPPGWE+R D   R YYVDHNTRTTTWQRP    + N + +Q  R +    M Q  +QR+  Q+ + +    DPLG LP GWEKR D N R Y+VNH  +TT W+DPR    +Q   LPPGWE+++T +G+ +FVDH T+TTT         +  +     A +  F  K  QF + C  NA+P  HVKI V R  L EDSF +IM +KP DL++RL+I  + E+GLDYGGI+REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YFRF+GRF+AMA++H KFID+GFT+PFYK+ML KR TL+D+E++D E+YNS+ +I++NN++EC + L F  + E+ GK+   ELK  G  I VTEENK EYI L+ +WRF+RGV EQTKAF+DGFNE+  L WL+ +DE+++EL+LCGMQ+ID+ DW+ ++IYR YTK+S QI+WFW+ V ++ N+++IRLLQFVTGTCRLPVGGF EL+GSNGPQKFCI+K+GKE+WLPRSHTCFNRLDLPPY SYEQL+EKL YA+ ETEGFGQE
Sbjct:  292 LPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWE--RPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAM-QHFSQRFLYQSSSASTDH-DPLGPLPPGWEKRQD-NGRVYYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPS-HVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIKENNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFNRLDLPPYKSYEQLREKLLYAIEETEGFGQE 870          
BLAST of E3 ubiquitin-protein ligase vs. TrEMBL
Match: A0A210PNA0 (E3 ubiquitin-protein ligase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14305 PE=4 SV=1)

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 365/580 (62.93%), Postives = 454/580 (78.28%), Query Frame = 1
Query:  673 STDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPR----LQANPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAE----------ETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            S +PLP  +E R D  +RPY+VDH T+TT+WE PQ LPPGWERR+D   RVYYVDHNTRTTTWQRP++ M+NN   +Q WR  R+  +EQ L  R+   N A   Q  DPLG LP+GWEKR DAN+R YFVNH N+TT W+DPR    +Q +PLP GWE+R+T +G+ +FVDH+TK+TTF DPR  P              E  F  K  QF Y C +    GHVKI V R+ L EDSF +IMR++P DL++RL+I FK E+GLDYGG++REWFF LSH++LNPMYCLFEYAS +NYSLQIN AS +NP+HL YFRF+GRF+AMA++H KFIDSGFT+PFYK+ML K++ L DIET+D E++NSL +I+DNNIDEC + L FSA++E+ GKIE+ +LK  G DI VTEENK EYI+LM NWRF RGV +QTKAF+DGF+E+V L WLQ +DER++EL+LCGMQ++DV DWE N+IYR Y ++S Q+ WFW+FV ++ N+++ RL+QFVTGTCRLPVGGF ELMGSNGPQ+FCIEK+GKE+WLPRSHTCFNRLDLPPY +YEQL EKLT A+ ETEGFGQE
Sbjct:  290 SNEPLPPGWEMRTDGHSRPYYVDHNTRTTTWERPQALPPGWERRVDPRGRVYYVDHNTRTTTWQRPNIDMVNNYQQWQEWRNNRSIALEQ-LQNRFLFPNPAQVTQENDPLGPLPEGWEKRVDANSRVYFVNHKNRTTQWEDPRTQGIVQEDPLPEGWEMRYTAEGVRYFVDHKTKSTTFQDPRGGPSKGPKGAFGVPIQYERSFRWKLGQFRYLCSSNALSGHVKITVSRDNLFEDSFAQIMRLQPYDLRRRLYIIFKGEEGLDYGGVAREWFFHLSHDVLNPMYCLFEYASHSNYSLQINAASNVNPDHLVYFRFIGRFIAMALYHGKFIDSGFTLPFYKRMLNKKLHLTDIETIDPEFFNSLTWIQDNNIDECGLELFFSADFEVLGKIEQHDLKEGGADIRVTEENKEEYINLMTNWRFQRGVEDQTKAFLDGFSEVVPLQWLQYFDERELELMLCGMQEVDVDDWERNTIYRHYQRNSKQVVWFWKFVREIDNEKRTRLMQFVTGTCRLPVGGFAELMGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYRTYEQLVEKLTMAIEETEGFGQE 868          
BLAST of E3 ubiquitin-protein ligase vs. TrEMBL
Match: K1QYN2 (E3 ubiquitin-protein ligase OS=Crassostrea gigas OX=29159 GN=CGI_10010750 PE=4 SV=1)

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 377/616 (61.20%), Postives = 465/616 (75.49%), Query Frame = 1
Query:  568 PRANATGNLRGSNNSLPVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPR----LQANPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAE----------ETQFLRKQSQFYYYC-QNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            P  N TG    S+ S   +  +    +A    ++ ST+PLP  +E R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP+  MLNN   +Q  R  RN  +E  L  R+   N        DPLG+LP+GWEKR D N R YFVNH N+TT W+DPR    +Q +PLP GWE+R+T DG+ +FVDH TKTTTF DPR                 E  F  K  QF Y C  NA+P GHVKI V R+ L EDSF +IMR++P DL++RL+I FK E+GLDYGG++REWFF LSH++LNPMYCLFEYAS +NY LQIN AS +NP+HL YFRF+GRF+AMA++H KFIDSGFT+PFYK+ML K++ L+DIET+D E+YNSL +IRDNNI+EC + L F+A++E+ GK+E+ +LK  G +I+VTEENK EYIDLM NWRFSRGV EQ+KAF+DGF+E+V L WLQ +DER++EL+LCGMQ++DV DWE N+IYR Y ++S Q+ WFW+FV ++ N++KIRLLQFVTGTCRLPVGGF ELMGSNGPQ+FCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQL EKLT A+ ETEGFGQE
Sbjct:  218 PATNGTGGATHSDESDGQTGPAGHPTQAQQNQSN-STEPLPAGWEMRTDAHGRSYYVDHNTRTTTWERPQPLPPGWERRVDPRGRVYYVDHNTRTTTWQRPNTDMLNNYSAWQDHRNNRNIQLEH-LQNRFLFPNPQQVTPDNDPLGSLPEGWEKRIDPNGRVYFVNHKNRTTQWEDPRTQGIVQEDPLPEGWEMRYTADGVRYFVDHNTKTTTFQDPRGGQGKGPKGAYGVPLQYERSFRWKLGQFRYLCTSNALP-GHVKITVSRDNLFEDSFQQIMRLQPFDLRRRLYIIFKGEEGLDYGGVAREWFFHLSHDVLNPMYCLFEYASTSNYCLQINAASSVNPDHLVYFRFIGRFIAMALYHGKFIDSGFTLPFYKRMLSKKLYLKDIETIDPEFYNSLVWIRDNNIEECGLELFFTADFEVLGKVEQHDLKEGGSEIKVTEENKEEYIDLMTNWRFSRGVEEQSKAFLDGFSEVVPLQWLQYFDERELELMLCGMQEMDVDDWERNTIYRHYQRNSKQVMWFWKFVREIDNEKKIRLLQFVTGTCRLPVGGFAELMGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYRSYEQLVEKLTMAIEETEGFGQE 830          
BLAST of E3 ubiquitin-protein ligase vs. TrEMBL
Match: A0A267GGT3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004025g1 PE=4 SV=1)

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 399/785 (50.83%), Postives = 513/785 (65.35%), Query Frame = 1
Query:  148 ATNNVQSAFTLNILIKKFKVKVKNL--GSHAELYVEYSVDDAPAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTLGKADVDLYKILCRFLGNLNNQELVVPISSTN--SHTHIGDLTVVLKIASTINIPEEDRPRANATGNLRGSNNSLPVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERN--NYMEQTLNQ---------RYGAQNWAGN----------------IQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQAN-------PLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXX------XXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            A+ +  + F LN+ I   K  V N+  G+  +L  E + D    +  T K TW P W+E+  LLV A+S + F L+   +S      +  VDL + L    G L N++L +P+++        +G+L V L     +N+    +    +TG   G +N+                    S + LP  +E R D   RPY+VDH  +TT+WE P PLPPGWERR D + R YYVDHNTRTTTWQRP  ++L    +FQ WR  +N  ++  + +N            G+ +  GN                      LG LP+GWEKR D   R YFVNH N+TT W+DPR   N       PLP GWEIR+T +G+ +FVDH T++TTFTDPRT      +     E  F  K  QF Y+CQ+   +GHVKI V R  LMEDSF++IMR+ P DL+KRL+IQFK E+GLDYGG++REWFF LSHEL+NPMYCLFEYAS+NNYSLQINP S INP+HLQYFRF+GRF+AMA++H KFID+GFT+PFYK ML K + L+DIETVD  YYNSL  IRD++++ECD+G+ FS +YE+ G+I E ELK  GRDI V  +NK +YI L+V WRF RGV EQ  AF++GF E++ L WL+ +DER++EL+LCGMQ+IDV DWE ++IYR Y + S Q++W W FV +L N+++ RLLQFVTGTCRLPVGGF EL+GSNGPQKFC+EK GKE+ LPRSHTCFNRLDLPPY SYEQLKEKL YA+ ETEGF QE
Sbjct:    7 ASASGSTLFQLNVAINSAKF-VPNVARGAPPDLLCEVAFDGNTKRTETRKKTWKPAWNEDFTLLVTARSKLDFKLMKPSRSSATLFCQGSVDLLQKLTESNGLLRNKKLTIPLAAEGRPDGQRLGELLVTL-TCDQVNMSAIQQQSQQSTGAATGDSNN--------------------SGEDLPPGWEMRRDARGRPYYVDHNNRTTTWERPSPLPPGWERRTDPNGRTYYVDHNTRTTTWQRPSTNLLQAQQNFQDWRNAQNFQDFANRFINMPGAGGAGNADAGSGSETGNGTAPTAGTGGSSTTGSGSEDGGLGPLPEGWEKRIDPQGRAYFVNHRNRTTQWEDPRRLGNLKPDEERPLPEGWEIRYTREGLKYFVDHNTRSTTFTDPRTGINVHPSATMQYERHFQWKLGQFRYHCQSNALQGHVKIQVSRQNLMEDSFHQIMRIDPVDLRKRLYIQFKGEEGLDYGGLAREWFFHLSHELMNPMYCLFEYASNNNYSLQINPGSSINPDHLQYFRFIGRFIAMALYHGKFIDNGFTLPFYKMMLNKPLNLKDIETVDNSYYNSLLSIRDSDLEECDLGMYFSVDYEVLGEIREHELKPGGRDIPVNNDNKEDYIQLIVEWRFRRGVQEQMNAFLNGFKEVIPLEWLRYFDERELELMLCGMQEIDVDDWERSTIYRHYNRSSKQVQWLWRFVRELDNEKRTRLLQFVTGTCRLPVGGFAELIGSNGPQKFCVEKCGKETSLPRSHTCFNRLDLPPYKSYEQLKEKLLYAIEETEGFTQE 769          
BLAST of E3 ubiquitin-protein ligase vs. TrEMBL
Match: A0A4W3IVH1 (E3 ubiquitin-protein ligase OS=Callorhinchus milii OX=7868 GN=wwp1 PE=4 SV=1)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 392/798 (49.12%), Postives = 521/798 (65.29%), Query Frame = 1
Query:  145 NATNNVQSAFTLNILIKKFKVKVKNLGSHAELYVEYSVDDAPAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKT-LGKADVDLYKILCRFLGNLNNQELVVPISSTNSH--THIGDLTVVL-----KIASTINIP--------------EEDRPRAN------------ATGNLRGSNNSLPV----SDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY-------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX-------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            + +NN      L++ +   K+K +       +YVE S +    K   + S+ NP W E+  + V   + + F + +++  +    LGKA +D+ + L      L N + V+ ++  N +     G+LTV L        S  N+P                 R R              +T   R S  + PV    S+SSP  + A  P +  +  P P   ++R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP +  + N + +Q  R +    M+Q  NQRY        A+N        DPLG LP GWE+R DAN+R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH T+TTT        +     P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++T++D+E++D E+YNSL +IRDNNI+EC + + F+ + E+ GK+   ELK  G +I VTEENK EYI LM  WRF+RGV EQT+AF+DGFNE+V L WLQ +DE+++E++LCGMQ++D+ DW+ N++YR YT++S QI WFW+FV ++ N+ ++RLLQFVTGTCRLP+GGF EL+GSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:    9 DTSNNHNGRSQLHVTVASAKLKRRKNWFGTAIYVELSAEGELKKTAKSNSSSNPKWDEDLTVNVAQHTKLDFKIWSHHTLKSDALLGKATLDINQALELHNRKLENVKEVLKLTLENKNRVVQTGELTVFLDGMTMDQESVPNVPTIQNGDAIHVNGGDTSGRARTRSCTETSNCADSPSTSFSRQSAANSPVLNGESNSSPT-HEAARPKS--APAPKPIETQQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQLQGAMQQ-FNQRYLYSASMLSAEN--------DPLGPLPPGWERRVDANDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVRYFVDHNTRTTTFQDPRTGKSSVAKGPQIAYERSFRWKLAHFRYLCQSNALPSHVKITVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLNKKLTIKDLESIDPEFYNSLIWIRDNNIEECGLEMYFAVDMEILGKVTSHELKAGGSNILVTEENKEEYIGLMAEWRFTRGVEEQTRAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLTDWQRNTVYRHYTRNSKQIIWFWQFVKEMDNEVRLRLLQFVTGTCRLPLGGFAELLGSNGPQKFCIEKVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 794          
BLAST of E3 ubiquitin-protein ligase vs. TrEMBL
Match: A0A1S3H5B3 (E3 ubiquitin-protein ligase OS=Lingula unguis OX=7574 GN=LOC106151787 PE=4 SV=1)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 357/579 (61.66%), Postives = 452/579 (78.07%), Query Frame = 1
Query:  679 DPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGA-QNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPR----LQANPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAE----------ETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            +PLP  +ERR D   RPY+VDH T+TT+WE P PLPPGWERR+D   RVYYVDH TRTTTWQRP+  M++NI+ ++ WR  +       +  R+   QN A N +  DPLG LP+GWEKR DAN R YFVNH N+TT W+DPR    +Q +PLP GWE+R+T +G+ +FVDH +++TTF DPR  P              E  F  K  QF Y CQ+    GHVKI + RN L E+SF++IMR++P DL++RL+I F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA+ NNYSLQIN AS +NP+HL YFRF+GR +AMA++H KFIDSGFT+PFYKKML K++T+ D+E++D E++NSL +I++NNI+EC + + FSA++E  GKIE  ELK NG  +EVTE NK+EYI+LM NWRF+RGV EQTKAF+DGFNE+V L WLQ +DER++EL+LCGMQ++D+ DWE N+IYR YT+ S Q+ WFW+FV ++ N+++ RLLQFVTGTCRLPVGGF ELMGSNGPQ+FCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQL EKLT+A+ ETEGFGQE
Sbjct:  273 EPLPSGWERRIDAQQRPYYVDHNTRTTTWERPTPLPPGWERRVDPRGRVYYVDHTTRTTTWQRPNQDMVSNINSWRNWRQNQAAQAWDQMQHRFLVPQNPALNPEN-DPLGPLPEGWEKRVDANGRMYFVNHKNRTTQWEDPRTQGIIQEDPLPEGWEMRYTPEGVRYFVDHNSRSTTFQDPRGKPAKGPKGAYGVPIQYERSFRWKLGQFRYLCQSNSLPGHVKISLSRNSLFEESFSQIMRLQPFDLRRRLYIIFRGEEGLDYGGLAREWFFHLSHEVLNPMYCLFEYANSNNYSLQINAASSVNPDHLMYFRFIGRVIAMALYHGKFIDSGFTLPFYKKMLNKKLTMTDLESIDPEFFNSLVWIKENNIEECGLEMFFSADFETLGKIEHVELKENGDKVEVTEANKDEYIELMTNWRFTRGVEEQTKAFLDGFNEVVPLQWLQYFDERELELMLCGMQEVDIDDWEKNTIYRHYTRSSKQVVWFWKFVREIDNEKRTRLLQFVTGTCRLPVGGFSELMGSNGPQRFCIEKVGKETWLPRSHTCFNRLDLPPYKSYEQLVEKLTFAIEETEGFGQE 850          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Cavefish
Match: wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:103040182])

