Kinesin-like protein

Overview
NameKinesin-like protein
Smed IDSMED30019972
Length (bp)3105
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-like protein (SMED30019972) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30019972) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin-like protein (SMED30019972) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30019972) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019972

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019972SMESG000017021.1 SmedASXL_012050SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30019972SMESG000017021.1 dd_Smed_v4_9460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019972SMESG000017021.1 dd_Smed_v4_9460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019972SMESG000017021.1 dd_Smed_v4_9460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30019972SMESG000017021.1 dd_Smed_v4_9460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019972SMESG000017021.1 dd_Smed_v6_9460_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30019972SMESG000017021.1 Contig44247newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30019972SMESG000017021.1 dd_Smed_v4_9460_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF19 (kinesin family member 19 [Source:HGNC Symbol;Acc:HGNC:26735])

HSP 1 Score: 470.315 bits (1209), Expect = 1.093e-148
Identity = 278/640 (43.44%), Postives = 414/640 (64.69%), Query Frame = 3
Query:  126 KNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGV-QVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLD---------SMQTSGD-----PEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEW---ESKKAERISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHA--SKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            K++  S DQ LMV LR+RP++  E   G  +IAH +D  M VL+DP+EDPDDILRA+RSRE+ ++FD  F+ + +QE V++ +T  LI  V+ GY ATVFAYG TG GKTYTMLG ++ PGI  + L  +F+ +    +D  +++S+SYLE+YNEMIRDLL  +   L+LRED  GV QVAG+TE+      E+M LL +GN  RT E T AN+ SSRSHAVLQV V  RSRV+N  +++ +G+LF+IDLAGSERAS T NRG+RM EGAHINRSLLALGNCINAL+D    +Y+NYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YA RAK+I+T++ +N+ +V++H+ QY ++I++L+ EI RL+ K+D           Q  GD      E  +     ++    ++++ L  AFQ+ +  ++ L E      ++ ++ +R  + I  W   +S++A +  E + K    + + E+ +        + E   V + R  +     E+ +L+ Q+  LEQ   +   + + LE  +P ++ +   R++L LLC++H+LE++ T++++ + +LR  A   +H+ ++  L +H  LC  II  Q  +I DY + +P+ LE LY++Y R+
Sbjct:    2 KDSGDSKDQQLMVALRVRPISVAELEEGATLIAHKVDEQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFTATQEMVYQATTKSLIEGVISGYNATVFAYGPTGCGKTYTMLGTDQEPGIYVQTLNDLFRAIEETSNDMEYEVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKEIMQLLMKGNRQRTQEPTAANQTSSRSHAVLQVTVRQRSRVKNILQEVRQGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSDKGSNKYINYRDSKLTRLLKDSLGGNSRTVMIAHISPASSAFEESRNTLTYAGRAKNIKTRVKQNLLNVSYHIAQYTSIIADLRGEIQRLKRKIDEQTGRGQARGRQDRGDIRHIQAEVQLHSGQGEKAGMGQLREQLASAFQEQMDVRRRLLELENRAMEVQIDTSRHLLTIAGWKHEKSRRALKWREEQRKECYAKDDSEKDSDTGDDQPDILEPPEVAAARESIAALVDEQKQLRKQKLALEQRCRELRARGRRLEETLPRRIGSEEQREVLSLLCRVHELEVENTEMQS-HALLRDGALRHRHEAVRR-LEQHRSLCDEIIQGQRQIIDDYNLAVPQRLEELYEVYLRE 639          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF19 (kinesin family member 19 [Source:HGNC Symbol;Acc:HGNC:26735])

HSP 1 Score: 408.683 bits (1049), Expect = 7.556e-130
Identity = 255/639 (39.91%), Postives = 386/639 (60.41%), Query Frame = 3
Query:  126 KNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSM---------QTSGD-----PEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEW---ESKKAERISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHA--SKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            K++  S DQ LMV LR+RP++  E   G  +IAH +D  M VL+DP+EDPDDILRA+RSRE+ ++FD  F+ + +QE V++ +T  LI  V+ GY ATVFAYG TG GKTYTMLG ++ PGI  + L  +F+ +    +D  +++S+SYLE+                                         M LL +GN  RT E T AN+ SSRSHAVLQV V  RSRV+N  +++ +G+LF+IDLAGSERAS T NRG+RM EGAHINRSLLALGNCINAL+D    +Y+NYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YA RAK+I+T++ +N+ +V++H+ QY ++I++L+ EI RL+ K+D           Q  GD      E  +     ++    ++++ L  AFQ+ +  ++ L E      ++ ++ +R  + I  W   +S++A +  E + K    + + E+ +        + E   V + R  +     E+ +L+ Q+  LEQ   +   + + LE  +P ++ +   R++L LLC++H+LE++ T++++ + +LR  A   +H+ ++  L +H  LC  II  Q  +I DY + +P+ LE LY++Y R+
Sbjct:    2 KDSGDSKDQQLMVALRVRPISVAELEEGATLIAHKVDEQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFTATQEMVYQATTKSLIEGVISGYNATVFAYGPTGCGKTYTMLGTDQEPGIYVQTLNDLFRAIEETSNDMEYEVSMSYLEI-----------------------------------------MQLLMKGNRQRTQEPTAANQTSSRSHAVLQVTVRQRSRVKNILQEVRQGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSDKGSNKYINYRDSKLTRLLKDSLGGNSRTVMIAHISPASSAFEESRNTLTYAGRAKNIKTRVKQNLLNVSYHIAQYTSIIADLRGEIQRLKRKIDEQTGRGQARGRQDRGDIRHIQAEVQLHSGQGEKAGMGQLREQLASAFQEQMDVRRRLLELENRAMEVQIDTSRHLLTIAGWKHEKSRRALKWREEQRKECYAKDDSEKDSDTGDDQPDILEPPEVAAARESIAALVDEQKQLRKQKLALEQRCRELRARGRRLEETLPRRIGSEEQREVLSLLCRVHELEVENTEMQS-HALLRDGALRHRHEAVRR-LEQHRSLCDEIIQGQRQIIDDYNLAVPQRLEELYEVYLRE 597          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF18B (kinesin family member 18B [Source:HGNC Symbol;Acc:HGNC:27102])

HSP 1 Score: 282.337 bits (721), Expect = 1.214e-80
Identity = 159/331 (48.04%), Postives = 218/331 (65.86%), Query Frame = 3
Query:  315 FVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEEN 1301
            FVFD VF  + +Q++VF+ +T  ++   L GY  +VFAYGATG GKT+TMLG    PGIM+     +++++   + +  F++ +SY EVYNE I DLL      L +RED + GV V GL+  +  +  +++++L RGN  RT   T AN  SSRSHA+ Q+ V  + RV    + +   K+ LIDLAGSERAS+T  +G+R+ EGA+INRSLLAL N +NALAD  G++ +V YRDSKLTRLLKD+LGGNCRTVMIA I PS+L +ED+ NTL YADRAK IR  +  NV  ++ H+ QY  +  +L+ E+  LR KL   +  G P   
Sbjct:   70 FVFDRVFGEAATQQDVFQHTTHSVLDSFLQGYNCSVFAYGATGAGKTHTMLGREGDPGIMYLTTVELYRRLEARQQEKHFEVLISYQEVYNEQIHDLLEPKGP-LAIREDPDKGVVVQGLSFHQPASAEQLLEILTRGNRNRTQHPTDANATSSRSHAIFQIFVKQQDRVPGLTQAVQVAKMSLIDLAGSERASSTHAKGERLREGANINRSLLALINVLNALADAKGRKTHVPYRDSKLTRLLKDSLGGNCRTVMIAAISPSSLTYEDTYNTLKYADRAKEIRLSLKSNVTSLDCHISQYATICQQLQAEVAALRKKLQVYEGGGQPPPQ 399          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF18B (kinesin family member 18B [Source:HGNC Symbol;Acc:HGNC:27102])

HSP 1 Score: 282.337 bits (721), Expect = 1.517e-80
Identity = 159/330 (48.18%), Postives = 218/330 (66.06%), Query Frame = 3
Query:  315 FVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEE 1298
            FVFD VF  + +Q++VF+ +T  ++   L GY  +VFAYGATG GKT+TMLG    PGIM+     +++++   + +  F++ +SY EVYNE I DLL      L +RED + GV V GL+  +  +  +++++L RGN  RT   T AN  SSRSHA+ Q+ V  + RV    + +   K+ LIDLAGSERAS+T  +G+R+ EGA+INRSLLAL N +NALAD  G++ +V YRDSKLTRLLKD+LGGNCRTVMIA I PS+L +ED+ NTL YADRAK IR  +  NV  ++ H+ QY  +  +L+ E+  LR KL   +  G P  
Sbjct:   70 FVFDRVFGEAATQQDVFQHTTHSVLDSFLQGYNCSVFAYGATGAGKTHTMLGREGDPGIMYLTTVELYRRLEARQQEKHFEVLISYQEVYNEQIHDLLEPKGP-LAIREDPDKGVVVQGLSFHQPASAEQLLEILTRGNRNRTQHPTDANATSSRSHAIFQIFVKQQDRVPGLTQAVQVAKMSLIDLAGSERASSTHAKGERLREGANINRSLLALINVLNALADAKGRKTHVPYRDSKLTRLLKDSLGGNCRTVMIAAISPSSLTYEDTYNTLKYADRAKEIRLSLKSNVTSLDCHISQYATICQQLQAEVAALRKKLQVYEGGGQPPP 398          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF18B (kinesin family member 18B [Source:HGNC Symbol;Acc:HGNC:27102])

HSP 1 Score: 281.952 bits (720), Expect = 1.802e-80
Identity = 159/331 (48.04%), Postives = 218/331 (65.86%), Query Frame = 3
Query:  315 FVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEEN 1301
            FVFD VF  + +Q++VF+ +T  ++   L GY  +VFAYGATG GKT+TMLG    PGIM+     +++++   + +  F++ +SY EVYNE I DLL      L +RED + GV V GL+  +  +  +++++L RGN  RT   T AN  SSRSHA+ Q+ V  + RV    + +   K+ LIDLAGSERAS+T  +G+R+ EGA+INRSLLAL N +NALAD  G++ +V YRDSKLTRLLKD+LGGNCRTVMIA I PS+L +ED+ NTL YADRAK IR  +  NV  ++ H+ QY  +  +L+ E+  LR KL   +  G P   
Sbjct:   79 FVFDRVFGEAATQQDVFQHTTHSVLDSFLQGYNCSVFAYGATGAGKTHTMLGREGDPGIMYLTTVELYRRLEARQQEKHFEVLISYQEVYNEQIHDLLEPKGP-LAIREDPDKGVVVQGLSFHQPASAEQLLEILTRGNRNRTQHPTDANATSSRSHAIFQIFVKQQDRVPGLTQAVQVAKMSLIDLAGSERASSTHAKGERLREGANINRSLLALINVLNALADAKGRKTHVPYRDSKLTRLLKDSLGGNCRTVMIAAISPSSLTYEDTYNTLKYADRAKEIRLSLKSNVTSLDCHISQYATICQQLQAEVAALRKKLQVYEGGGQPPPQ 408          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-13 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:H2KYL6])

HSP 1 Score: 269.24 bits (687), Expect = 1.156e-77
Identity = 169/360 (46.94%), Postives = 238/360 (66.11%), Query Frame = 3
Query:  150 QNLMVCLRIRPVNEDEH-----------NLGIPIIAHSMDGNM-----AVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNG-VQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKN 1178
            Q L V +R+RP+N  E            +  +P  + S   N+      +L+DP +  ++ILR NR  ER F FD  F ++ +QE+V + +T P+I  V++G+ ATVFAYGATG+GKT+TM+G  +RPG+M    +++++++     D  +++ LSY+E+YNE+IRDLL  +   L+L ED+ G ++V GL+ ++      +M +L  GN  RT EAT ANK SSRSHA+LQV ++        + Q +  KLF+IDLAGSERASNT NRG R+ EGA INRSLLALGN IN+LA    K +VNYRDSKLTRLLKD+LGG  +T MIAH+ PS+ +FE++ NTL+YA RA +I  K  +N
Sbjct:    6 QQLTVVVRVRPLNSGEKSRKAFQCVFPLDKKVPRTSLSKKLNLFSFKRVLLVDPEKFENNILRQNRQHERKFEFDASFGATSNQEDVHETTTGPIIDSVVEGFNATVFAYGATGSGKTFTMIGTKDRPGLMTLMTKTLYEKL-----DNQYQVLLSYMEIYNEIIRDLLNPSGGDLELLEDERGNIRVPGLSSVKAPN---IMQILQEGNLRRTQEATMANKTSSRSHALLQVMIV--------KNQSLHSKLFMIDLAGSERASNTQNRGIRLKEGAAINRSLLALGNVINSLASKTTK-FVNYRDSKLTRLLKDSLGGTAKTCMIAHVTPSSSNFEETYNTLMYASRAMNITNKPMRN 348          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-11 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:E5QCG4])

HSP 1 Score: 208.764 bits (530), Expect = 6.479e-56
Identity = 144/363 (39.67%), Postives = 219/363 (60.33%), Query Frame = 3
Query:  309 RHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERP---GIMFKALESMFKQMHMMED-DYIFKMSLSYLEVYNEMIRDLLGSNS-VVLDLRE-DQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRT--KIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEENITLSMSDQIEEMKIKDNLLVAFQK 1373
            + F FD +++ + +Q ++++ +   L+  VL+GY AT+FAYG TGTGKT+TM G +  P   G+++K ++ +F+ M    + +Y+ + S  YLE+Y E +RDLL + S   L+++E    GV V  LT     T  E+ +++ RGN  R+V  T  N+HSSRSHA+  + V       + +  I  G+L L+DLAGSER S T   G+R  E   IN SL ALGN I+AL D     ++ YRDSKLTRLL+D+LGGN +TVM+A IGP++ +FE++  TL YA+RAK+I+   KI+++  D          ++ E ++EI  LR +L   +T     +  T S  D  E  K++D+ + A QK
Sbjct:   58 KDFTFDAIYDENSTQSDLYEETFRDLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSSDPEQRGVIYKCIDHIFEHMAASHNQEYLVRAS--YLEIYQEELRDLLEAESNKKLEIKERPDGGVYVKDLTSKLTRTVGEIHEVMIRGNGHRSVGRTNMNEHSSRSHAIFIITVECSRIGEDGESHITVGRLNLVDLAGSERQSKTGATGERFKEATKINLSLSALGNVISALVDAKSA-HIPYRDSKLTRLLQDSLGGNSKTVMVACIGPASYNFEETLGTLRYANRAKNIKNQPKINEDPKDA---------LLREFQEEIEMLREQLKQRKTRS--RDGATQSFYD-AERAKLEDD-IEAIQK 404          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: unc-116 (Kinesin heavy chain [Source:UniProtKB/Swiss-Prot;Acc:P34540])

HSP 1 Score: 202.601 bits (514), Expect = 9.642e-54
Identity = 127/301 (42.19%), Postives = 187/301 (62.13%), Query Frame = 3
Query:  315 FVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGI---NERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQ-VAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLV 1205
            +VFD VF  + +QE+V+K +   ++  VL GY  TVFAYG T +GKT+TM G+   N   GI+ + +  +F  ++ M+++  F + +SY E+YNE IRDLL    V L + ED+N V  V G TE  V   +EV+  +  G + R V  T  N+HSSRSH+V  + V  +   + T++Q+  GKL+L+DLAGSE+ S T  +G  + E  +IN+SL ALG  I+ALA+   K +V YRDSKLTR+L+++LGGN RT +I    PS  +  ++++TL++  RAK I     KNV  +N  L 
Sbjct:   49 YVFDKVFKPNTTQEQVYKGAAYHIVQDVLSGYNGTVFAYGQTSSGKTHTMEGVIGDNGLSGIIPRIVADIFNHIYSMDENLQFHIKVSYYEIYNEKIRDLLDPEKVNLSIHEDKNRVPYVKGATERFVGGPDEVLQAIEDGKSNRMVAVTNMNEHSSRSHSVFLITV--KQEHQTTKKQLT-GKLYLVDLAGSEKVSKTGAQGTVLEEAKNINKSLTALGIVISALAE-GTKSHVPYRDSKLTRILQESLGGNSRTTVIICASPSHFNEAETKSTLLFGARAKTI-----KNVVQINEELT 340          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: osm-3 (Osmotic avoidance abnormal protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P46873])