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 344/577 (59.62%), Postives = 440/577 (76.26%), Query Frame = 1
Query:  673 STDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX-------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            + DPLP  +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   R+YYVDHNTRTTTWQRP +  + N + +Q  R++    M Q  NQRY       + +  DPLG LP GWE+R D+N+R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH T+TTT        +     P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++ L+D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GKI   +LK +G +I VTEENK EYI LM  WRFSRGV  QTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D++DW+ N++YR YT++S QI WFW+FV ++ N+ ++RLLQFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY S+EQLKEKL +A+ ETEGFGQE
Sbjct:  346 TADPLPPGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRIYYVDHNTRTTTWQRPTMESVRNFEQWQSQRSQLQGAMHQ-FNQRYLYSASMMSAEN-DPLGPLPPGWERRVDSNDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVRYFVDHNTRTTTFSDPRTGKSSVTKGPQIAYERSFRWKLAHFRYLCQSNALSSHVKITVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLNKKLILKDLESIDPEFYNSLIWIRDNNIEECSLEMYFSVDMEILGKITSHDLKPDGANILVTEENKEEYIGLMAEWRFSRGVEGQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLQDWQRNTVYRHYTRNSKQIMWFWQFVKEVDNEVRLRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSFEQLKEKLLFAIEETEGFGQE 920          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Cavefish
Match: itcha (E3 ubiquitin-protein ligase Itchy-like [Source:NCBI gene;Acc:103032591])

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 338/586 (57.68%), Postives = 435/586 (74.23%), Query Frame = 1
Query:  661 AADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQR--YGAQNW---AGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEET-------QFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
             + ++  PLP  +E+R D   R YFVDH+ K T+WE P+PLPPGWERRLD   RVYYVDH +RTTTWQRP    + N + +Q  R++    M Q  NQR  YG Q+    A N +  DPLG LPQGWEKRTD+N R YFV+H  +TT W+DPR Q      PLP GWE+RFT DG+ +FVDH  + TT+ DPRT   + E          F  K   F ++CQ      H+KI V R  L EDSF +IM   P+DL++RL+I F  E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL+YF+F+GRF+AMA+FH KFID+GF++PFYK++L K + L+D+E++D E+YNSL +I++NN+ EC++ + FS + E+ G++   ELK +G +I VTEENK EYI L+  WR SRGV EQT+AF +GFNE++   +LQ +D +++E++LCGMQ+ID+ DW+ N+IYR Y + S QI WFW+FV ++ N++++RLLQFVTGTCRLPVGGF +LMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEKLT A+ ETEGFGQE
Sbjct:  270 VSPINNGPLPPGWEQRVDQNGRLYFVDHIEKRTTWERPEPLPPGWERRLDPMGRVYYVDHISRTTTWQRPTAESVRNYEEWQNQRSQLQGAMHQ-FNQRFIYGLQDQLAPAAN-KEFDPLGPLPQGWEKRTDSNGRMYFVHHPTRTTQWEDPRTQGLLNEKPLPEGWEMRFTVDGIPYFVDHNRRRTTYIDPRTGKSSLENGPQITYVRDFKAKVHYFRFWCQQLSMPQHIKIHVNRKTLFEDSFQQIMSFHPQDLRRRLWIIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASSINPDHLKYFKFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPLALKDLESIDPEFYNSLIWIKENNLQECELEMYFSVDKEILGEVTTHELKPDGGNILVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQYFDAKELEVMLCGMQEIDLSDWQRNTIYRHYARSSKQIIWFWQFVKEMDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLTLAIEETEGFGQE 853          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Cavefish
Match: itcha (E3 ubiquitin-protein ligase Itchy-like [Source:NCBI gene;Acc:103032591])

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 338/586 (57.68%), Postives = 435/586 (74.23%), Query Frame = 1
Query:  661 AADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQR--YGAQNW---AGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEET-------QFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
             + ++  PLP  +E+R D   R YFVDH+ K T+WE P+PLPPGWERRLD   RVYYVDH +RTTTWQRP    + N + +Q  R++    M Q  NQR  YG Q+    A N +  DPLG LPQGWEKRTD+N R YFV+H  +TT W+DPR Q      PLP GWE+RFT DG+ +FVDH  + TT+ DPRT   + E          F  K   F ++CQ      H+KI V R  L EDSF +IM   P+DL++RL+I F  E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL+YF+F+GRF+AMA+FH KFID+GF++PFYK++L K + L+D+E++D E+YNSL +I++NN+ EC++ + FS + E+ G++   ELK +G +I VTEENK EYI L+  WR SRGV EQT+AF +GFNE++   +LQ +D +++E++LCGMQ+ID+ DW+ N+IYR Y + S QI WFW+FV ++ N++++RLLQFVTGTCRLPVGGF +LMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEKLT A+ ETEGFGQE
Sbjct:  189 VSPINNGPLPPGWEQRVDQNGRLYFVDHIEKRTTWERPEPLPPGWERRLDPMGRVYYVDHISRTTTWQRPTAESVRNYEEWQNQRSQLQGAMHQ-FNQRFIYGLQDQLAPAAN-KEFDPLGPLPQGWEKRTDSNGRMYFVHHPTRTTQWEDPRTQGLLNEKPLPEGWEMRFTVDGIPYFVDHNRRRTTYIDPRTGKSSLENGPQITYVRDFKAKVHYFRFWCQQLSMPQHIKIHVNRKTLFEDSFQQIMSFHPQDLRRRLWIIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASSINPDHLKYFKFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPLALKDLESIDPEFYNSLIWIKENNLQECELEMYFSVDKEILGEVTTHELKPDGGNILVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQYFDAKELEVMLCGMQEIDLSDWQRNTIYRHYARSSKQIIWFWQFVKEMDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLTLAIEETEGFGQE 772          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Cavefish
Match: itchb (E3 ubiquitin-protein ligase Itchy [Source:NCBI gene;Acc:103022206])

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 338/593 (57.00%), Postives = 433/593 (73.02%), Query Frame = 1
Query:  637 ALNRAVLPA-ADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY---GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEET-------QFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            AL  A  P+   ++T PLP  +E+R D   R YFVDH+ K T+WE P+PLPPGWERR+D   RVY+VDH TR+TTWQRP V  + N + +Q  R++    M Q  N+R+     Q      +  DPLG LP GWEKRTDAN R YFV+H  + T W+DPR Q      PLP GWE+RFT DG+ +FVDH  +TTT+ DPRT   + E          F  K   F ++CQ      H+KI V R  L EDSF +IM    +DL++RL+I F  E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS+INP+HL+YFRF+GRF+AMA+FH KFID+GF+ PFYK++L K + L D+E++D E+YNSL +I++NNI+EC + + FS + ++ G+I   ELK  G DI+VTEENK EYI L+  WR SRGV EQT+AF +GFNE++   +LQ +D +++E+LLCGMQ+ID+ DW+ N+IYR YT+ + QI WFW+ V ++ N++++RLLQFVTGTCRLPVGGF +LMGSNGPQKFCIEK GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:  283 ALTVAPAPSRMSMATGPLPPGWEQRVDQNGRMYFVDHVEKRTTWERPEPLPPGWERRVDPMGRVYFVDHTTRSTTWQRPTVETVRNYEQWQHQRSQLEGAMHQ-FNRRFIVGEPQAVPAQNKEFDPLGPLPHGWEKRTDANGRVYFVHHPTRCTQWEDPRSQGLLNEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSSLENGPQITYVRDFKAKVQYFRFWCQQLALPQHIKINVTRKTLFEDSFQQIMSFSAQDLRRRLWIIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSQPFYKRILNKPLGLGDLESIDPEFYNSLIWIKENNIEECGLEMFFSVDKDILGEITTHELKPEGGDIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQYFDAKELEVLLCGMQEIDLADWQRNTIYRHYTRGNKQIVWFWQLVKEMDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKTGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 874          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Cavefish
Match: itchb (E3 ubiquitin-protein ligase Itchy [Source:NCBI gene;Acc:103022206])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 369/777 (47.49%), Postives = 495/777 (63.71%), Query Frame = 1
Query:  160 VQSAFTLNILIKKFKVKVKNLGSHAELYVEYSVDDAPAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTL-GKADVDLYKILCRFLGNLNNQELVVPISSTNSHTHIGDLTVVLKIASTINIPEEDRPRANATGNLRGSNNSLPVSDS-------------------------SPALNRAVLPAADLSTDPLPQH-YERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY--GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEET-------QFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            +++   + +L  K K   KN    +  YVE +VD    K     +T +P W +   ++V   S + F + ++   +   L G A +D+ ++L        N ++    SS N+      + V L+ +   +    D     +  N R  N +   S S                         SP L  A++         +  + +E+R D   R YFVDH+ K T+WE P+PLPPGWERR+D   RVY+VDH TR+TTWQRP V  + N + +Q  R++    M Q  N+R+  G Q      +  DPLG LP GWEKRTDAN R YFV+H  + T W+DPR Q      PLP GWE+RFT DG+ +FVDH  +TTT+ DPRT   + E          F  K   F ++CQ      H+KI V R  L EDSF +IM    +DL++RL+I F  E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS+INP+HL+YFRF+GRF+AMA+FH KFID+GF+ PFYK++L K + L D+E++D E+YNSL +I++NNI+EC + + FS + ++ G+I   ELK  G DI+VTEENK EYI L+  WR SRGV EQT+AF +GFNE++   +LQ +D +++E+LLCGMQ+ID+ DW+ N+IYR YT+ + QI WFW+ V ++ N++++RLLQFVTGTCRLPVGGF +LMGSNGPQKFCIEK GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:   16 MKAQLQIVVLSAKLKENKKNWFGPSP-YVEVAVDGQSKKTEKCNNTHSPKWKQPLTVIVTPFSKLIFRVWSHQTLKSDLLLGVATLDISEML-------KNNDMK---SSVNAFCVCVCVCVYLRKSREGSPTVMDAQERLSAPNGRAVNGTGSPSTSARSSRPLRPPRPSRPPPPTPRRPVSSPGLWTALISVCVCVCVCVRTYRWEQRVDQNGRMYFVDHVEKRTTWERPEPLPPGWERRVDPMGRVYFVDHTTRSTTWQRPTVETVRNYEQWQHQRSQLEGAMHQ-FNRRFIVGPQAVPAQNKEFDPLGPLPHGWEKRTDANGRVYFVHHPTRCTQWEDPRSQGLLNEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSSLENGPQITYVRDFKAKVQYFRFWCQQLALPQHIKINVTRKTLFEDSFQQIMSFSAQDLRRRLWIIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSQPFYKRILNKPLGLGDLESIDPEFYNSLIWIKENNIEECGLEMFFSVDKDILGEITTHELKPEGGDIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQYFDAKELEVLLCGMQEIDLADWQRNTIYRHYTRGNKQIVWFWQLVKEMDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKTGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 780          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Sea Lamprey
Match: wwp2 (WW domain containing E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-000607-82])

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 322/578 (55.71%), Postives = 404/578 (69.90%), Query Frame = 1
Query:  682 PLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYME--QTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA-----NPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEE------TQFLRKQSQ-FYYYCQNAVPEGHVKIIVRRNMLME-DSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            P    +E+R D   R YFVDH TKTT+WE PQPLPPGWERR+D   RVYYVDHNTRTTTWQRP    + N   F++W+++RN      Q  NQR+  Q   G     DPLGALP GWEKR +   R YFVNH  +TT W+DPR Q       PLP GWE RFT +G+ +FVDH  +TTTF DPR   + A        +  L+     F  +  + + + H +  +  +        N  +   P        +             SREWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YFRF+GRF+AMA++H KFID+GF++PFYK+ML K++T++D+E++D E+YNSL ++RDNNI+EC + + FS + EL GK+   +LK +G DI VTEENK EYI LM  WRFSRGV EQTKAF+DGF+E+V L WL  +DER++E++LCGMQ+ID+ DW+ ++IYR Y + S QI WFW+ V ++ N++++RLLQFVTGTCRLPVGGF EL+GSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEKL YA+ ETEGFGQE
Sbjct:  359 PCAARWEQRADPHGRLYFVDHNTKTTTWERPQPLPPGWERRVDVRGRVYYVDHNTRTTTWQRPTTESVRN---FEQWQSQRNQLQGAMQLFNQRFLFQT-GGLPTENDPLGALPSGWEKRIEQGGRMYFVNHNTRTTQWEDPRTQGCVLSEEPLPDGWETRFTNEGVRYFVDHTMRTTTFQDPRPGAKAAGHFGAHIPSHLLQSHPHHFGVHIPSHLLQSHPQFGIPPDTCYTFAGRNGAVPTPPASSTLTASLPACPPPPSALMSASREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLAYFRFIGRFIAMALYHGKFIDTGFSLPFYKRMLNKKLTIKDLESIDPEFYNSLIWLRDNNIEECGLEMFFSVDMELLGKVSSHDLKPDGSDILVTEENKEEYIGLMTEWRFSRGVEEQTKAFLDGFSEVVPLQWLLYFDERELEVMLCGMQEIDLADWQRSTIYRHYNRSSKQISWFWQVVKEMDNEKRLRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIEKVGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLYAIEETEGFGQE 932          

HSP 2 Score: 64.3142 bits (155), Expect = 1.216e-10
Identity = 34/81 (41.98%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  655 LPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPP---------QPLPPGWERRLDTHNRVYYVDHNTRTTTWQRP 870
            LP  +     LP  +E+R +   R YFV+H T+TT WE P         +PLP GWE R       Y+VDH  RTTT+Q P
Sbjct:  457 LPTENDPLGALPSGWEKRIEQGGRMYFVNHNTRTTQWEDPRTQGCVLSEEPLPDGWETRFTNEGVRYFVDHTMRTTTFQDP 537          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Sea Lamprey
Match: nedd4a (NEDD4 E3 ubiquitin protein ligase a [Source:ZFIN;Acc:ZDB-GENE-051005-2])

HSP 1 Score: 404.831 bits (1039), Expect = 1.596e-131
Identity = 218/470 (46.38%), Postives = 295/470 (62.77%), Query Frame = 1
Query: 1012 LPQGWEKRTDANNRTYFVNHVNKTTHWDD--------PRLQANPLP-PGWEIRFTEDGMAFFVDHEXXXXX--XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPE-----GHVKIIVRRNMLMEDSFNEIMRVKPRDLQK-RLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPAS-FINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGK-IEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYR-VYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGF 2361
            LP GWE R   N R +F++H N+TT W          PR    PLP PGWE R   DG  F++DH TK T       +    T     + R   Q Y + +  + +        ++ + R  ++EDS+  I+ VK  DL K RL+I+F  E GLDYGG++REWFF +S E+ NP Y LFEY++ +NY+LQINP S   N EHL YF F+GR   MA+FH K +D  F  PFYK ML K ITL D+E+VD EYYNSL +I +N  D  D+ L F  + E+FG+     ELK NG +I VT ENK EYI+L++ WRF   V +Q  AFM+GF+E++ +  ++++DE ++ELL+CG+  +DV DW  ++IY+  Y  + P I+WFW+ V  +  +++IRLLQFVTGT R+P+ GF EL GSNGPQ F IE       LPR+HTCFNRLDLPPY S++ L+EKL  A+   +GF
Sbjct:   23 LPAGWEMRFAPNGRPFFIDHNNRTTTWSHISLSTMLHPRFSLFPLPHPGWEERTHSDGRTFYIDHNTKNTQWEDPRLQNPAITGPAVPYSRDYKQKYDFFRKKLKKPADIPNRFEMKLHRASILEDSYRRIVAVKRADLLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPISGLCNEEHLSYFTFIGRVAGMAVFHGKLLDGFFIRPFYKMMLQKPITLNDMESVDSEYYNSLMWILEN--DPADLDLRFCIDEEMFGQQTHLVELKPNGSEILVTNENKKEYIELVIQWRFVERVQKQINAFMEGFSELIPMDLIKIFDENELELLMCGLGDVDVNDWRQHTIYKNSYCANHPVIQWFWKAVLLMDGEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEMWSTSEKLPRAHTCFNRLDLPPYESFDDLREKLNIAIENAQGF 490          

HSP 2 Score: 61.6178 bits (148), Expect = 5.719e-10
Identity = 30/75 (40.00%), Postives = 40/75 (53.33%), Query Frame = 1
Query:  685 LPQHYERRFDNFNRPYFVDHLTKTTSWEPPQ------------PLP-PGWERRLDTHNRVYYVDHNTRTTTWQRP 870
            LP  +E RF    RP+F+DH  +TT+W                PLP PGWE R  +  R +Y+DHNT+ T W+ P
Sbjct:   23 LPAGWEMRFAPNGRPFFIDHNNRTTTWSHISLSTMLHPRFSLFPLPHPGWEERTHSDGRTFYIDHNTKNTQWEDP 97          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Sea Lamprey
Match: smurf2 (SMAD specific E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:563633])

HSP 1 Score: 348.977 bits (894), Expect = 3.357e-107
Identity = 236/749 (31.51%), Postives = 360/749 (48.06%), Query Frame = 1
Query:  283 TTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTLGKADVDLYKIL-----------------CRFLGNLNNQELVVPISSTNSHTHIGDLTVVLKIASTI--NIPE--------------------------EDRPRA--NATGNLRGSNNSLPVSDSSPALNRAVL---PAADLSTDPLPQHYER--RFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQANPLPPGWEIRFTEDGMAFF----------VDHEXXXXXXXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFS-AEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKI-GKESWLPRSHTCFNRLDLP--PYASYEQLKEKL 2331
            T ++T +P W++  +L +    SI   + N  K  KK  G   +   ++L                 CR   + N+      + S  S   IG    V+        ++PE                            RP A     G +       P+     A  RA     P+A  +    P+   R  R  NF        L++T   +PP  LP G+E+R     ++Y++   T  +TW  P V    ++ H                                + LG LP GWE R+ A  R YFV+H N+TT + DPRL AN L    + R T+ G               D E     +             +   +QSQ           GH ++ V R  + E+S+ ++M+++PRDL+KRL ++F+ E+GLDYGG++REW + LSHE+LNP Y LF+Y+ D+ Y+LQINP S INPEHL YF FVGR + MA+FH  +ID GFT+PFYK++LGK ITL D+ETVD E + SL +I +N+    D+ ++     +  +G   +   +T  + +            L V+WRF RG+  Q  A   GFNE++    L+ +DE+++EL++ G+ +IDV DW++N+  +  T +S  ++WFW  V     + + RLLQFVTG+ R+P+ GF+ L G+ GP+ F I  I  K   LP++HTCFNR+D+   PY +   + +++
Sbjct:   52 TVRNTLDPKWNQHYDLYISKSDSITISVWNRKKIHKKQ-GAGFLGCVRLLSNLISRIKDTGYQRLDLCRLGQSSNDTVRGQIVLSLQSRDRIGTGGAVVDCRGLFPNDLPEGWEERRSTMGRTQYVNHVTRTAQWERPTRPAAECGGPGCVAPGQEGTPLRAGQGADGRATTAGEPSAAPAAPGSPELGTRSQRHRNF--------LSRTHLHQPPD-LPEGYEQRTTQQGQIYFLHTQTGVSTWHDPRVP--RDLSHVN-----------------------------CEDLGPLPAGWETRSTATGRVYFVDHNNRTTQFTDPRLSAN-LHHLLKNRQTQQGPCPPGLPPGPPPPPADEECPVPRYKRDLVQKLKCLRQELALQQSQ----------AGHCRLEVSRTEIFEESYRQVMKMRPRDLKKRLMVKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAINPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLADMETVDPELHKSLVWILNNS----DVNILHEHTVHSCWGGRVQFCFRTVNKGVPAMIRLAPRR--LYVSWRFLRGIEAQFLALQKGFNELIPQPLLKSFDEKELELIIGGLGKIDVSDWKSNTRLKHCTPESSVVRWFWRAVESFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHLIDAKTDNLPKAHTCFNRIDITRNPYETNNNIYDRV 742          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Sea Lamprey
Match: ube3a (ubiquitin protein ligase E3A [Source:ZFIN;Acc:ZDB-GENE-041114-190])

HSP 1 Score: 194.897 bits (494), Expect = 1.103e-51
Identity = 122/363 (33.61%), Postives = 200/363 (55.10%), Query Frame = 1
Query: 1300 HVKIIVRRNMLMEDSFNEIMRVK---PRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLK--FIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQ-VYDERQIELLLCGMQQIDVKDWEANSIYR-VYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKES-WLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFG 2364
            ++++ VRR+ +++D+   +  +    P DL+K+L+++F+ E G+D GG+S+E+F  +  EL NP   +F +  ++      NP+S  N      F  +G  + +A+++   +D  F +  Y+K++GKR T  D+       Y SLK     + ++++  M     + +++FG    Q+LK NG DI VT +NK E++DL   +  ++ V +Q KAF  GF+ +     L+ ++   ++ELL+CG + +D    E  + Y   + K S  I+ FW+ V     D+K   LQF TGT R PVGG        G  K  I K G +S  LP +HTCFN L LP Y+S E+LKE+L  A+   +GFG
Sbjct:  514 YLRLKVRRDHVIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEELFNPDIGMFTF-DESTRLFWFNPSSLENEGQ---FTLIGIVLGLAIYNNCILDIHFPMVVYRKLMGKRGTFHDLADSHPALYQSLKDLLAYEGSVEDDIMATFRISYFDMFGTPITQDLKENGEDIPVTNDNKKEFVDLYAEYILNQSVEKQFKAFRRGFHMVTSESPLKALFRPEEVELLVCGSRVLDFHALEDATEYDGGFNKSSRVIRDFWDTVHDFCEDKKRLFLQFTTGTDRAPVGGL-------GKLKMIIAKNGPDSDRLPTAHTCFNVLLLPEYSSREKLKERLLKAITHAKGFG 865          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005015.1 (pep scaffold:Pmarinus_7.0:GL486731:734:6293:1 gene:ENSPMAG00000004557.1 transcript:ENSPMAT00000005015.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.792 bits (447), Expect = 2.256e-51
Identity = 77/164 (46.95%), Postives = 117/164 (71.34%), Query Frame = 1
Query: 1873 IDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYR-VYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGF 2361
            + L++ WRF   V +Q  AFM+GF E++ +  ++++DE ++ELL+CG+  +DV +W  +++Y+  Y  + P ++WFW+ V  +  +++IRLLQFVTGT R+P+ GF EL GSNGPQ F +E  G    LPR+HTCFNRLDLPPY S+E+L+E+L  A+   +GF
Sbjct:    1 VSLVIQWRFVSRVQKQMNAFMEGFCELIPMDLIKIFDENELELLVCGLGDVDVNNWRQHTVYKNGYCANHPVVQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTVEMWGAPEKLPRAHTCFNRLDLPPYESFEELRERLNMAIENAQGF 164          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Yeast
Match: RSP5 (NEDD4 family E3 ubiquitin ligase; regulates processes including: MVB sorting, the heat shock response, transcription, endocytosis and ribosome stability; ubiquitinates Sec23p, Sna3p, Ste4p, Nfi1p, Rpo21p and Sem1p; autoubiquitinates; deubiquitinated by Ubp2p; regulated by SUMO ligase Siz1p, in turn regulates Siz1p SUMO ligase activity; required for efficient Golgi-to-ER trafficking in COPI mutants; mutant tolerates aneuploidy; human homolog implicated in Liddle syndrome [Source:SGD;Acc:S000000927])

HSP 1 Score: 502.671 bits (1293), Expect = 3.970e-165
Identity = 268/581 (46.13%), Postives = 358/581 (61.62%), Query Frame = 1
Query:  781 LPPGWERRLDTHNRVYYVDHNTRTTTWQRPDV--------SMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDP------------------LGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA--------------------NPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEET-QFLR--KQSQFYYYCQNA--VPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            LPPGWERR D   R YYVDHNTRTTTW+RP +        + LN     +R R  R   +    +         G    + P                  LG LP GWE+R     R YFV+H  +TT W DPR Q                      PLP GWE+R T     +FVDH TKTTT+ DPR      +   Q+ R  ++   Y+  Q A  +  G   I VRR  + ED++ EIMR  P DL+KRL I+F  E+GLDYGG+SRE+FF LSHE+ NP YCLFEY++ +NY++QINP S INPEHL YF+F+GR V + +FHR+F+D+ F    YK ML K++ LQD+E VD E YNSL ++ +N+ID   + L FSA+ E FG++   +LK +GR+IEVT+ NK EY++L   WR    V EQ KAFMDGFNE++    + V+DER++ELL+ G+ +ID++DW+ ++ YR Y +    I+WFW+ V +  N+++ RLLQF TGT R+PV GF++L GS+GP++F IEK G+   LP+SHTCFNR+DLP Y  Y+ +K+KLT AV ET GFGQE
Sbjct:  231 LPPGWERRTDNFGRTYYVDHNTRTTTWKRPTLDQTEAERGNQLNANTELER-RQHRGRTLPGGSSDNSSVTVQVGGGSNIPPVNGAAAAAFAATGGTTSGLGELPSGWEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKVIYFRSQPALRILPGQCHIKVRRKNIFEDAYQEIMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMFNPFYCLFEYSAYDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSIDGV-LDLTFSADDERFGEVVTVDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLPQYVDYDSMKQKLTLAVEETIGFGQE 809          