HSP 1 Score: 200.29 bits (508), Expect = 1.231e-53
Identity = 143/367 (38.96%), Postives = 208/367 (56.68%), Query Frame = 3
Query:  150 QNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERP---GIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGS-NSVVLDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELK 1235
            +++ V +R RP N+ E +L   +    M  N+             L A     + F FD  +    + E+++     PL+  V++GY  TVFAYG TG+GKT++M GI   P   G++ +A + +F      E+   F +  SYLE+YNE +RDLLG+ N   L+++E  + GV VAGL+    +      +L+ RG   R V AT  NK SSRSH++  V V   +   +    I  GKL L+DLAGSER S T   G R+ E   IN SL ALGN I+AL D   K ++ YRDSKLTRLL+D+LGGN +T+MIA + PS+ +++++ +TL YA+RAK+I+ K   N    +  L +Y   I+ LK
Sbjct:    3 ESVRVAVRCRPFNQREKDLNTTLCV-GMTPNVG---------QVNLNAPDGAAKDFTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQRGVIPRAFDHIFTATATTEN-VKFLVHCSYLEIYNEEVRDLLGADNKQKLEIKEQPDRGVYVAGLSMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVEGMTETGS----IRMGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSK-HIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINEDPKDALLREYQEEIARLK 353          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 197.593 bits (501), Expect = 4.965e-53
Identity = 156/413 (37.77%), Postives = 227/413 (54.96%), Query Frame = 3
Query:  150 QNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLG---INERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSN-SVVLDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIR--TKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDP--EENITLSMSDQIEEMKIKDNLL 1358
            + + V +R RP++  E   G  I     D   AV +  L        +     R F FD VF+ +  Q  V+ ++  P++  VL GY  T+FAYG TGTGKT+TM G     E  GI+  +   +F  +   + D  F + +SYLE+YNE IRDLL  + +  L+++E  + GV V  L+   V   +++  L+  G+  R V AT  N  SSRSHA+  V + S    RN    + +GKL L+DLAGSER S T  +G+R+ E A IN SL  LGN I++L D  GK  ++ YR+SKLTRLL+D+LGGN +TVMIA++GP+  +++++ +TL YA+RAK+I+   KI+++  D      Q          EI  LR  LD      D   EE     M ++  EM+ K  +L
Sbjct:    5 EKVKVVVRCRPISTTEKLQGHKIAVTCNDEEKAVNIKSL--------SQEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSKDHNGNLEIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTIES---CRNGL--VTQGKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVD--GKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYANRAKNIQNVAKINEDPKDAQLRKFQL---------EIEALRKILDEENPGDDENQEEAWEAKMQEREVEMEKKRKIL 393          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Kif19A (gene:FBgn0038205 transcript:FBtr0082912)

HSP 1 Score: 363.229 bits (931), Expect = 1.875e-111
Identity = 252/693 (36.36%), Postives = 374/693 (53.97%), Query Frame = 3
Query:  141 SSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERP------------------------GIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNG--VQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYD---VNFHLVQYNNVISELKQEINRLRNKL-----------------DSMQTSGDPEENITLSMSDQIEEMK-----IKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRDDLTMTNNINMGLLDIDKDLYTYERILP 2066
            + ++ L+V +R+RP               SM+     +              +SR R + +DHVF  + SQE+V+K +T PL+  VL+G  A VFAYGATG+GKT+TMLG   R                         G+M +A+E +F  +   E  Y  ++S+SYLE+YNE+IRDLL      L+LRED  G  + VAGL+EI  ++  EV+ LL +GN  RT+E T AN+ SSRSHA+L + V +R+ +   Q     G+LFL DLAGSERA  T NRGKR+ EGAHINRSLLALGN IN L+   G RYVNYRDSKLTRLLK+AL G C+TVMIAH+ P + H ++++NTLVYADRA  I TK+  +VY     +F    Y +++SEL+ E++RLR K+                  S           + ++ +Q E+ K     +++ +++ F++ +  ++ L E  +    L L+  R  +II  W+     RI +  +   D +IE E              S  +K+   EL   + E  R K  RE+ E +L++   +   LE  +PE++ ++  R++L LLC++H+LE  +  L+ E +  +    + DL      +   LC+ II++Q  LI++  VDLP +L  LY LY ++       I+ G+  +      YER LP
Sbjct:   31 AQEERLVVAVRVRP---------------SMEATERCIEVISGGSLLYDDGGKSRPRQYSYDHVFRENDSQEQVYKTTTAPLVRDVLNGLNAAVFAYGATGSGKTHTMLGPVPRKKPQTSDRAPPTASCDSTDVSSQDIGLMVRAIEDIFSHIESAEA-YSCRVSISYLEIYNELIRDLLNPGGP-LELREDHRGQRITVAGLSEITTSSRKEVVSLLLKGNKARTMEPTAANQTSSRSHALLSIMVQARTPLGTKQ-----GRLFLTDLAGSERAKKTKNRGKRLQEGAHINRSLLALGNVINGLS--GGARYVNYRDSKLTRLLKEALSGRCKTVMIAHVAPESKHRDETKNTLVYADRANSITTKLQNSVYIDEFKDFPTKHYQSLVSELRDEVSRLRTKMLTERPRSGAAAAAAAAAASGSAGTAGSGAGSEAVQEQDEQRKTELRYLREQIVLTFKQQMKLRRKLLEAESHLLGLELDAERQHMIISHWQG----RIGKLYDAMGDDDIESE-------------GSVALKNAWGELAAIEKETRRYKEIRERTEHELEQCRQKGVKLEDELPERISSDEERELLALLCRVHELEADKVSLQAERLARQAELRRRDLQLLRAERQRRLCEDIISSQRRLIEEGNVDLPDELRELYGLYQQE-------IHAGV--VTPSTSNYERKLP 673          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp67A (gene:FBgn0004379 transcript:FBtr0333886)

HSP 1 Score: 253.447 bits (646), Expect = 1.801e-71
Identity = 153/337 (45.40%), Postives = 215/337 (63.80%), Query Frame = 3
Query:  321 FDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYD----VNFHLVQYNNVISE---LKQEINRLRNKLDSMQTSG----DPEE 1298
            FD VF+   S +++F+  T PL+  VL+GY  +VF YGATG GKT+TMLG    PG+ +  ++ +F ++    D   F + +SYLEVYNE + +LL + S  L LRED NGV V+GL    + +  E++ +L  GN+ RT   T AN  SSRSHA+ QV++    R  +T+  +   KL +IDLAGSERA++T   G R  EGA IN+SLLALGNCIN LAD  G +++ YRDS LTR+LKD+LGGNCRT+M+A++  S+L +ED+ NTL YA RAK IRT + +NV        F++ + + V++E   LK+    L  K   ++ +G    DP E
Sbjct:   74 FDRVFDIDNSNQDLFEECTAPLVDAVLNGYNCSVFVYGATGAGKTFTMLGSEAHPGLTYLTMQDLFDKIQAQSDVRKFDVGVSYLEVYNEHVMNLL-TKSGPLKLREDNNGVVVSGLCLTPIYSAEELLRMLMLGNSHRTQHPTDANAESSRSHAIFQVHIRITERKTDTKRTV---KLSMIDLAGSERAASTKGIGVRFKEGASINKSLLALGNCINKLAD--GLKHIPYRDSNLTRILKDSLGGNCRTLMVANVSMSSLTYEDTYNTLKYASRAKKIRTTLKQNVLKSKMPTEFYVKKIDEVVAENERLKERNKALEAKATQLERAGNSGFDPLE 404          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp67A (gene:FBgn0004379 transcript:FBtr0346530)