HSP 2 Score: 72.0182 bits (175), Expect = 2.793e-13
Identity = 40/101 (39.60%), Postives = 52/101 (51.49%), Query Frame = 1
Query:  685 LPQHYERRFDNFNRPYFVDHLTKTTSWEPPQ------------------------PLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDV--SMLNNIDHFQR 909
            LP  +E+RF    R YFVDH T+TT+W  P+                        PLP GWE RL    RVY+VDHNT+TTTW  P +  S+  N+  ++R
Sbjct:  333 LPSGWEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKR 433          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Yeast
Match: TOM1 (E3 ubiquitin ligase of the hect-domain class; has a role in mRNA export from the nucleus and may regulate transcriptional coactivators; involved in degradation of excess histones; interacts with Dia2p and is required for Dia2p degradation; required to target Cdc6p for ubiquitin-mediated destruction during G1 phase [Source:SGD;Acc:S000002865])

HSP 1 Score: 266.929 bits (681), Expect = 3.010e-74
Identity = 139/355 (39.15%), Postives = 214/355 (60.28%), Query Frame = 1
Query: 1309 IIVRRNMLMEDSFNEIMRVKPRDLQ-KRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEK-IGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMET-EGFG 2364
            I VRR  +  DS+  +      +++  +L I FK E G+D GG++REW+  LS ++ NP Y LF     +  +   N  S INPEHL +F+F+G  +  A+  + F+D  F+   YK +LG+ ++L+D+E++D +YY SL +I +N+I +  +   FS E + +G+ +   L   G+DI VTE NK +Y+  +V ++    V EQ   F+ GF  ++    + ++DE+++ELL+ G+  IDV DW+ N+ Y  YT    ++ +FW  V     +E+ +LLQFVTGT ++P+ GF+EL G NG  KF I +  G    LP SHTCFN+L+LPPY SYE L+  L  A+ E  EGFG
Sbjct: 2913 ITVRREQVFLDSYRALFFKTNDEIKNSKLEITFKGESGVDAGGVTREWYQVLSRQMFNPDYALFLPVPSDKTTFHPNRTSGINPEHLSFFKFIGMIIGKAIRDQCFLDCHFSREVYKNILGRPVSLKDMESLDPDYYKSLVWILENDITDI-IEETFSVETDDYGEHKVINLIEGGKDIIVTEANKQDYVKKVVEYKLQTSVKEQMDNFLVGFYALISKDLITIFDEQELELLISGLPDIDVDDWKNNTTYVNYTATCKEVSYFWRAVRSFDAEERAKLLQFVTGTSKVPLNGFKELSGVNGVCKFSIHRDFGSSERLPSSHTCFNQLNLPPYESYETLRGSLLLAINEGHEGFG 3266          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Yeast
Match: HUL4 (Protein with similarity to hect domain E3 ubiquitin-protein ligases; not essential for viability; found in association with Trf4 in TRAMP complex [Source:SGD;Acc:S000003797])

HSP 1 Score: 145.591 bits (366), Expect = 4.596e-36
Identity = 111/379 (29.29%), Postives = 190/379 (50.13%), Query Frame = 1
Query: 1300 HVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYS-LQINPASFINPE----HLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELF----------GKIEEQ----ELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEI-VHLHWLQVYDERQIELLLCG---MQQIDVKDWEANSIY-RVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFG 2364
            + KI VRR+++  DS    ++    DL K L I+F +E G+D GG+ +EWFF L+  L NPM  LF Y  +++ S   I+P +F   +     L+ +   G  + +A+F+   +D  F    YKK+  + ++ +D   +  E   S   I+  N  E +   VFS  +E             K  ++    EL  NGR++ +T+ NK+E++   V +   + +  Q   F+ GF  +    + +++++  ++E L+CG     + D K   + + Y   ++ DS  + WFWE +       + +LLQFVT + R+P  G      S  P K  +        LP +HTCFN + L  Y+S ++L+ KL +A+ E+EG+G
Sbjct:  520 YFKIKVRRDVISHDSL-RCIKEHQGDLLKSLRIEFVNEPGIDAGGLRKEWFFLLTKSLFNPMNGLFIYIKESSRSWFAIDPPNFDKSKGKNSQLELYYLFGVVMGLAIFNSTILDLQFPKALYKKLCSEPLSFEDYSELFPE--TSRNLIKMLNYTEDNFEDVFSLTFETTYRNNNWILNDSKSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIKLFNSEELERLVCGDEEQTKFDFKSLRSVTKYVGGFSDDSRAVCWFWEIIESWDYPLQKKLLQFVTASDRIPATGI-----STIPFKISLLGSHDSDDLPLAHTCFNEICLWNYSSKKKLELKLLWAINESEGYG 890          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Yeast
Match: HUL5 (Multiubiquitin chain assembly factor (E4); proteasome processivity factor that elongates polyUb chains on substrates, opposing Ubp6p, a branched polyubiquitin protease; required for retrograde transport of misfolded proteins during ERAD; required for ubiquitination of a subset of cytosolic misfolded proteins upon heat shock [Source:SGD;Acc:S000003109])

HSP 1 Score: 143.28 bits (360), Expect = 2.755e-35
Identity = 103/356 (28.93%), Postives = 179/356 (50.28%), Query Frame = 1
Query: 1312 IVRRNMLMEDSFNEIMRVKPR---DLQKRLFIQFKDEDGLDYGGISREWFFQLSHE-LLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKML----GKRITLQDIETVDVEYYNSLKFIRDNNIDEC-DMGLVFSA-EYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQ-QIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESW-LPRSHTCFNRLDLPPYASYEQLKEKLTYAV 2343
            I+ R+ ++ED+FN    +  R    L      +F +E G+D GGI++E+   +S E   +P + LF      N   ++ P+   +   L+Y  F+G+ V   ++    ID  F   F KK+L    G   +  D+ + D   YN+L  + +   DE   + L F   E E   K+   +L  NG    VT++N   Y+  + +++ ++   +   AF  G + I+  HW+++++  ++++L+ G +  ID+ D ++N+ Y  Y ++   I  FWE + +   +EK+  L+FVT   + P+ GF+ L       KF I   G E + LP + TC N L LP Y +   L+EKL YA+
Sbjct:  557 IISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGGITKEFLTTVSDEGFKDPKHELFR----TNDRYELYPSVVYDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPESSAKV--VDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVLNEFKFEEKLNFLKFVTSVPQAPLQGFKAL-----DPKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILREKLLYAI 901          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Yeast
Match: UFD4 (Ubiquitin-protein ligase (E3); interacts with Rpt4p and Rpt6p, two subunits of the 19S particle of the 26S proteasome; cytoplasmic E3 involved in the degradation of ubiquitin fusion proteins; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000001493])

HSP 1 Score: 95.1301 bits (235), Expect = 3.034e-20
Identity = 81/307 (26.38%), Postives = 142/307 (46.25%), Query Frame = 1
Query: 1531 INPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYK---KMLGKRIT---------LQDIETVDVEYYNSLKFI---RDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDV-----KDWEANSIY------RVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQ-----KFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEG 2358
            +NP S  N + ++ F ++G FVA ++   + +D  F+  F++   +M    +T         L  IE VD     SLK+I   +D+N+    + L F+         ++ EL   G +  +   N  EYI  +++    +G+ +Q KAF++GF+++     +         L+L   + +D+     +DW   ++Y        YT DS  I  F   +      E+   LQF+TG+ +LP+GGF+ L     P+     K   + +  + +LP   TC N L LP Y S + ++ +L  A+ E  G
Sbjct: 1191 LNPFSN-NEKVIELFGYLGTFVARSLLDNRILDFRFSKVFFELLHRMSTPNVTTVPSDVETCLLMIELVDPLLAKSLKYIVANKDDNMTLESLSLTFTVPGN-----DDIELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEGFSKVFSYERM---------LILFPDELVDIFGRVEEDWSMATLYTNLNAEHGYTMDSSIIHDFISIISAFGKHERRLFLQFLTGSPKLPIGGFKSL----NPKFTVVLKHAEDGLTADEYLPSVMTCANYLKLPKYTSKDIMRSRLCQAIEEGAG 1478          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Nematostella
Match: EDO49328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHD7])

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 298/544 (54.78%), Postives = 390/544 (71.69%), Query Frame = 1
Query:  679 DPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQAN-----PLPPGWEIRFTEDGMAFFVDHEXXXXX-------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFW-EFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHT 2271
            +PLP  +E+R D   R Y+VDH ++TT+WE PQPLP GWERR D+  R YYVDHNTRTTTWQRP    +   +++Q           Q   QR+   N     +   PLG LP GWEKR + N R YFVNH  +TT W+DPR Q       PLP GWE+R+T +G+ +FVDH T+TTT                 A E  F  K  QF + CQ      H+KI V R  L E+SF ++MR +P DL++RL+I FK E+GLDYGG++REWFF LSHE+LNPMYCLFEYA+ NNYSLQIN AS +NP+HL YF+F+GRF+AMA++H KFID GFT+PFYK+ML K++ ++D+ET+D E+YNSL ++++NNI+EC + + F+ + EL GK+   +LK  G DI V EENK EYI LM  WR +RG+ EQT+AF++G +E++ L+W+Q +DER++EL+LCGMQ+IDV+DW+ N++YR YT++S Q+ WFW + V    N+++IRLLQFVTGTCRLPVGGF ELMGSNGPQKFCIEK+GKE+WLPRSHT
Sbjct:  110 EPLPPGWEQRVDPHGRIYYVDHNSRTTAWERPQPLPHGWERRTDSRGRTYYVDHNTRTTTWQRPTAETIRTFENWQNQNRAMLGAERQQFQQRFLLPNQQDAERDNGPLGPLPAGWEKRVETNGRVYFVNHNTRTTQWEDPRTQTTASADKPLPQGWEMRYTNEGIPYFVDHNTRTTTFTDPRGNGAPGVKGAAPAFERSFRWKVGQFRHLCQANTLPSHIKITVSRTNLFEESFQQVMRYQPHDLRRRLYITFKGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYANKNNYSLQINAASSVNPDHLMYFKFIGRFIAMALYHGKFIDRGFTLPFYKRMLNKKLLMKDLETIDPEFYNSLVWVKENNIEECGLEMFFTVDMELLGKVTSHDLKPGGTDIAVIEENKEEYISLMTEWRLNRGIEEQTRAFLEGMHEVLPLYWIQYFDERELELMLCGMQEIDVEDWQQNTVYRHYTRNSKQVMWFWQQAVKAYDNEKRIRLLQFVTGTCRLPVGGFTELMGSNGPQKFCIEKVGKETWLPRSHT 653          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Nematostella
Match: EDO49327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHD5])

HSP 1 Score: 524.242 bits (1349), Expect = 1.698e-179
Identity = 231/363 (63.64%), Postives = 302/363 (83.20%), Query Frame = 1
Query: 1282 NAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            N +P  H+KI V R  L E+SF ++MR +P DL++RL+I FK E+GLDYGG++REWFF LSHE+LNPMYCLFEYA+ NNYSLQIN AS +NP+HL YF+F+GRF+AMA++H KFID GFT+PFYK+ML K++ ++D+ET+D E+YNSL ++++NNI+EC + + F+ + EL GK+   +LK  G DI VTEENK EYI LM  WR +RG+ EQT+AF++G +E++ L+W+Q +DER++EL+LCGMQ+IDV+DW+ N++YR YT++S Q+ WFW+ V    N+++IRLLQFVTGTCRLPVGGF ELMG NGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQL EKLT+A+ ETEGF QE
Sbjct:    3 NTLP-SHIKITVSRTNLFEESFQQVMRYQPHDLRRRLYITFKGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYANKNNYSLQINAASSVNPDHLMYFKFIGRFIAMALYHGKFIDRGFTLPFYKRMLNKKLLMKDLETIDPEFYNSLVWVKENNIEECGLEMFFTVDMELLGKVTSHDLKPGGTDIAVTEENKEEYISLMTEWRLNRGIEEQTRAFLEGMHEVLPLYWIQYFDERELELMLCGMQEIDVEDWQQNTVYRHYTRNSKQVMWFWQAVKAYDNEKRIRLLQFVTGTCRLPVGGFTELMGDNGPQKFCIEKVGKETWLPRSHTCFNRLDLPPYKSYEQLVEKLTFAIEETEGFAQE 364          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Nematostella
Match: EDO46071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR93])

HSP 1 Score: 420.624 bits (1080), Expect = 1.905e-131
Identity = 224/532 (42.11%), Postives = 316/532 (59.40%), Query Frame = 1
Query:  778 PLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQANPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMR--VKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPAS-FINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYR-VYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGF 2361
            PLPPGW  +   + R++++DHN+RTTTW  P ++ L+                      +        +      LG LP GWE+R  ++ R ++++H  ++T W+DPRLQ N          T   + +  D++                 +  + R + +      + VP  + +I +RR  LMEDS+  +    VKP  L+ RL+I F  E GLDYGG+ REWF+ LS E+ NP Y LFEY++ +NY+LQINP S   N EHL YF+F+GR   MA++H K +D+ F  PFYK MLG+ ITL D+E+VD EYYNSL +I +N  D  D+ L F  + ELFG +  ++LK NG    VT ENK EYI+L++ WRF   V +Q +AFM+GF +++  + +Q++DER++ELL+CG+ +ID  DW  NS YR  Y      I+WFW+ V     + + RLLQFVTGT R+P+ GF EL GSNGPQ+F IE  G    LPR+HTCFNRLDLP Y SY +L+E+L  A+  T+GF
Sbjct:  508 PLPPGWAVQRAPNGRLFFIDHNSRTTTWHDPRLTHLS----------------------QSPPSALPPSAPPAQDLGPLPDGWEERIHSDGRVFYIDHETRSTQWEDPRLQLNT---------TSQAVPYSRDYK----------------RKCDYFRSKLKR----PSNVPNKY-EIHIRRRNLMEDSYRAVQLSIVKPEILKSRLWIVFDGETGLDYGGLQREWFYLLSKEVFNPYYGLFEYSASDNYTLQINPNSGLCNEEHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFYKMMLGRPITLIDMESVDSEYYNSLNWILEN--DPEDLDLHFCVDEELFGILSVKDLKPNGSQTNVTNENKREYINLVIKWRFVSRVEDQMRAFMEGFCDLIPHNLIQIFDERELELLMCGLGEIDTVDWRKNSNYRGEYHDKHIVIQWFWKAVNSFDIETRARLLQFVTGTSRVPMNGFSELYGSNGPQRFTIEPWGTPHSLPRAHTCFNRLDLPRYRSYYELRERLRIAIENTQGF 985          

HSP 2 Score: 57.3806 bits (137), Expect = 2.592e-8
Identity = 29/91 (31.87%), Postives = 45/91 (49.45%), Query Frame = 1
Query:  679 DPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQ-----------------------PLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSM 882
            DPLP  +  +     R +F+DH ++TT+W  P+                       PLP GWE R+ +  RV+Y+DH TR+T W+ P + +
Sbjct:  507 DPLPPGWAVQRAPNGRLFFIDHNSRTTTWHDPRLTHLSQSPPSALPPSAPPAQDLGPLPDGWEERIHSDGRVFYIDHETRSTQWEDPRLQL 597          

HSP 3 Score: 53.5286 bits (127), Expect = 3.965e-7
Identity = 26/66 (39.39%), Postives = 36/66 (54.55%), Query Frame = 1
Query:  772 PQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQ 969
            P PLP GWE R D + R +Y+DH TRTTTW RP  S  +   H    ++    +M+  +  R  A+
Sbjct:  203 PPPLPEGWEERQDANGRTFYIDHTTRTTTWVRP--SRHDTDAHADTLQSRMQTHMQSRMQTRTQAR 266          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Nematostella
Match: EDO49383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG94])

HSP 1 Score: 319.316 bits (817), Expect = 6.571e-101
Identity = 152/340 (44.71%), Postives = 226/340 (66.47%), Query Frame = 1
Query: 1357 MRVKPRDLQK-RLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRV-YTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            M+   R LQ+ RL IQF  E+GLDYGG +RE+FF +S ++ NP Y LFEY++++ Y++Q++P S       ++FRF GR V + + H+  +D+ FT  FYK +L     L D+E +D  ++ S+ ++ +N+I++  + L FS   E+FG++ E+EL   G+DI VTE+NK +Y+  MV WR  RGV EQ ++ + GFNE++    + ++D R++EL++ G   ID+KDW  N+ YR  Y  +   +KWFW+ V    N++++RLLQFVTGT  +P  GF  L GS GP+KF IE+ G  + LPR+HTCFNRLD+P Y SY++L EKLTYAV ET  F  +
Sbjct:    1 MKETARSLQRNRLEIQFAGEEGLDYGGPAREFFFLISRQIFNPYYGLFEYSANDTYTVQVSPVSLYVDNSHEWFRFCGRIVGLVIIHQHLLDAFFTRTFYKALLRSLCDLSDVEALDALFHQSMTWVIENDIEDV-LDLTFSVSEEIFGQVTERELIPGGKDIAVTEQNKGDYVAEMVKWRVERGVSEQMESIVRGFNEVIDPALVNIFDARELELVISGTADIDIKDWRRNTEYRSGYHDNHKVVKWFWKAVSSFDNEQRLRLLQFVTGTSSIPYEGFAALRGSTGPRKFSIERWGDYTKLPRAHTCFNRLDMPIYRSYDELLEKLTYAVEETGSFAMQ 339          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Nematostella
Match: EDO40462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S732])

HSP 1 Score: 209.149 bits (531), Expect = 1.973e-56
Identity = 131/381 (34.38%), Postives = 211/381 (55.38%), Query Frame = 1
Query: 1249 RKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVK---PRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLK--FIRDNNIDECDMGLVFSAEY-ELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQV-YDERQIELLLCGMQQIDVKDWEANSIYR-VYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKES-WLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFG 2364
            R+ +  Y   +   P  ++++ VRR+ L+ED+   +  V    P DL+K+LF++F+ E G+D GG+S+E+F  +  ++ NP Y +F Y  +       NP SF   E    F  +G  + +A+++   +D  F +  Y+K+ GK  T++D++      Y SL      + N++E D+   F   Y ++FG     ELK NG  I VT+EN+ EY++L  ++  ++ V +Q  AF  GF+ +V    L++ +   ++E+L+CG +  D    E  + Y    TKDS  I+WFWE V     ++K +LL F TG+ R+PVGG  +L       K  I K G +S  LP +HTCFN L LP YA+ E+L+E+L  A+   +GFG
Sbjct:  427 RRLTLLYSLVRRQQPTPYLRLKVRRDHLIEDALVSLEMVAQDNPLDLKKQLFVEFEGEQGIDEGGVSKEFFQLIVEQIFNPDYGMFTY-DEATRICWFNPTSF---ESDAQFCLIGLVLGLAIYNNIILDIHFPMVVYRKLFGKPGTVEDLKDSHPVLYMSLTELLTYEGNVEE-DLMCTFKIGYTDVFGSDLTHELKANGESIPVTKENRQEYVNLHADFILNKSVEKQFTAFKRGFDMVVDESPLKIFFRPDEVEMLVCGSKDFDFDALEKATEYDGGLTKDSALIRWFWEIVHSFDMEQKRQLLMFTTGSDRIPVGGLAKL-------KLIIAKNGPDSPRLPTAHTCFNVLLLPDYATKEKLEERLLKAITHAKGFG 795          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Medaka
Match: wwp1 (WW domain containing E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101169496])

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 345/580 (59.48%), Postives = 441/580 (76.03%), Query Frame = 1
Query:  673 STDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY---GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXX-------XXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            S+DPLP  +E+R D   R Y+VDH T+TT+WE PQPLPPGWERR+D   R+YYVDHNTRTTTWQRP +  + N + +Q  R++    M Q  NQRY    +   A N    DPLG LP GWE+R D+N+R YFVNH  KTT W+DPR Q     +PLP GWEIR+T +G+ +FVDH T+TTT        +     P+ A E  F  K + F Y CQ+     HVKI V R  L EDSF +IM +KP DL++RL++ F+ E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL YF F+GRF+AMA+FH KFID+GF++PFYK+ML K++ L+D+E++D E+YNSL +IRDNNI+EC + + FS + E+ GKI   +LK +G +I+VTEENK EYI  M  WRFSRGV  QTKAF+DGFNE+V L WLQ +DE+++E++LCGMQ++D++DW+ N++YR YT++S QI WFW+ V ++ N+ ++RL+QFVTGTCRLP+GGF ELMGSNGPQKFCIEK+GK++WLPRSHTCFNRLDLPPY SYEQLKEKL +A+ ETEGFGQE
Sbjct:  386 SSDPLPPGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDERGRIYYVDHNTRTTTWQRPTMESVRNFEQWQSQRSQLQGAMHQ-FNQRYLYSASMMTAEN----DPLGPLPPGWERRVDSNDRVYFVNHNTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVRYFVDHNTRTTTFSDPRTGKSSVTKGPQIAYERSFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQINPASAINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLNKKLILKDLESIDPEFYNSLIWIRDNNIEECGLEMFFSVDMEILGKITSHDLKPDGANIQVTEENKEEYISQMAEWRFSRGVEGQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLQDWQRNTVYRHYTRNSKQIIWFWQLVKEVDNEVRLRLMQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE 960          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Medaka
Match: wwp2 (WW domain containing E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101168206])

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 347/615 (56.42%), Postives = 444/615 (72.20%), Query Frame = 1
Query:  568 PRANATGNLRGSNNSLPVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXXXX---------XXXXXXXXAEETQFLRKQSQFYYYCQ-NAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            P  NAT N   S  S                 A+ +TD LP  +E+R     R Y+VDH TKTT+WE  +PLP GWE+R+D   R YYVDHNTRTTTWQRP    + N   +Q  R++    M Q  +QR+  Q     ++  DPLGALP GWEKR D N R YFVNH  +TT WDDPR Q     +PLPPGWE+++T +G+ +FVDH ++TTTF            +     A +  F  K  QF + C  NA+P  HVKI V R  L EDSF +IM VKP DL++RL+I  + E+GLDYGGI+REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YFRF+GRF+AMA++H KFID+GFT+PFYK+ML K+ TL+D+E++D E+YNS+ ++++NN+ EC + L F+ + E+ GK+   +LK +G +  VTEENK EYI L+ +WRF+RGV EQTKAF+DGFNE+V L WL+ +DE+++EL+LCGMQ+ID+ DW+ N+IYR YTK+S QI WFW+ V ++ N+++IRLLQFVTGTCRLPVGGF+EL+GSNGPQKFCI+K+GKE+WLPRSHTCFNRLDLPPY S EQL+EKL +A+ ETEGFGQE
Sbjct:  293 PSPNATSNTEQSGTS----------------TAEPNTDSLPTGWEQRVLPHGRVYYVDHNTKTTTWE--RPLPAGWEKRVDQRGRFYYVDHNTRTTTWQRPTAESVRNYQQWQSQRSQLQGAMHQ-FSQRFLYQPSGAPVEN-DPLGALPPGWEKRQD-NGRVYFVNHNTRTTQWDDPRTQGMIKEHPLPPGWEMKYTAEGVRYFVDHNSRTTTFKDPRPGFEPGSRQGGSPGAYDRSFRWKYHQFRFLCHSNALPS-HVKISVSRQTLFEDSFQQIMNVKPYDLRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLDKKPTLKDLESIDPEFYNSIMWVKENNLAECGVELYFAQDMEILGKVSTHQLKDDGENELVTEENKEEYISLLTDWRFTRGVEEQTKAFLDGFNEVVPLEWLRYFDEKELELMLCGMQEIDLADWQKNTIYRHYTKNSKQIHWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFQELIGSNGPQKFCIDKVGKETWLPRSHTCFNRLDLPPYKSLEQLREKLLFAIEETEGFGQE 885          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Medaka
Match: wwp2 (WW domain containing E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101168206])

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 347/615 (56.42%), Postives = 444/615 (72.20%), Query Frame = 1
Query:  568 PRANATGNLRGSNNSLPVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXXXX---------XXXXXXXXAEETQFLRKQSQFYYYCQ-NAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            P  NAT N   S  S                 A+ +TD LP  +E+R     R Y+VDH TKTT+WE  +PLP GWE+R+D   R YYVDHNTRTTTWQRP    + N   +Q  R++    M Q  +QR+  Q     ++  DPLGALP GWEKR D N R YFVNH  +TT WDDPR Q     +PLPPGWE+++T +G+ +FVDH ++TTTF            +     A +  F  K  QF + C  NA+P  HVKI V R  L EDSF +IM VKP DL++RL+I  + E+GLDYGGI+REWFF LSHE+LNPMYCLFEYA  NNY LQINPAS INP+HL YFRF+GRF+AMA++H KFID+GFT+PFYK+ML K+ TL+D+E++D E+YNS+ ++++NN+ EC + L F+ + E+ GK+   +LK +G +  VTEENK EYI L+ +WRF+RGV EQTKAF+DGFNE+V L WL+ +DE+++EL+LCGMQ+ID+ DW+ N+IYR YTK+S QI WFW+ V ++ N+++IRLLQFVTGTCRLPVGGF+EL+GSNGPQKFCI+K+GKE+WLPRSHTCFNRLDLPPY S EQL+EKL +A+ ETEGFGQE
Sbjct:  293 PSPNATSNTEQSGTS----------------TAEPNTDSLPTGWEQRVLPHGRVYYVDHNTKTTTWE--RPLPAGWEKRVDQRGRFYYVDHNTRTTTWQRPTAESVRNYQQWQSQRSQLQGAMHQ-FSQRFLYQPSGAPVEN-DPLGALPPGWEKRQD-NGRVYFVNHNTRTTQWDDPRTQGMIKEHPLPPGWEMKYTAEGVRYFVDHNSRTTTFKDPRPGFEPGSRQGGSPGAYDRSFRWKYHQFRFLCHSNALPS-HVKISVSRQTLFEDSFQQIMNVKPYDLRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLDKKPTLKDLESIDPEFYNSIMWVKENNLAECGVELYFAQDMEILGKVSTHQLKDDGENELVTEENKEEYISLLTDWRFTRGVEEQTKAFLDGFNEVVPLEWLRYFDEKELELMLCGMQEIDLADWQKNTIYRHYTKNSKQIHWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFQELIGSNGPQKFCIDKVGKETWLPRSHTCFNRLDLPPYKSLEQLREKLLFAIEETEGFGQE 885          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Medaka
Match: itcha (E3 ubiquitin-protein ligase Itchy [Source:NCBI gene;Acc:101167949])