HSP 1 Score: 253.832 bits (647), Expect = 4.490e-71
Identity = 153/337 (45.40%), Postives = 215/337 (63.80%), Query Frame = 3
Query:  321 FDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYD----VNFHLVQYNNVISE---LKQEINRLRNKLDSMQTSG----DPEE 1298
            FD VF+   S +++F+  T PL+  VL+GY  +VF YGATG GKT+TMLG    PG+ +  ++ +F ++    D   F + +SYLEVYNE + +LL + S  L LRED NGV V+GL    + +  E++ +L  GN+ RT   T AN  SSRSHA+ QV++    R  +T+  +   KL +IDLAGSERA++T   G R  EGA IN+SLLALGNCIN LAD  G +++ YRDS LTR+LKD+LGGNCRT+M+A++  S+L +ED+ NTL YA RAK IRT + +NV        F++ + + V++E   LK+    L  K   ++ +G    DP E
Sbjct:   74 FDRVFDIDNSNQDLFEECTAPLVDAVLNGYNCSVFVYGATGAGKTFTMLGSEAHPGLTYLTMQDLFDKIQAQSDVRKFDVGVSYLEVYNEHVMNLL-TKSGPLKLREDNNGVVVSGLCLTPIYSAEELLRMLMLGNSHRTQHPTDANAESSRSHAIFQVHIRITERKTDTKRTV---KLSMIDLAGSERAASTKGIGVRFKEGASINKSLLALGNCINKLAD--GLKHIPYRDSNLTRILKDSLGGNCRTLMVANVSMSSLTYEDTYNTLKYASRAKKIRTTLKQNVLKSKMPTEFYVKKIDEVVAENERLKERNKALEAKATQLERAGNSGFDPLE 404          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp67A (gene:FBgn0004379 transcript:FBtr0076499)

HSP 1 Score: 253.832 bits (647), Expect = 4.490e-71
Identity = 153/337 (45.40%), Postives = 215/337 (63.80%), Query Frame = 3
Query:  321 FDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYD----VNFHLVQYNNVISE---LKQEINRLRNKLDSMQTSG----DPEE 1298
            FD VF+   S +++F+  T PL+  VL+GY  +VF YGATG GKT+TMLG    PG+ +  ++ +F ++    D   F + +SYLEVYNE + +LL + S  L LRED NGV V+GL    + +  E++ +L  GN+ RT   T AN  SSRSHA+ QV++    R  +T+  +   KL +IDLAGSERA++T   G R  EGA IN+SLLALGNCIN LAD  G +++ YRDS LTR+LKD+LGGNCRT+M+A++  S+L +ED+ NTL YA RAK IRT + +NV        F++ + + V++E   LK+    L  K   ++ +G    DP E
Sbjct:   74 FDRVFDIDNSNQDLFEECTAPLVDAVLNGYNCSVFVYGATGAGKTFTMLGSEAHPGLTYLTMQDLFDKIQAQSDVRKFDVGVSYLEVYNEHVMNLL-TKSGPLKLREDNNGVVVSGLCLTPIYSAEELLRMLMLGNSHRTQHPTDANAESSRSHAIFQVHIRITERKTDTKRTV---KLSMIDLAGSERAASTKGIGVRFKEGASINKSLLALGNCINKLAD--GLKHIPYRDSNLTRILKDSLGGNCRTLMVANVSMSSLTYEDTYNTLKYASRAKKIRTTLKQNVLKSKMPTEFYVKKIDEVVAENERLKERNKALEAKATQLERAGNSGFDPLE 404          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp68D (gene:FBgn0004381 transcript:FBtr0332129)

HSP 1 Score: 211.075 bits (536), Expect = 1.442e-56
Identity = 152/416 (36.54%), Postives = 234/416 (56.25%), Query Frame = 3
Query:  123 RKNTAGSS---DQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGI---NERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSG-------DPEENITLSMSDQIE 1331
            R+   GSS   ++ + V +R RP++  E +   P + +       V L  + D       N+ + + F +D  +++S +Q  ++     PL+S VL+G+   +FAYG TGTGKT+TM G+   +E  GI+ +  E ++  ++  E+ + F + +SYLE+Y E +RDLL  NS  L++RE  +GV V  L  I   +  +++ ++  GN  RTV  T  N+HSSRSHA+  + +       NT   I  GKL LIDLAGSER S T    +R+ E + IN +L +LGN I+ALA+     +V YRDSKLTRLL+D+LGGN +T+MIA+IGPS  ++ ++  TL YA RAK I+ +  KN    +  L +Y   I  LK+ I   + +    Q +          +E +T  MSD ++
Sbjct:    6 RRPGTGSSQTPNECVQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVD------GNKEQRKVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQIWLHINRTEN-FQFLVDVSYLEIYMEELRDLLKPNSKHLEVRERGSGVYVPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDTETNT---IKVGKLNLIDLAGSERQSKTGASAERLKEASKINLALSSLGNVISALAE--SSPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLRYASRAKSIQNQPIKNEDPQDAKLKEYQEEIERLKRLIGPQQQQRSEKQVTAKKQRVKKPKKETVTKEMSDSLQ 409          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: si:dkey-26i13.8 (si:dkey-26i13.8 [Source:ZFIN;Acc:ZDB-GENE-090312-134])

HSP 1 Score: 449.129 bits (1154), Expect = 7.004e-142
Identity = 277/645 (42.95%), Postives = 408/645 (63.26%), Query Frame = 3
Query:  147 DQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNG-VQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGK--RYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSM---QTSGDPEE--NITLSMS--DQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRDDLTMTNNINMGLLDIDKDLYTY 2051
            D  L V LRIRP+NE E   G  I+AH +D  M VL+DP ED D++LRA+RSRE+ ++FD  F+ + +QE+V+  +T  LI  V+ GY ATVFAYG TG GKT+TMLG++  PGI  + L  +F+ +    +D    + +SY+E+YNEMIRDLL  +S  L+LRED  G +++AG+TE       E+M LL +GN  RT E+T ANK SSRSHA+LQV V  +SRV++  E++  GKLF++DLAG+ERAS T NRGKRM EGAHINRSLLAL NCINAL++  GK  ++VNYRDSKLTRLLKDALGGN RTVMI HI P++ +FE+SRNTLVYAD+AK+IRTK+ +N+ +V++HL QY  +I++L+ EI RLR K+D     Q  G+  +  NI   +      E   +++ LL AF++ +  ++ L E    + +L ++ +R  + I +WE  +A    E++  S  K+  D+E+  E    E       V + R E+     E+ +    + +LE+ L    ++   +E  +P+++ N   R +L LLC++H+LE+++T++++  +         D I     +   LC  II  Q  LI+D G+ +P+ L+ LY LY          ++ G++D   +L+T+
Sbjct:   10 DHQLTVALRIRPLNEAEIEEGATIVAHKIDNQMVVLMDPCEDSDNVLRAHRSREKTYMFDLAFDYTATQEDVYVATTKNLIDGVIAGYNATVFAYGPTGAGKTHTMLGLDSEPGIYIRTLNDLFRAIEDSTEDLDCSVYMSYIEIYNEMIRDLLNPSSGYLELREDGKGEIRIAGITEFSTCNAKEIMALLTKGNKQRTQESTAANKTSSRSHAILQVTVKQKSRVKDINEEVRVGKLFMVDLAGTERASQTQNRGKRMKEGAHINRSLLALANCINALSEKGGKGAQFVNYRDSKLTRLLKDALGGNSRTVMITHISPASSNFEESRNTLVYADKAKNIRTKVKRNLMNVSYHLAQYTRIIADLRSEIERLRAKIDQQSQDQLKGEKADIRNIQAEVQQYSHGEMALLQEQLLSAFREQMEIRRSLMELENCNMELHIDTSRHLLTISDWERDRARARREKDELSGQKKHTDKEEEQESMPEEPQY----VTAAREEIGPLLAEQRKTMELKRELEEKLLNMKLKSSKIEELLPKRISNTEQRDILMLLCKVHELELEKTEIQSAVLCKENVLRTKDFIIQRHEQQRTLCDDIIHQQKMLIEDQGLCVPEGLQELYSLY-------FGELSDGIIDQILNLHTF 643          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif19 (kinesin family member 19 [Source:ZFIN;Acc:ZDB-GENE-080215-2])