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 370/803 (46.08%), Postives = 507/803 (63.14%), Query Frame = 1
Query:  160 VQSAFTLNILIKKFKVKVKNLGSHAELYVEYSVDDAPAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTL-GKADVDLYKILCRFLGNLNNQELVVPISSTNSHTHIGDLTVVLKIASTIN-----------------------------IPEEDRPRANATGN----LRGSNNSLPVSDSSPALNRAVLPAADLSTDPLPQH----------------YERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQR--YGAQNWAGNI--QRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEET--------QFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            +++   + IL  K K   KN    +  YVE +VD    +     +T +P W +   ++V   S + F + ++   +   L G A +++ +IL       NN +L   + S    T    L VV +++  ++                             +   +   AN T +    L GS  SLP   + P  +     AA    + +                   +E+R D   R Y+VDH+ K T+W+ P+PLP GWERR+D   RVYYVDH TRTTTWQRP    + N + +Q  R++    M Q  NQR  YG Q+    I  +  DPLG LP GWEKRTD N R YFV+H  +TT W+DPR Q      PLP GWE+RFT DG+ ++VDH  +TTT+ DPRT   ++ E          F  K   F ++CQ      H+KI V R  L EDSF +IM   P+DL++RL+I F  E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS+INP+HL+YF+F+GRF+AMA+FH KFID+GF++PFYK++L K +TL+D+E++D E+YNSL +I+DNNI+EC + + FS + E+ G++   ELK +G +I+VTE+NK EYI L+  WR SRGV EQT+AF +GFNE++   +LQ +D +++E++LCGMQ+ID+ DW+ N+IYR Y ++S QI WFW+FV ++ N++++RLLQFV GTCRLP+GGF +LMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY +YEQLKEKL +A+ ETEGFGQE
Sbjct:    1 MKAQLQVTILSAKLKENKKNWFGPSP-YVEVTVDGQSKRTEKCNNTHSPKWKQSLTVIVSPVSELIFRVWSHQTLKADILLGMASLEICQIL-----KTNNFKLCEVVQSLQLSTGRNSLDVVGELSVCLDGMQVHPEALAQAESESSMDSSPSSDSDDWVIVSNDHTANGTDSPSPTLGGSATSLPSRPARPPASMPHRSAASACNNSMKTFVYIFIKSSTAYLRQVIWEQRVDQNGRVYYVDHIEKRTTWDRPEPLPTGWERRVDPMGRVYYVDHITRTTTWQRPTQESVRNYEEWQHQRSQLQGAM-QHFNQRFIYGLQDQLAAIASKEFDPLGPLPHGWEKRTDTNGRVYFVHHPTRTTQWEDPRRQGLLNDKPLPEGWEMRFTVDGIPYYVDHNRRTTTYIDPRTGKSSSLENGPQITYVRDFKAKVQYFRFWCQQLSMPQHIKITVSRKTLFEDSFQQIMSFHPQDLRRRLWIIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFKFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPLTLKDLESIDPEFYNSLIWIKDNNIEECGLEMFFSVDKEILGEVTTHELKPDGGNIQVTEDNKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQYFDAKELEVMLCGMQEIDLADWQRNTIYRHYARNSKQIIWFWQFVKEMDNEKRMRLLQFVAGTCRLPMGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKTYEQLKEKLMFAIEETEGFGQE 796          
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Medaka
Match: itchb (E3 ubiquitin-protein ligase Itchy [Source:NCBI gene;Acc:101174746])

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 339/609 (55.67%), Postives = 442/609 (72.58%), Query Frame = 1
Query:  595 RGSNNSLPVSDSSPALNRAVLP--AADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQR--YGAQNWAGNIQ--RVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEET-------QFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            RGS  +      +P      LP     +ST PLP  +E+R D   R Y+VDH+ K T+W+ P+PLPPGWERR+D   RVY+VDH +RTTTWQRP +  + N + +Q  R++    M+Q  NQR  YG Q+ A   Q    DPLG LP GWEKRTDAN R YF++H  ++T W+DPR Q      PLP GWE+RFT DG+ +FVDH  ++TT+ DPRT   + E          F  K   F ++CQ      H+KI V R  L EDSF +IM +   DL++RL+I F  E+GLDYGG++REWFF LSHE+LNPMYCLFEYA  +NY LQINPAS INP+HL+YFRF+GRF+AMA+FH KFI++GF++PFYK++L K + ++D+E++D E+YNSL +I+DNNI+EC + + FS + E+ G+I   ELK  G DI+VTEENK EYI L+  WR SRGV EQT+AF +GFNE++   +LQ +D +++E++LCGMQ ID+ DW+ N+IYR Y ++S QI WFW+ V ++ N++++RLLQFVTGTCRLPVGGF +LMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY SYEQLKEK+ +A+ ETEGFGQE
Sbjct:  272 RGSTAA--AGRQAPGAVTPSLPPRVPAVSTAPLPPGWEQRVDQNGRLYYVDHVEKRTTWDRPEPLPPGWERRVDQMGRVYFVDHISRTTTWQRPTMETVRNYEQWQHQRSQLQGAMQQ-FNQRFIYGVQDPAAAAQNKEFDPLGPLPAGWEKRTDANGRVYFLHHPTRSTQWEDPRTQGLLNEKPLPEGWEMRFTVDGIPYFVDHNRRSTTYIDPRTGKSSLENGPQITYVRDFKAKIQYFRFWCQQLALPQHIKINVTRKNLFEDSFQQIMSINAPDLRRRLWIIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASSINPDHLKYFRFIGRFIAMALFHGKFINTGFSLPFYKRILNKPLAVKDLESIDPEFYNSLMWIKDNNIEECCLEMFFSVDKEILGEITTHELKPGGGDIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQYFDAKELEVMLCGMQDIDLADWQRNTIYRHYARNSKQILWFWQLVKEMDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKVMFAIEETEGFGQE 877          
BLAST of E3 ubiquitin-protein ligase vs. Planmine SMEST
Match: SMESG000008708.1 (SMESG000008708.1)

HSP 1 Score: 1518.06 bits (3929), Expect = 0.000e+0
Identity = 742/745 (99.60%), Postives = 743/745 (99.73%), Query Frame = 1
Query:  136 MIENATNNVQSAFTLNILIKKFKVKVKNLGSHAELYVEYSVDDAPAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTLGKADVDLYKILCRFLGNLNNQELVVPISSTNSHTHIGDLTVVLKIASTINIPEEDRPRANATGNLRGSNNSLPVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQANPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            MIENATNNVQSAFTLNILIKKFKVKVKNLGSHAELYVEYSVDDAPAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTLGKADVDLYKILCRF GNLNNQELVVPISSTNSHTHIGDLTVVLKIASTINIPEEDRPRANATGNLRGSNNSLPVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQANPLPPGWEIRFTEDGMAFFVDHETKTTTFTDPRTTPRTAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKP+DLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIV LHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE
Sbjct:    1 MIENATNNVQSAFTLNILIKKFKVKVKNLGSHAELYVEYSVDDAPAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTLGKADVDLYKILCRFHGNLNNQELVVPISSTNSHTHIGDLTVVLKIASTINIPEEDRPRANATGNLRGSNNSLPVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQANPLPPGWEIRFTEDGMAFFVDHETKTTTFTDPRTTPRTAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPKDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVPLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 745          
BLAST of E3 ubiquitin-protein ligase vs. Planmine SMEST
Match: SMESG000039114.1 (SMESG000039114.1)

HSP 1 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 371/657 (56.47%), Postives = 474/657 (72.15%), Query Frame = 1
Query:  466 LVVPISSTNSHTH-----IGDLTVVLKIASTINIPEEDRPRANATGNLRGSNN-SLPVSDSSPA----------LNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNW-----AGNIQR-VDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQANPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            L++   ++NS  H     I D+T+  +   TI    +     N+   +   NN S  + +S P            +   LP   ++ +PLPQ YE R    NR Y++D LTKT+SWE PQP+P GWERRLD H RVYYVDHNTR+TTWQRP+ +ML N+  +Q WR+ERNN M++   + YG  N      A N Q   D L  LP GWE+R DANNR Y+VNH N+TT W+DPR Q  PLP GWEIR+  DG  FF+DH TK +T+ DPR   +   E     K + F + CQ+   +GH+KI V R  L+ DSFN+IM+++P  L+KRL+I FK E+GLDYGG++REWFF+LS ELLNPM CLFEYA DNNYSL+INPASF+NPEHLQYFRFVGRF+AMA+FH KFIDSGFT+ FYK+ML K+  L+DIE VD  YYNSLKFI++ +++ECD+ L FSA++E+ GK+E QELK  G  I VTE+NK EYIDLMVNWRF+RG+  Q ++F+ GFNE++ L+WL  +DE++IELLLCGMQ I+V DWE +++YR YT++S QI  FW++V  L N+ ++RLLQFVTGTCRLP+GGF+ LMGSNGPQKFCIEK+GKE+WLPRSHTCFNRLDLPPY S++QL EKL YA+ ETEGF  +
Sbjct:   84 LIIGQGTSNSEFHDVETAISDVTISER--DTIETLSKASRTVNSDTAISIENNFSKLIQNSQPPPESELCNVSECSSTALPINSVNDEPLPQFYEMRRTKDNRIYYIDRLTKTSSWEKPQPIPSGWERRLDGHGRVYYVDHNTRSTTWQRPNANMLTNVSLWQEWRSERNNNMQEAFARLYGTDNALLPRVATNFQTDSDQLEPLPIGWERRVDANNRVYYVNHENRTTQWEDPRYQGPPLPDGWEIRYNVDGKPFFIDHNTKISTYLDPRKFMKVDNEWDLSAKIATFRFLCQSNGVDGHIKINVSRKDLLTDSFNQIMQIQPTHLRKRLYITFKGEEGLDYGGVAREWFFRLSQELLNPMICLFEYACDNNYSLKINPASFVNPEHLQYFRFVGRFIAMALFHGKFIDSGFTLSFYKRMLNKKPILEDIEAVDYLYYNSLKFIKEMDLNECDLELYFSADFEILGKLETQELKPGGHSILVTEDNKEEYIDLMVNWRFNRGIENQAESFIKGFNEVLPLNWLYYFDEKEIELLLCGMQDINVDDWEKHTVYRHYTQNSKQIIHFWKYVRNLTNEMRVRLLQFVTGTCRLPIGGFKNLMGSNGPQKFCIEKVGKETWLPRSHTCFNRLDLPPYKSFQQLSEKLNYAIKETEGFSMD 738          
BLAST of E3 ubiquitin-protein ligase vs. Planmine SMEST
Match: SMESG000038772.1 (SMESG000038772.1)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 277/547 (50.64%), Postives = 381/547 (69.65%), Query Frame = 1
Query:  781 LPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSMLNNIDHFQRWRTER--NNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKRTDA-NNRTYFVNHVNKTTHWDDPRLQA----NPLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAE----------ETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE 2370
            LP GWE R   + ++Y+ +      +W +P  SM+N++    R RTE   + + +   +  YG  +   N    +    LPQGWEKR D  NNR Y+VNH+ K T W+DPRL        LPP WE+R+T  G+ +FVDHE++T T  DPRT  ++            E  F  +   F   C++ +P G VKI  +R+ L++ SFN+I+ +   +L++RL IQF  E+GLDYGG+++EWF +LSHE+LNPMYCLFEYA+  NYSL+INP SF+NP HL YF+F+GRF+ MA FH + ID+GFTIPFYK++L K +TLQDIE++D+E+Y SL FI++N I++CD+ L FSA YE+ G+++  EL   G +++VT+ENK EYI LM+ W  ++GV +Q K F++G  E+V L  LQ +DER++ELLLCG+Q+IDV DWE +++YR Y+  + Q+ WFW+FV  L ++++ RLLQFVTGTCRLP+GGF EL G NG Q FC+E++G E+WLPRSHTCFNRLDLPPY +YEQ  EKLT A  ETEGFGQE
Sbjct:  162 LPEGWEMRNGENGQMYFYNEELNKRSWMKPSKSMINSVRQL-RVRTENRLSQHNKGLFSDIYGIFSKDNNSLIRNDTDGLPQGWEKRIDPRNNRVYYVNHITKMTQWEDPRLDGMNLNKKLPPNWEMRYTAKGIRYFVDHESQTVTLVDPRTGKQSGPVGSFGVPVLLERSFRYRLEAFQDECKSMMPTGTVKINFKRDDLLDSSFNQIINLSTTELKQRLSIQFLGEEGLDYGGVAKEWFLRLSHEILNPMYCLFEYANTYNYSLKINPGSFVNPNHLSYFKFIGRFIGMAFFHGRCIDNGFTIPFYKQILNKPLTLQDIESIDLEFYQSLLFIKENPINDCDLELYFSASYEVLGEVKLHELIPGGNEVKVTDENKKEYIQLMIPWWLTKGVEKQMKNFLEGLYELVPLSLLQRFDERELELLLCGLQKIDVDDWERHTVYRQYSPSNIQVIWFWKFVRSLDHEQQARLLQFVTGTCRLPLGGFSELQGGNGRQLFCLERVGDETWLPRSHTCFNRLDLPPYKTYEQFIEKLTLAFEETEGFGQE 707          

HSP 2 Score: 61.2326 bits (147), Expect = 3.506e-9
Identity = 32/74 (43.24%), Postives = 41/74 (55.41%), Query Frame = 1
Query:  676 TDPLPQHYERRFD-NFNRPYFVDHLTKTTSWEPP--------QPLPPGWERRLDTHNRVYYVDHNTRTTTWQRP 870
            TD LPQ +E+R D   NR Y+V+H+TK T WE P        + LPP WE R       Y+VDH ++T T   P
Sbjct:  237 TDGLPQGWEKRIDPRNNRVYYVNHITKMTQWEDPRLDGMNLNKKLPPNWEMRYTAKGIRYFVDHESQTVTLVDP 310          
BLAST of E3 ubiquitin-protein ligase vs. Planmine SMEST
Match: SMESG000013095.1 (SMESG000013095.1)

HSP 1 Score: 416.001 bits (1068), Expect = 9.190e-131
Identity = 245/621 (39.45%), Postives = 343/621 (55.23%), Query Frame = 1
Query:  685 LPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHN----TRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY----------------------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQAN----------------------------PLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEETQFLRKQSQFYYYCQNAV-----PEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQK-RLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFI-NPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRV-YTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGF 2361
            LP+ +E R D   R Y+VDH  + T WE   P      ++++   ++     N     R  +  RP  S  +++D    +   R    E T+  R                         +N    +  +     LP GW+     N R +F+NH +KTT W+DPR   N                            PLP GWE R   DG  FFV+H TKTT + DPR    +     + R   Q Y Y ++ +     P    ++ + R  + EDS+  I  VK  ++ K +L+I+F  E GLDYGG+ REWFF LS E+ NP Y LFEY++ +NY+LQINP S + N  HL+YF+F+GR   MA++H + +D  F  P YK MLGK+I+L+D+E+VD EYY SLKFI +N  D   + L FS + E FG+  E +L  +GR   VT+ENK +YI+ ++NWRF + V  Q  AF++GF ++V L+ LQ++D  ++ELLLCG+Q I+V DW+ N+ Y+  Y  + P I  FW+ V    N+ + RLLQFVTGT R+P+ GF EL GS GPQKF IEK G    LPR+HTCFNRLDLPPY ++E+L+ KL  A+   EGF
Sbjct:  244 LPEGWEERADLSGRVYYVDHANQKTQWE--HPASKSAPQKVNKLAKINMPAANNPLSVRAVSPTRPGPS--SDVDAATMFLRRRQISHEDTVASRIRPVATESLPTVEQTTEPPPITASVENITKELASITVDEELPPGWQMAMTTNGRRFFINHNDKTTTWEDPRAIRNRSKSTSGTPAPTAINRTSSRDDLLVDLGPLPAGWEEREHTDGRIFFVNHNTKTTQWEDPRLNKFSGPAVPYSRNYKQKYDYFRSKLRAPREPNAKFEMRINRKNIFEDSYRLIYNVKKTEMLKYKLWIEFIGEKGLDYGGVQREWFFLLSREMFNPYYGLFEYSAADNYTLQINPLSGVANENHLRYFKFIGRVAGMAVYHGRLLDGFFIRPLYKMMLGKKISLKDMESVDTEYYRSLKFILEN--DPAVLDLTFSVDEEHFGQKVEVDLIPDGRSKAVTQENKRQYIECIINWRFVKRVESQMTAFLEGFQDVVTLNTLQIFDANELELLLCGLQDINVTDWKGNTNYKGEYNPNHPVIVNFWKTVYTFNNELRSRLLQFVTGTSRVPMNGFVELWGSTGPQKFTIEKWGTPDQLPRAHTCFNRLDLPPYVTFEELRRKLLIAIENAEGF 858          

HSP 2 Score: 67.3958 bits (163), Expect = 4.340e-11
Identity = 65/217 (29.95%), Postives = 98/217 (45.16%), Query Frame = 1
Query:  253 SVDDAPAKKTTTKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKT----LGKADVDLYKI-LC--RFLGNLNNQELVVPISSTNSHTHIGDLTVVLKIASTINIPEEDRPRANATGNLRGSNNSLP--VSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYFVDHLTKTTSWEPP--QPLPPGWERRLDTHNRVYYVDHNTRTTTWQRP 870
            +V  +  +  T K T NP W+EE   L     +   ++I  Y   + T    LG   + L ++ +C      +L  +   +   S+ S+   G+L + L       +P +  P A+ T       NS+P  V+DS   ++      A++    L   +E R D   R Y+VDH +K T WE P    LP GWE R D   RVYYVDH  + T W+ P
Sbjct:   70 TVVGSSVQTRTMKKTLNPRWNEE--FLFRVNVNENRLVIEMYDENRLTRDDFLGVISIHLPQLEICTESVTSHLAPKSFKLRPRSSRSNVK-GNLILYLAY-----LPIDIDP-ASWTPGPTDEGNSIPGTVADSEITIHTEENSTAEV----LANGWEERVDQNGRIYYVDHKSKRTQWEKPTNAQLPEGWEERADLSGRVYYVDHANQKTQWEHP 273          

HSP 3 Score: 54.299 bits (129), Expect = 4.294e-7
Identity = 25/57 (43.86%), Postives = 32/57 (56.14%), Query Frame = 1
Query: 1009 ALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQANPLPPGWEIRFTEDGMAFFVDH 1179
             L  GWE+R D N R Y+V+H +K T W+ P      LP GWE R    G  ++VDH
Sbjct:  209 VLANGWEERVDQNGRIYYVDHKSKRTQWEKP--TNAQLPEGWEERADLSGRVYYVDH 263          
BLAST of E3 ubiquitin-protein ligase vs. Planmine SMEST
Match: SMESG000013095.1 (SMESG000013095.1)

HSP 1 Score: 416.387 bits (1069), Expect = 1.994e-130
Identity = 245/621 (39.45%), Postives = 343/621 (55.23%), Query Frame = 1
Query:  685 LPQHYERRFDNFNRPYFVDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHN----TRTTTWQRPDVSMLNNIDHFQRWRTERNNYMEQTLNQRY----------------------GAQNWAGNIQRVDPLGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQAN----------------------------PLPPGWEIRFTEDGMAFFVDHEXXXXXXXXXXXXXXXAEETQFLRKQSQFYYYCQNAV-----PEGHVKIIVRRNMLMEDSFNEIMRVKPRDLQK-RLFIQFKDEDGLDYGGISREWFFQLSHELLNPMYCLFEYASDNNYSLQINPASFI-NPEHLQYFRFVGRFVAMAMFHRKFIDSGFTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAEYELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFMDGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRV-YTKDSPQIKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEKIGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGF 2361
            LP+ +E R D   R Y+VDH  + T WE   P      ++++   ++     N     R  +  RP  S  +++D    +   R    E T+  R                         +N    +  +     LP GW+     N R +F+NH +KTT W+DPR   N                            PLP GWE R   DG  FFV+H TKTT + DPR    +     + R   Q Y Y ++ +     P    ++ + R  + EDS+  I  VK  ++ K +L+I+F  E GLDYGG+ REWFF LS E+ NP Y LFEY++ +NY+LQINP S + N  HL+YF+F+GR   MA++H + +D  F  P YK MLGK+I+L+D+E+VD EYY SLKFI +N  D   + L FS + E FG+  E +L  +GR   VT+ENK +YI+ ++NWRF + V  Q  AF++GF ++V L+ LQ++D  ++ELLLCG+Q I+V DW+ N+ Y+  Y  + P I  FW+ V    N+ + RLLQFVTGT R+P+ GF EL GS GPQKF IEK G    LPR+HTCFNRLDLPPY ++E+L+ KL  A+   EGF
Sbjct:  284 LPEGWEERADLSGRVYYVDHANQKTQWE--HPASKSAPQKVNKLAKINMPAANNPLSVRAVSPTRPGPS--SDVDAATMFLRRRQISHEDTVASRIRPVATESLPTVEQTTEPPPITASVENITKELASITVDEELPPGWQMAMTTNGRRFFINHNDKTTTWEDPRAIRNRSKSTSGTPAPTAINRTSSRDDLLVDLGPLPAGWEEREHTDGRIFFVNHNTKTTQWEDPRLNKFSGPAVPYSRNYKQKYDYFRSKLRAPREPNAKFEMRINRKNIFEDSYRLIYNVKKTEMLKYKLWIEFIGEKGLDYGGVQREWFFLLSREMFNPYYGLFEYSAADNYTLQINPLSGVANENHLRYFKFIGRVAGMAVYHGRLLDGFFIRPLYKMMLGKKISLKDMESVDTEYYRSLKFILEN--DPAVLDLTFSVDEEHFGQKVEVDLIPDGRSKAVTQENKRQYIECIINWRFVKRVESQMTAFLEGFQDVVTLNTLQIFDANELELLLCGLQDINVTDWKGNTNYKGEYNPNHPVIVNFWKTVYTFNNELRSRLLQFVTGTSRVPMNGFVELWGSTGPQKFTIEKWGTPDQLPRAHTCFNRLDLPPYVTFEELRRKLLIAIENAEGF 898          