HSP 1 Score: 448.358 bits (1152), Expect = 6.423e-141
Identity = 254/582 (43.64%), Postives = 377/582 (64.78%), Query Frame = 3
Query:  288 RANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNG-VQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKL---DSMQTSGD--------PEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAER----ISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            RA+RSRE+ ++FD  F+ S +Q+EV++ +T  LI  ++ GY ATVFAYG TG GKTYTMLG +  PGI  + L  +FK +    DD  + +S+SYLE+YNEMIRDLL  +S  LDLRED  G +QVAG+TE+      E+M+LL +GN  RT E T AN+ SSRSHAVLQV V  +SR R+  +++   +LF+IDLAGSERAS T NRG+R+ EGAHINRSLLALGNCINAL++ NG +YVNYRDSKLTRLLKD+LGGN RTVMIAHI P++L FEDSRNTL YADRAK IRT++ +N+ +V++H+ QY ++IS+L+ EI RL+ K+    S Q + D         E     S   + E  ++++ L+ AF++ +  +K L E   S+ ++ ++ ++  + I +WE ++  R      ER  +S +K+ E E+ +     L   +E++ V   R  L     E+ +++ Q+  LEQ L +   + + LE  +P +V +   R++L LLC++H+LEI+  ++++  ++      + +++     +H  LC  II  Q   I D+ + +P  L+ LY++Y ++
Sbjct:   17 RAHRSREKTYMFDVAFDYSATQDEVYRYTTKGLIEGLISGYNATVFAYGPTGCGKTYTMLGTDREPGIYVRTLNDLFKAIEETSDDMQYSVSMSYLEIYNEMIRDLLNPSSGFLDLREDSKGEIQVAGITEVSTINAREIMELLMKGNKQRTQEPTAANQTSSRSHAVLQVVVRQQSRCRDILQEVRFARLFMIDLAGSERASQTQNRGQRLKEGAHINRSLLALGNCINALSEKNGNKYVNYRDSKLTRLLKDSLGGNSRTVMIAHISPASLAFEDSRNTLTYADRAKSIRTRVKRNLLNVSYHIAQYTSIISDLRSEIQRLKKKIADQASRQINPDRTDIRHVQAEVQAHSSQQSRAEMDQLREQLIDAFRQQMDIRKRLMELDNSNMEIQIDTSKHLLTIADWEQERFRRRKKWQGERRKESFNKD-ESEKDSDSPESLPDSTETQEVAIARENLVTLMAEQKKIQKQKAGLEQRLAELREKARRLEELLPRRVSSEEQREVLCLLCKVHELEIENAEMQSSALLKDNVIRQKNVVVQRFEQHRHLCHEIIQQQRQFIDDHSLLVPPHLQELYEMYMKE 597          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif19 (kinesin family member 19 [Source:ZFIN;Acc:ZDB-GENE-080215-2])

HSP 1 Score: 405.216 bits (1040), Expect = 1.823e-125
Identity = 222/524 (42.37%), Postives = 333/524 (63.55%), Query Frame = 3
Query:  462 MLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNG-VQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKL---DSMQTSGD--------PEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAER----ISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            MLG +  PGI  + L  +FK +    DD  + +S+SYLE+YNEMIRDLL  +S  LDLRED  G +QVAG+TE+      E+M+LL +GN  RT E T AN+ SSRSHAVLQV V  +SR R+  +++   +LF+IDLAGSERAS T NRG+R+ EGAHINRSLLALGNCINAL++ NG +YVNYRDSKLTRLLKD+LGGN RTVMIAHI P++L FEDSRNTL YADRAK IRT++ +N+ +V++H+ QY ++IS+L+ EI RL+ K+    S Q + D         E     S   + E  ++++ L+ AF++ +  +K L E   S+ ++ ++ ++  + I +WE ++  R      ER  +S +K+ E E+ +     L   +E++ V   R  L     E+ +++ Q+  LEQ L +   + + LE  +P +V +   R++L LLC++H+LEI+  ++++  ++      + +++     +H  LC  II  Q   I D+ + +P  L+ LY++Y ++
Sbjct:    1 MLGTDREPGIYVRTLNDLFKAIEETSDDMQYSVSMSYLEIYNEMIRDLLNPSSGFLDLREDSKGEIQVAGITEVSTINAREIMELLMKGNKQRTQEPTAANQTSSRSHAVLQVVVRQQSRCRDILQEVRFARLFMIDLAGSERASQTQNRGQRLKEGAHINRSLLALGNCINALSEKNGNKYVNYRDSKLTRLLKDSLGGNSRTVMIAHISPASLAFEDSRNTLTYADRAKSIRTRVKRNLLNVSYHIAQYTSIISDLRSEIQRLKKKIADQASRQINPDRTDIRHVQAEVQAHSSQQSRAEMDQLREQLIDAFRQQMDIRKRLMELDNSNMEIQIDTSKHLLTIADWEQERFRRRKKWQGERRKESFNKD-ESEKDSDSPESLPDSTETQEVAIARENLVTLMAEQKKIQKQKAGLEQRLAELREKARRLEELLPRRVSSEEQREVLCLLCKVHELEIENAEMQSSALLKDNVIRQKNVVVQRFEQHRHLCHEIIQQQRQFIDDHSLLVPPHLQELYEMYMKE 523          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif18a (kinesin family member 18A [Source:ZFIN;Acc:ZDB-GENE-040426-862])

HSP 1 Score: 297.745 bits (761), Expect = 6.920e-86
Identity = 176/387 (45.48%), Postives = 248/387 (64.08%), Query Frame = 3
Query:  138 GSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXX---------XXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKL 1265
            G    ++ V +R+RP+N+ E +     + H +D +M V     E+             +R   +++  FVFD VF    SQ EVF+ +T  ++  VL+GY  TVFAYGATG GKT+TMLG +  PG+MF  ++ +F +M ++++D +F ++ SYLEVYNE IRDLL +NS  L +RED  NGV V GLT  +  +   +++ L+ GN  RT   T  N  SSRSHAV Q+ +  + +  +    +   K+ LIDLAGSERAS T  +G R+ EGA+INRSLLALGN IN LA+P  K+ ++ YRDSKLTRLLKD+LGGNCRTVMIA++ PS+L +ED+ NTL YA+RAK I++ +  NV  ++ H+ QY  +  + K EI  L+ KL
Sbjct:    4 GEVCSHVKVVVRVRPLNDKEKDGNFKKVVHVVDNHMLVFDPKEEEVTFFRGQRVGNRDVRKRANKDLKFVFDSVFGEESSQIEVFENTTKAIVDGVLNGYNCTVFAYGATGAGKTHTMLGTSNSPGVMFLTMKELFARMDLIKEDKVFNVAFSYLEVYNEQIRDLL-TNSGPLAVREDGSNGVVVQGLTLHQPKSAEHILEALDYGNRNRTQHPTDMNATSSRSHAVFQIYLRQQDKTASLNPNVRVAKMSLIDLAGSERASATNTKGARLREGANINRSLLALGNVINTLANPKCKKTHIPYRDSKLTRLLKDSLGGNCRTVMIANVSPSSLSYEDTHNTLKYANRAKEIKSTLRSNVMSLDSHIGQYAIICEKQKAEIVMLKQKL 389          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif18a (kinesin family member 18A [Source:ZFIN;Acc:ZDB-GENE-040426-862])