HSP 2 Score: 70.8626 bits (172), Expect = 4.006e-12
Identity = 41/124 (33.06%), Postives = 62/124 (50.00%), Query Frame = 1
Query:  781 LPPGWERRLDTHNRVYYVDHNTRTTTWQRP----------DVSMLNNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDP-LGALPQGWEKRTDANNRTYFVNHVNKTTHWDDPRLQANP 1119
            L  GWE R+D + R+YYVDH ++ T W++P          + S+L+NID               TL      +N       V P +  LP+GWE+R D + R Y+V+H N+ T W+ P  ++ P
Sbjct:  210 LANGWEERVDQNGRIYYVDHKSKRTQWEKPTNFRVSKRPSNGSVLSNIDF--------------TLLMSNPIRNQPLYDNEVCPNIAQLPEGWEERADLSGRVYYVDHANQKTQWEHPASKSAP 319          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WWP10.000e+058.91WW domain containing E3 ubiquitin protein ligase 1... [more]
WWP10.000e+058.91WW domain containing E3 ubiquitin protein ligase 1... [more]
WWP20.000e+058.46WW domain containing E3 ubiquitin protein ligase 2... [more]
ITCH0.000e+054.85itchy E3 ubiquitin protein ligase [Source:HGNC Sym... [more]
ITCH0.000e+054.85itchy E3 ubiquitin protein ligase [Source:HGNC Sym... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wwp-10.000e+051.48E3 ubiquitin-protein ligase [Source:UniProtKB/TrE... [more]
wwp-10.000e+051.34E3 ubiquitin-protein ligase [Source:UniProtKB/TrE... [more]
wwp-13.506e-1160.04E3 ubiquitin-protein ligase [Source:UniProtKB/TrE... [more]
wwp-13.506e-1160.04E3 ubiquitin-protein ligase [Source:UniProtKB/TrE... [more]
wwp-16.350e-1159.80E3 ubiquitin-protein ligase [Source:UniProtKB/TrE... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Su(dx)0.000e+057.07gene:FBgn0003557 transcript:FBtr0077823[more]
Su(dx)0.000e+057.07gene:FBgn0003557 transcript:FBtr0077824[more]
Su(dx)0.000e+057.07gene:FBgn0003557 transcript:FBtr0339529[more]
Su(dx)0.000e+057.07gene:FBgn0003557 transcript:FBtr0077822[more]
Su(dx)0.000e+057.07gene:FBgn0003557 transcript:FBtr0334778[more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wwp10.000e+050.00WW domain containing E3 ubiquitin protein ligase 1... [more]
wwp10.000e+056.77WW domain containing E3 ubiquitin protein ligase 1... [more]
wwp10.000e+057.76WW domain containing E3 ubiquitin protein ligase 1... [more]
wwp13.282e-1259.05WW domain containing E3 ubiquitin protein ligase 1... [more]
wwp16.726e-1259.05WW domain containing E3 ubiquitin protein ligase 1... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wwp10.000e+048.06WW domain containing E3 ubiquitin protein ligase 1... [more]
wwp10.000e+048.18WW domain containing E3 ubiquitin protein ligase 1... [more]
wwp10.000e+047.89WW domain containing E3 ubiquitin protein ligase 1... [more]
wwp10.000e+057.84WW domain containing E3 ubiquitin protein ligase 1... [more]
wwp10.000e+048.18WW domain containing E3 ubiquitin protein ligase 1... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wwp12.088e-1258.91WW domain containing E3 ubiquitin protein ligase 1... [more]
Wwp12.088e-1258.91WW domain containing E3 ubiquitin protein ligase 1... [more]
Wwp20.000e+047.53WW domain containing E3 ubiquitin protein ligase 2... [more]
Wwp20.000e+056.52WW domain containing E3 ubiquitin protein ligase 2... [more]
Itch0.000e+057.17itchy, E3 ubiquitin protein ligase [Source:MGI Sym... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BZZ3|WWP1_MOUSE1.461e-1158.91NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Mus... [more]
sp|Q9H0M0|WWP1_HUMAN0.000e+058.91NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Hom... [more]
sp|Q9Y0H4|SUDX_DROME0.000e+057.07E3 ubiquitin-protein ligase Su(dx) OS=Drosophila m... [more]
sp|Q9DBH0|WWP2_MOUSE0.000e+056.52NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus... [more]
sp|O00308|WWP2_HUMAN0.000e+058.46NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Hom... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PNA00.000e+062.93E3 ubiquitin-protein ligase OS=Mizuhopecten yessoe... [more]
K1QYN20.000e+061.20E3 ubiquitin-protein ligase OS=Crassostrea gigas O... [more]
A0A267GGT30.000e+050.83Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A4W3IVH10.000e+049.12E3 ubiquitin-protein ligase OS=Callorhinchus milii... [more]
A0A1S3H5B30.000e+061.66E3 ubiquitin-protein ligase OS=Lingula unguis OX=7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wwp10.000e+059.62WW domain containing E3 ubiquitin protein ligase 1... [more]
itcha0.000e+057.68E3 ubiquitin-protein ligase Itchy-like [Source:NCB... [more]
itcha0.000e+057.68E3 ubiquitin-protein ligase Itchy-like [Source:NCB... [more]
itchb0.000e+057.00E3 ubiquitin-protein ligase Itchy [Source:NCBI gen... [more]
itchb0.000e+047.49E3 ubiquitin-protein ligase Itchy [Source:NCBI gen... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wwp21.216e-1055.71WW domain containing E3 ubiquitin protein ligase 2... [more]
nedd4a1.596e-13146.38NEDD4 E3 ubiquitin protein ligase a [Source:ZFIN;A... [more]
smurf23.357e-10731.51SMAD specific E3 ubiquitin protein ligase 2 [Sourc... [more]
ube3a1.103e-5133.61ubiquitin protein ligase E3A [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000005015.12.256e-5146.95pep scaffold:Pmarinus_7.0:GL486731:734:6293:1 gene... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RSP53.970e-16546.13NEDD4 family E3 ubiquitin ligase; regulates proces... [more]
TOM13.010e-7439.15E3 ubiquitin ligase of the hect-domain class; has ... [more]
HUL44.596e-3629.29Protein with similarity to hect domain E3 ubiquiti... [more]
HUL52.755e-3528.93Multiubiquitin chain assembly factor (E4); proteas... [more]
UFD43.034e-2026.38Ubiquitin-protein ligase (E3); interacts with Rpt4... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493280.000e+054.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493271.698e-17963.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460711.905e-13142.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493836.571e-10144.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404621.973e-5634.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wwp10.000e+059.48WW domain containing E3 ubiquitin protein ligase 1... [more]
wwp20.000e+056.42WW domain containing E3 ubiquitin protein ligase 2... [more]
wwp20.000e+056.42WW domain containing E3 ubiquitin protein ligase 2... [more]
itcha0.000e+046.08E3 ubiquitin-protein ligase Itchy [Source:NCBI gen... [more]
itchb0.000e+055.67E3 ubiquitin-protein ligase Itchy [Source:NCBI gen... [more]
back to top
BLAST of E3 ubiquitin-protein ligase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008708.10.000e+099.60SMESG000008708.1[more]
SMESG000039114.10.000e+056.47SMESG000039114.1[more]
SMESG000038772.13.506e-950.64SMESG000038772.1[more]
SMESG000013095.19.190e-13139.45SMESG000013095.1[more]
SMESG000013095.11.994e-13039.45SMESG000013095.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019975 ID=SMED30019975|Name=E3 ubiquitin-protein ligase|organism=Schmidtea mediterranea sexual|type=transcript|length=2921bp
TTTATAAATAAGATCTAATTTATTATCTTCCTTATAACTAAAATTTCCTG
TGTTACTTTTCTCTTGATAGATTATAAAATATTTTTAAAGTTAAAAGAAT
TAATGTATTATTGATAGTTCAACATTTAATTATAAATGATTGAAAACGCA
ACTAATAACGTCCAGTCTGCTTTCACTCTTAATATACTAATAAAAAAATT
TAAAGTGAAAGTCAAAAACCTAGGCAGCCACGCAGAACTATATGTTGAGT
ATTCAGTTGACGATGCACCTGCTAAAAAAACTACTACTAAAAGTACATGG
AATCCCGATTGGAGTGAAGAATGTAATTTGTTAGTAGAAGCGAAATCATC
TATAAAATTCATTTTGATCAATAATTATAAATCCCAAAAGAAAACGTTGG
GAAAAGCGGATGTTGATCTCTACAAAATATTATGTCGATTTCTTGGCAAT
TTAAATAACCAAGAATTAGTGGTTCCGATTTCCTCTACCAATAGTCACAC
TCACATCGGAGATCTCACTGTTGTATTAAAAATAGCTTCAACAATAAATA
TTCCAGAAGAAGACAGACCGCGTGCTAATGCTACTGGAAATTTACGCGGG
AGCAATAACTCTTTGCCAGTTTCAGACAGCAGTCCAGCATTAAACAGAGC
TGTTTTACCAGCCGCTGACCTTTCTACAGATCCACTTCCTCAGCACTATG
AAAGGCGATTCGATAATTTCAATAGACCGTATTTTGTAGATCATTTAACA
AAAACTACTTCATGGGAGCCTCCGCAGCCTCTTCCACCAGGTTGGGAGCG
CAGATTAGATACACACAATCGAGTGTATTATGTTGATCACAATACTCGTA
CTACAACTTGGCAAAGACCAGATGTCAGTATGCTCAACAATATCGATCAT
TTTCAAAGGTGGAGAACCGAGAGAAATAATTACATGGAGCAAACACTAAA
TCAGAGATATGGGGCACAAAATTGGGCTGGTAATATTCAAAGGGTGGATC
CGTTAGGAGCTCTTCCTCAAGGCTGGGAAAAGCGAACCGATGCAAATAAT
CGTACTTATTTTGTAAATCACGTGAATAAAACGACTCATTGGGACGATCC
TAGACTGCAAGCTAACCCGTTGCCTCCGGGTTGGGAAATAAGATTTACAG
AAGATGGAATGGCATTTTTTGTGGACCACGAAACCAAAACTACAACTTTT
ACAGATCCTAGAACAACACCGAGAACTGCGGAAGAGACACAATTTTTAAG
AAAACAAAGCCAGTTTTATTACTACTGTCAAAATGCAGTACCGGAAGGTC
ATGTGAAAATTATTGTCCGCAGAAATATGCTGATGGAGGATTCTTTTAAT
GAGATCATGAGAGTCAAACCTAGGGATCTTCAAAAAAGATTATTTATTCA
ATTTAAGGATGAAGATGGTTTAGATTACGGAGGAATTTCAAGAGAATGGT
TTTTCCAGCTATCACACGAGTTGCTCAACCCTATGTATTGTTTATTTGAA
TATGCTTCTGATAATAATTATTCGTTACAAATCAATCCAGCTTCATTTAT
CAATCCAGAGCATTTACAATATTTCCGATTCGTTGGTCGTTTTGTAGCTA
TGGCGATGTTTCATAGAAAATTTATAGACAGTGGATTTACTATTCCATTT
TACAAAAAAATGCTAGGCAAACGTATTACTCTTCAGGATATAGAAACAGT
TGACGTTGAATATTATAATTCTTTGAAATTTATAAGAGATAATAATATTG
ATGAGTGCGACATGGGTCTCGTATTTTCAGCTGAATACGAATTGTTTGGT
AAAATAGAAGAACAAGAACTTAAAACGAATGGGCGTGATATTGAAGTAAC
TGAAGAAAATAAAAATGAATATATTGATCTTATGGTCAATTGGAGGTTTA
GTAGAGGAGTTGTTGAACAGACCAAAGCTTTTATGGATGGCTTTAATGAG
ATTGTCCATCTACACTGGTTACAGGTTTATGATGAAAGACAAATAGAGTT
GTTACTTTGTGGTATGCAACAAATTGATGTGAAGGACTGGGAAGCCAATT
CAATATACAGGGTGTACACTAAAGATTCACCACAAATTAAATGGTTTTGG
GAGTTTGTTGGCAAATTACCAAATGACGAAAAGATCCGTTTGTTGCAATT
TGTAACCGGCACATGTCGCCTTCCAGTCGGTGGATTCAGGGAATTAATGG
GATCTAATGGGCCTCAGAAATTTTGTATAGAAAAAATAGGTAAAGAATCT
TGGTTACCACGCAGCCACACTTGTTTCAACAGATTGGATTTGCCACCTTA
TGCCAGTTATGAGCAATTAAAAGAAAAGTTGACATATGCTGTTATGGAAA
CCGAAGGATTCGGACAAGAATAATAATAATCTATTTAAGAATTATAATTA
TGGACTTTCAATTGATTGATTTTTACTGAACGCGTGTTGTTATGAATATC
TATTGATCATTGTGTTGACAAACAGAGTTGACGCAGTAAATCGAGTTTGA
GATATAACTAATTTTTTAATTTATTTTTTAATACTATTTCCGTCACCGGC
CCGATGTTATCAAATAAAAAAGAAATGTTATCGCGTTAGAGTAATGAGAA
AAATATCTGAATATTTTTTTTACAATGAGAAAATTATTTTTATTTCCATC
GGTTTCATTTAGTATTAAATATTTTCCCATTGGCCTTTTTGGCGCTTGTT
TCCTATTGGAGGAAATCATTTTTCATGTGTCTTTGACGTTGAAGTTGATT
ATTGATTAGTTTTTTATTTCCATTTGAGTTCAGTGAAATATATTGGAATT
TTATCAATAATTATTAATTTTACATTTGCATGTCTATCGTGTTGGTGCTA
TTGGGCCTTCAAAATCGATAAGACGTTTATTAGCCATGTGATTCATTGAT
GGGAGAATTTCGGGATTTACG
back to top

protein sequence of SMED30019975-orf-1

>SMED30019975-orf-1 ID=SMED30019975-orf-1|Name=SMED30019975-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=746bp
MIENATNNVQSAFTLNILIKKFKVKVKNLGSHAELYVEYSVDDAPAKKTT
TKSTWNPDWSEECNLLVEAKSSIKFILINNYKSQKKTLGKADVDLYKILC
RFLGNLNNQELVVPISSTNSHTHIGDLTVVLKIASTINIPEEDRPRANAT
GNLRGSNNSLPVSDSSPALNRAVLPAADLSTDPLPQHYERRFDNFNRPYF
VDHLTKTTSWEPPQPLPPGWERRLDTHNRVYYVDHNTRTTTWQRPDVSML
NNIDHFQRWRTERNNYMEQTLNQRYGAQNWAGNIQRVDPLGALPQGWEKR
TDANNRTYFVNHVNKTTHWDDPRLQANPLPPGWEIRFTEDGMAFFVDHET
KTTTFTDPRTTPRTAEETQFLRKQSQFYYYCQNAVPEGHVKIIVRRNMLM
EDSFNEIMRVKPRDLQKRLFIQFKDEDGLDYGGISREWFFQLSHELLNPM
YCLFEYASDNNYSLQINPASFINPEHLQYFRFVGRFVAMAMFHRKFIDSG
FTIPFYKKMLGKRITLQDIETVDVEYYNSLKFIRDNNIDECDMGLVFSAE
YELFGKIEEQELKTNGRDIEVTEENKNEYIDLMVNWRFSRGVVEQTKAFM
DGFNEIVHLHWLQVYDERQIELLLCGMQQIDVKDWEANSIYRVYTKDSPQ
IKWFWEFVGKLPNDEKIRLLQFVTGTCRLPVGGFRELMGSNGPQKFCIEK
IGKESWLPRSHTCFNRLDLPPYASYEQLKEKLTYAVMETEGFGQE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO:0045746negative regulation of Notch signaling pathway
GO:0048190wing disc dorsal/ventral pattern formation
GO:0019915lipid storage
GO:0031623receptor internalization
GO:0032880regulation of protein localization
GO:0035209pupal development
GO:0008586imaginal disc-derived wing vein morphogenesis
GO:0008587imaginal disc-derived wing margin morphogenesis
GO:0016348imaginal disc-derived leg joint morphogenesis
GO:0016567protein ubiquitination
GO:0007219Notch signaling pathway
GO:0007275multicellular organism development
Vocabulary: molecular function
TermDefinition
GO:0061630ubiquitin protein ligase activity
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0019904protein domain specific binding
GO:0016740transferase activity
GO:0005112Notch binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR024928E3_ub_ligase_SMURF1
IPR036020WW_dom_sf
IPR035983Hect_E3_ubiquitin_ligase
IPR000569HECT_dom
IPR000008C2_dom
IPR022566DUF2613
IPR001202WW_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005938cell cortex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000569HECT domainSMARTSM00119hect_3coord: 409..745
e-value: 1.2E-167
score: 572.9
IPR000569HECT domainPFAMPF00632HECTcoord: 441..743
e-value: 1.6E-94
score: 316.8
IPR000569HECT domainPROSITEPS50237HECTcoord: 411..745
score: 106.31
IPR000569HECT domainCDDcd00078HECTccoord: 391..743
e-value: 2.45879E-165
score: 478.598
IPR001202WW domainSMARTSM00456ww_5coord: 328..360
e-value: 7.1E-12
score: 55.5
coord: 183..215
e-value: 2.8E-7
score: 40.2
coord: 216..247
e-value: 2.7E-10
score: 50.2
coord: 292..324
e-value: 1.8E-12
score: 57.4
IPR001202WW domainPFAMPF00397WWcoord: 216..245
e-value: 7.7E-11
score: 41.9
coord: 329..358
e-value: 1.0E-7
score: 31.9
coord: 184..213
e-value: 2.7E-6
score: 27.3
coord: 293..322
e-value: 6.9E-11
score: 42.0
IPR001202WW domainPROSITEPS01159WW_DOMAIN_1coord: 333..358
IPR001202WW domainPROSITEPS01159WW_DOMAIN_1coord: 220..245
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 182..215
score: 14.205
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 291..324
score: 17.358
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 214..247
score: 18.323
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 327..360
score: 15.624
IPR001202WW domainCDDcd00201WWcoord: 330..351
e-value: 7.73489E-5
score: 38.2778
IPR001202WW domainCDDcd00201WWcoord: 185..215
e-value: 8.55841E-7
score: 43.6706
IPR001202WW domainCDDcd00201WWcoord: 294..324
e-value: 4.49708E-11
score: 55.997
IPR001202WW domainCDDcd00201WWcoord: 217..246
e-value: 5.36188E-11
score: 55.6118
NoneNo IPR availableGENE3DG3DSA:3.90.1750.10coord: 328..624
e-value: 2.2E-128
score: 429.5
NoneNo IPR availableGENE3DG3DSA:2.20.70.10coord: 177..214
e-value: 3.4E-10
score: 41.2
NoneNo IPR availableGENE3DG3DSA:2.20.70.10coord: 285..324
e-value: 2.0E-16
score: 61.6
NoneNo IPR availableGENE3DG3DSA:2.20.70.10coord: 215..259
e-value: 4.8E-15
score: 57.0
NoneNo IPR availableGENE3DG3DSA:3.30.2410.10coord: 626..745
e-value: 2.7E-46
score: 158.4
NoneNo IPR availableGENE3DG3DSA:3.30.2160.10coord: 513..591
e-value: 2.2E-128
score: 429.5
NoneNo IPR availablePANTHERPTHR11254:SF299NEDD4-LIKE E3 UBIQUITIN-PROTEIN LIGASE WWP1coord: 177..745
NoneNo IPR availablePANTHERPTHR11254HECT DOMAIN UBIQUITIN-PROTEIN LIGASEcoord: 177..745
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 25..131
IPR000008C2 domainPFAMPF00168C2coord: 26..97
e-value: 3.1E-6
score: 27.4
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 12..139
e-value: 3.3E-11
score: 45.2
IPR024928E3 ubiquitin-protein ligase, SMURF1 typePIRSFPIRSF001569E3_ub_ligase_SMURF1coord: 248..745
e-value: 4.5E-223
score: 740.8
coord: 213..287
e-value: 1.4E-14
score: 51.0
coord: 117..216
e-value: 5.9E-9
score: 32.4
coord: 2..110
e-value: 2.4E-4
score: 17.1
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 327..361
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 175..213
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 286..325
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 213..247
IPR035983HECT, E3 ligase catalytic domainSUPERFAMILYSSF56204Hect, E3 ligase catalytic domaincoord: 374..739