HSP 1 Score: 297.745 bits (761), Expect = 6.920e-86
Identity = 176/387 (45.48%), Postives = 248/387 (64.08%), Query Frame = 3
Query:  138 GSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXX---------XXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKL 1265
            G    ++ V +R+RP+N+ E +     + H +D +M V     E+             +R   +++  FVFD VF    SQ EVF+ +T  ++  VL+GY  TVFAYGATG GKT+TMLG +  PG+MF  ++ +F +M ++++D +F ++ SYLEVYNE IRDLL +NS  L +RED  NGV V GLT  +  +   +++ L+ GN  RT   T  N  SSRSHAV Q+ +  + +  +    +   K+ LIDLAGSERAS T  +G R+ EGA+INRSLLALGN IN LA+P  K+ ++ YRDSKLTRLLKD+LGGNCRTVMIA++ PS+L +ED+ NTL YA+RAK I++ +  NV  ++ H+ QY  +  + K EI  L+ KL
Sbjct:    4 GEVCSHVKVVVRVRPLNDKEKDGNFKKVVHVVDNHMLVFDPKEEEVTFFRGQRVGNRDVRKRANKDLKFVFDSVFGEESSQIEVFENTTKAIVDGVLNGYNCTVFAYGATGAGKTHTMLGTSNSPGVMFLTMKELFARMDLIKEDKVFNVAFSYLEVYNEQIRDLL-TNSGPLAVREDGSNGVVVQGLTLHQPKSAEHILEALDYGNRNRTQHPTDMNATSSRSHAVFQIYLRQQDKTASLNPNVRVAKMSLIDLAGSERASATNTKGARLREGANINRSLLALGNVINTLANPKCKKTHIPYRDSKLTRLLKDSLGGNCRTVMIANVSPSSLSYEDTHNTLKYANRAKEIKSTLRSNVMSLDSHIGQYAIICEKQKAEIVMLKQKL 389          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: asah1 (N-acylsphingosine amidohydrolase (acid ceramidase) 1 [Source:Xenbase;Acc:XB-GENE-494421])

HSP 1 Score: 489.189 bits (1258), Expect = 6.593e-156
Identity = 289/640 (45.16%), Postives = 426/640 (66.56%), Query Frame = 3
Query:  126 KNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGV-QVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLD-----SMQTSGDPEENITLSMS------DQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEI---EDEEKNYXXXXXXXX-XXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVV----LRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            K+   S +Q L V LRIRP+NE E   G  IIAH +D  M VL+DP+EDPDD+LRANRSRE+ ++FD  F+ + +Q+ V++L+T  LI  V+ GY ATVFAYG TG GKTYTMLG +  PGI  + L  +FK +    DD  +++ +SY+E+YNEMIRDLL  +   LDLRED  GV QVAG+TE+      E+M LL +GN  RT E T ANK SSRSHA+LQV V  +SRV+N  +++  G+LF+IDLAGSERAS T NRG+RM EGAHINRSLLALGNCINAL++  G +YVNYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YADRAK+I+T++ +N+ +V++H+ QY ++IS+L++EI RL+ K+D      +++      NI   +        + E  ++K+ L+ AF++ +  ++ L E   S  ++ +E +R  +II +WE +KA R  + +++ L KE    +D EK+ +    +    E   V + R  +++ + ++ +L+ Q+ +LE+       + + LE A+P+++ +   R++L LLC++H+LEI+ T++++  ++    +RQ   K+ ++Q    +H  LC  II  Q  +I D+ + +P  LE LY+LY R+
Sbjct:    2 KDGGESKEQQLTVALRIRPINEAELGEGATIIAHKVDEQMVVLMDPMEDPDDVLRANRSREKSYMFDVAFDYTATQDTVYRLTTKGLIEGVISGYNATVFAYGPTGCGKTYTMLGTDWEPGIYIRTLNDLFKAIEETSDDMEYEVLMSYMEIYNEMIRDLLNPSLGYLDLREDSKGVIQVAGITEVSTINAKEIMQLLMKGNKQRTQEPTAANKTSSRSHAILQVTVRQKSRVKNITQEVRVGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSERGGNKYVNYRDSKLTRLLKDSLGGNSRTVMIAHISPASTSFEESRNTLTYADRAKNIKTRVKRNLLNVSYHIAQYTSIISDLRKEIQRLKEKIDEQGLKQLRSEKSDIRNIQAEVQLHSSPYGRHEMEQLKEQLIRAFREQMDIRRQLMEIENSSMEMQMETSRHFLIIADWEQEKARRARKWKDE-LRKETYGKDDSEKDSDTGDEQSDFIEPPEVTTARETIQILEGDQSKLRRQKLELEKRFRDIRQRARRLEEALPKRISSEDQREILSLLCKVHELEIENTEMQSHALLKDNMIRQ---KNHMVQR-FEQHRSLCDEIIKQQRRIIYDHNLTVPHQLEDLYELYFRE 636          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: asah1 (N-acylsphingosine amidohydrolase (acid ceramidase) 1 [Source:Xenbase;Acc:XB-GENE-494421])

HSP 1 Score: 480.715 bits (1236), Expect = 4.092e-154
Identity = 285/631 (45.17%), Postives = 420/631 (66.56%), Query Frame = 3
Query:  153 NLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGV-QVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLD-----SMQTSGDPEENITLSMS------DQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEI---EDEEKNYXXXXXXXXXXX-XNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVV----LRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
             L V LRIRP+NE E   G  IIAH +D  M VL+DP+EDPDD+LRANRSRE+ ++FD  F+ + +Q+ V++L+T  LI  V+ GY ATVFAYG TG GKTYTMLG +  PGI  + L  +FK +    DD  +++ +SY+E+YNEMIRDLL  +   LDLRED  GV QVAG+TE+      E+M LL +GN  RT E T ANK SSRSHA+LQV V  +SRV+N  +++  G+LF+IDLAGSERAS T NRG+RM EGAHINRSLLALGNCINAL++  G +YVNYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YADRAK+I+T++ +N+ +V++H+ QY ++IS+L++EI RL+ K+D      +++      NI   +        + E  ++K+ L+ AF++ +  ++ L E   S  ++ +E +R  +II +WE +KA R  + +++ L KE    +D EK+ +    +        V + R  +++ + ++ +L+ Q+ +LE+       + + LE A+P+++ +   R++L LLC++H+LEI+ T++++  ++    +RQ   K+ ++Q    +H  LC  II  Q  +I D+ + +P  LE LY+LY R+
Sbjct:    7 GLSVALRIRPINEAELGEGATIIAHKVDEQMVVLMDPMEDPDDVLRANRSREKSYMFDVAFDYTATQDTVYRLTTKGLIEGVISGYNATVFAYGPTGCGKTYTMLGTDWEPGIYIRTLNDLFKAIEETSDDMEYEVLMSYMEIYNEMIRDLLNPSLGYLDLREDSKGVIQVAGITEVSTINAKEIMQLLMKGNKQRTQEPTAANKTSSRSHAILQVTVRQKSRVKNITQEVRVGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSERGGNKYVNYRDSKLTRLLKDSLGGNSRTVMIAHISPASTSFEESRNTLTYADRAKNIKTRVKRNLLNVSYHIAQYTSIISDLRKEIQRLKEKIDEQGLKQLRSEKSDIRNIQAEVQLHSSPYGRHEMEQLKEQLIRAFREQMDIRRQLMEIENSSMEMQMETSRHFLIIADWEQEKARRARKWKDE-LRKETYGKDDSEKDSDTGDEQSDFIEPPEVTTARETIQILEGDQSKLRRQKLELEKRFRDIRQRARRLEEALPKRISSEDQREILSLLCKVHELEIENTEMQSHALLKDNMIRQ---KNHMVQR-FEQHRSLCDEIIKQQRRIIYDHNLTVPHQLEDLYELYFRE 632          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: asah1 (N-acylsphingosine amidohydrolase (acid ceramidase) 1 [Source:Xenbase;Acc:XB-GENE-494421])

HSP 1 Score: 480.33 bits (1235), Expect = 6.400e-154
Identity = 285/631 (45.17%), Postives = 418/631 (66.24%), Query Frame = 3
Query:  153 NLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGV-QVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLD-----SMQTSGDPEENITLSMS------DQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEI---EDEEKNYXXXXXXXXXXX-XNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVV----LRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
             L V LRIRP+NE E   G  IIAH +D  M VL+DP+EDPDD+LRANRSRE+ ++FD  F+ + +Q+ V++L+T  LI  V+ GY ATVFAYG TG GKTYTMLG +  PGI  + L  +FK +    DD  +++ +SY+E+YNEMIRDLL  +   LDLRED  GV QVAG+TE+      E+M LL +GN  RT E T ANK SSRSHA+LQV V  +SRV+N  +++  G+LF+IDLAGSERAS T NRG+RM EGAHINRSLLALGNCINAL++  G +YVNYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YADRAK+I+T++ +N+ +V++H+ QY ++IS+L++EI RL+ K+D      +++      NI   +        + E  ++K+ L+ AF++ +  ++ L E   S  ++ +E +R  +II +WE +KA R + +    L KE    +D EK+ +    +        V + R  +++ + ++ +L+ Q+ +LE+       + + LE A+P+++ +   R++L LLC++H+LEI+ T++++  ++    +RQ   K+ ++Q    +H  LC  II  Q  +I D+ + +P  LE LY+LY R+
Sbjct:    7 GLSVALRIRPINEAELGEGATIIAHKVDEQMVVLMDPMEDPDDVLRANRSREKSYMFDVAFDYTATQDTVYRLTTKGLIEGVISGYNATVFAYGPTGCGKTYTMLGTDWEPGIYIRTLNDLFKAIEETSDDMEYEVLMSYMEIYNEMIRDLLNPSLGYLDLREDSKGVIQVAGITEVSTINAKEIMQLLMKGNKQRTQEPTAANKTSSRSHAILQVTVRQKSRVKNITQEVRVGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSERGGNKYVNYRDSKLTRLLKDSLGGNSRTVMIAHISPASTSFEESRNTLTYADRAKNIKTRVKRNLLNVSYHIAQYTSIISDLRKEIQRLKEKIDEQGLKQLRSEKSDIRNIQAEVQLHSSPYGRHEMEQLKEQLIRAFREQMDIRRQLMEIENSSMEMQMETSRHFLIIADWEQEKARR-ARKWKDELRKETYGKDDSEKDSDTGDEQSDFIEPPEVTTARETIQILEGDQSKLRRQKLELEKRFRDIRQRARRLEEALPKRISSEDQREILSLLCKVHELEIENTEMQSHALLKDNMIRQ---KNHMVQR-FEQHRSLCDEIIKQQRRIIYDHNLTVPHQLEDLYELYFRE 632          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: asah1 (N-acylsphingosine amidohydrolase (acid ceramidase) 1 [Source:Xenbase;Acc:XB-GENE-494421])

HSP 1 Score: 444.891 bits (1143), Expect = 1.466e-139
Identity = 267/640 (41.72%), Postives = 397/640 (62.03%), Query Frame = 3
Query:  126 KNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGV-QVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLD-----SMQTSGDPEENITLSMS------DQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEI---EDEEKNYXXXXXXXX-XXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVV----LRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            K+   S +Q L V LRIRP+NE E   G  IIAH +D  M VL+DP+EDPDD+LRANRSRE+ ++FD  F+                       YTAT                    +PGI  + L  +FK +    DD  +++ +SY+E+YNEMIRDLL  +   LDLRED  GV QVAG+TE+      E+M LL +GN  RT E T ANK SSRSHA+LQV V  +SRV+N  +++  G+LF+IDLAGSERAS T NRG+RM EGAHINRSLLALGNCINAL++  G +YVNYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YADRAK+I+T++ +N+ +V++H+ QY ++IS+L++EI RL+ K+D      +++      NI   +        + E  ++K+ L+ AF++ +  ++ L E   S  ++ +E +R  +II +WE +KA R  + +++ L KE    +D EK+ +    +    E   V + R  +++ + ++ +L+ Q+ +LE+       + + LE A+P+++ +   R++L LLC++H+LEI+ T++++  ++    +RQ   K+ ++Q    +H  LC  II  Q  +I D+ + +P  LE LY+LY R+
Sbjct:    2 KDGGESKEQQLTVALRIRPINEAELGEGATIIAHKVDEQMVVLMDPMEDPDDVLRANRSREKSYMFDVAFD-----------------------YTAT--------------------QPGIYIRTLNDLFKAIEETSDDMEYEVLMSYMEIYNEMIRDLLNPSLGYLDLREDSKGVIQVAGITEVSTINAKEIMQLLMKGNKQRTQEPTAANKTSSRSHAILQVTVRQKSRVKNITQEVRVGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSERGGNKYVNYRDSKLTRLLKDSLGGNSRTVMIAHISPASTSFEESRNTLTYADRAKNIKTRVKRNLLNVSYHIAQYTSIISDLRKEIQRLKEKIDEQGLKQLRSEKSDIRNIQAEVQLHSSPYGRHEMEQLKEQLIRAFREQMDIRRQLMEIENSSMEMQMETSRHFLIIADWEQEKARRARKWKDE-LRKETYGKDDSEKDSDTGDEQSDFIEPPEVTTARETIQILEGDQSKLRRQKLELEKRFRDIRQRARRLEEALPKRISSEDQREILSLLCKVHELEIENTEMQSHALLKDNMIRQ---KNHMVQR-FEQHRSLCDEIIKQQRRIIYDHNLTVPHQLEDLYELYFRE 593          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: asah1 (N-acylsphingosine amidohydrolase (acid ceramidase) 1 [Source:Xenbase;Acc:XB-GENE-494421])

HSP 1 Score: 404.06 bits (1037), Expect = 3.450e-124
Identity = 260/640 (40.62%), Postives = 390/640 (60.94%), Query Frame = 3
Query:  126 KNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGV-QVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLD-----SMQTSGDPEENITLSMS------DQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEI---EDEEKNYXXXXXXXX-XXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVV----LRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            K+   S +Q L V LRIRP+NE E   G  IIAH +D  M VL+DP+EDPDD+LRANRSRE+ ++FD  F+ + +Q+ V++L+T  LI  V+ GY ATVFAYG TG GKTYTMLG +  PGI  + L  +FK +    DD  +++ +SY+E+YNEMIRDLL  +   LDLRED  GV QVAG+TE+      E+M LL +GN  RT E T ANK SSRSHA+LQV V  +SRV+N  +++  G+LF+IDLAGSERAS T NRG+RM EGAHINRSLLALGNCINAL++  G +YVNYRDSKLTRLL                                         K+ +N+ +V++H+ QY ++IS+L++EI RL+ K+D      +++      NI   +        + E  ++K+ L+ AF++ +  ++ L E   S  ++ +E +R  +II +WE +KA R  + +++ L KE    +D EK+ +    +    E   V + R  +++ + ++ +L+ Q+ +LE+       + + LE A+P+++ +   R++L LLC++H+LEI+ T++++  ++    +RQ   K+ ++Q    +H  LC  II  Q  +I D+ + +P  LE LY+LY R+
Sbjct:    2 KDGGESKEQQLTVALRIRPINEAELGEGATIIAHKVDEQMVVLMDPMEDPDDVLRANRSREKSYMFDVAFDYTATQDTVYRLTTKGLIEGVISGYNATVFAYGPTGCGKTYTMLGTDWEPGIYIRTLNDLFKAIEETSDDMEYEVLMSYMEIYNEMIRDLLNPSLGYLDLREDSKGVIQVAGITEVSTINAKEIMQLLMKGNKQRTQEPTAANKTSSRSHAILQVTVRQKSRVKNITQEVRVGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSERGGNKYVNYRDSKLTRLL-----------------------------------------KVKRNLLNVSYHIAQYTSIISDLRKEIQRLKEKIDEQGLKQLRSEKSDIRNIQAEVQLHSSPYGRHEMEQLKEQLIRAFREQMDIRRQLMEIENSSMEMQMETSRHFLIIADWEQEKARRARKWKDE-LRKETYGKDDSEKDSDTGDEQSDFIEPPEVTTARETIQILEGDQSKLRRQKLELEKRFRDIRQRARRLEEALPKRISSEDQREILSLLCKVHELEIENTEMQSHALLKDNMIRQ---KNHMVQR-FEQHRSLCDEIIKQQRRIIYDHNLTVPHQLEDLYELYFRE 595          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif19a (kinesin family member 19A [Source:MGI Symbol;Acc:MGI:2447024])

HSP 1 Score: 481.871 bits (1239), Expect = 2.763e-153
Identity = 285/641 (44.46%), Postives = 411/641 (64.12%), Query Frame = 3
Query:  126 KNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGV-QVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSG--------------DPEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERI----SERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSV--LLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            K++  S DQ LMV LR+RP++  E   G  +IAH MD  M VL+DP+EDPDDILRA+RSRE+ ++FD  F+ + +QE V++ +T  LI  V+ GY ATVFAYG TG GKTYTMLG +  PGI  + L  +F+ +    +D  +++S+SYLE+YNEMIRDLL      L+LRED  GV QVAG+TE+      E+M LL +GN  RT E T AN+ SSRSHAVLQV V  RSRV+N  +++ +G+LF+IDLAGSERAS T NRG+RM EGAHINRSLLALGNCINAL+D    +Y+NYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YA RAK+IRT++ +N+ +V++H+ QY ++I++L+ EI RL+ K+D     G                E  +        E  ++++ L+ AF + +  ++ L E      ++ ++ +R  + I  WE +K+ R      ER  +S  K  ED EK+ +        E   V S R  +     E+ +L+ ++  LEQ   +   + + LE  +P ++ +   R++L LLC++H+LE++ T++++ + +LR  A +H   ++V  L +H  LC  II  Q  +I DY +++P+ LE LY++Y R+
Sbjct:    2 KDSGDSKDQQLMVALRVRPISVAELEEGATLIAHKMDEQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFTATQEMVYQATTKSLIEGVISGYNATVFAYGPTGCGKTYTMLGTDHEPGIYVRTLNDLFRAIEETSNDMEYEVSMSYLEIYNEMIRDLLNPALGYLELREDSKGVIQVAGITEVSTINAKEIMQLLMKGNRQRTQEPTAANQTSSRSHAVLQVAVRQRSRVKNILQEVRQGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSDKGSNKYINYRDSKLTRLLKDSLGGNSRTVMIAHISPASTAFEESRNTLTYAGRAKNIRTRVKQNLLNVSYHIAQYTSIIADLRGEIQRLKCKIDQQAGRGQARGKLDRGDIRHIQAEVQLHSGQEGPAEMGQLREQLISAFHEQMDVRRRLLELENQAMEVQIDTSRHLLTIAGWEHEKSRRALKWREERRKESYTK--EDSEKDSDTGDEPDNLEPPEVASARENIAALVGEQKKLRKEKLALEQRCRELRARGRRLEETLPRRIGSEEQREVLSLLCRVHELEVENTEMQS-HALLRDSALRHRR-EAVRRLEQHRSLCDEIIQGQRQIIDDYNLEVPRHLEELYEVYLRE 638          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Gm4869 (predicted gene 4869 [Source:MGI Symbol;Acc:MGI:3646257])

HSP 1 Score: 459.914 bits (1182), Expect = 4.478e-145
Identity = 270/635 (42.52%), Postives = 400/635 (62.99%), Query Frame = 3
Query:  147 DQNLM----------VCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNG-VQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR--YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSM--QTSGDPEE-NITLSMSDQIEE------MKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            DQ LM          V LRIRP+N  E   G  +IAH +   + VL+DP EDP+D LRA+RSRER F+FD VF+   SQE V+  +   L+  V+ GY  T+FAYG +G GKT+TMLG++  PGI  + L  +F+ +   +D+  + +S+SYLE+YNE+IRDLL  +S  L+LRED  G +Q+AG+TE+  +   E+M LL +GN  RT E T  NK SSRSHAVLQV V  RSR  +  E++  G+LF++DLAGSERA+ T NRGKRM EGAHINRSLLALGNCINAL++  G R  YVN+RDSKLTRLLKDALGGN RTVMIAHI P++  FE+SR TL+YA RAK+I+T++ +N+ +V++ + QY +VIS+L++EI  L++K++    +   DP   +I +++    EE       +I+  L+ AF++ +  ++ L E   ++ +L ++ +R  + I +WE +K  +  + ++   DKE  D +           SE   V   R E+ +   E+ +    +  LEQ L     +   +E  +P +V +   R++LQLLC+ H+LE++ T+L+ +N+  +    + D +     +H  LC+++I  Q  L++D G+  P+ LE  Y LY+R+
Sbjct:   25 DQQLMLRVLVLPCPQVALRIRPLNSTELEEGATVIAHKVGDQVVVLMDPGEDPEDTLRAHRSRERTFIFDTVFDQHASQETVYCATIQHLVEGVISGYNTTIFAYGPSGAGKTHTMLGVDAEPGIYLQTLTDLFQAIEETQDNMEYSVSMSYLEIYNEVIRDLLNPSSGFLELREDSRGSIQIAGITEVSTSNAQEIMQLLTKGNRQRTQEPTATNKTSSRSHAVLQVTVHQRSRGGDLAEEVRLGRLFMVDLAGSERAAQTQNRGKRMKEGAHINRSLLALGNCINALSEKGGSRAQYVNFRDSKLTRLLKDALGGNSRTVMIAHISPASTSFEESRTTLLYAYRAKNIKTRVKRNLLNVSYRIAQYTDVISDLRREIGHLKSKIEKQDKEKKSDPGVLDIQVTIPHDAEEDSRLQMNRIRAQLIGAFKEQMEMRRSLVELENTNIELHIDMSRHLLTIADWEREKTHQHVDVDSGERDKEPVDADGE-----EVGASEPPEVALAREEVNLLLAEQQKTAALKAGLEQRLAHAKQKASQMEKLLPRQVTSEEQREVLQLLCRAHELEVENTELQADNLFRKNLLCQKDFVIQRYHQHRLLCEQVIQGQRQLMQDNGISAPEPLEQQYRLYSRE 654          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif19a (kinesin family member 19A [Source:MGI Symbol;Acc:MGI:2447024])

HSP 1 Score: 422.55 bits (1085), Expect = 4.075e-134
Identity = 267/642 (41.59%), Postives = 390/642 (60.75%), Query Frame = 3
Query:  126 KNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEENITLSMSD----QIE-----------EM-KIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERI----SERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSV--LLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            K++  S DQ LMV LR+RP++  E   G  +IAH MD  M VL+DP+EDPDDILRA+RSRE+ ++FD  F+ + +QE V++ +T  LI  V+ GY ATVFAYG TG GKTYTMLG +  PGI  + L  +F+ +    +D  +++S+SYLE+                                         M LL +GN  RT E T AN+ SSRSHAVLQV V  RSRV+N  +++ +G+LF+IDLAGSERAS T NRG+RM EGAHINRSLLALGNCINAL+D    +Y+NYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YA RAK+IRT++ +N+ +V++H+ QY ++I++L+ EI RL+ K+D  Q +G  +    L   D    Q E           EM ++++ L+ AF + +  ++ L E      ++ ++ +R  + I  WE +K+ R      ER  +S  K  ED EK+ +        E   V S R  +     E+ +L+ ++  LEQ   +   + + LE  +P ++ +   R++L LLC++H+LE++ T++++ + +LR  A +H   ++V  L +H  LC  II  Q  +I DY +++P+ LE LY++Y R+
Sbjct:    2 KDSGDSKDQQLMVALRVRPISVAELEEGATLIAHKMDEQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFTATQEMVYQATTKSLIEGVISGYNATVFAYGPTGCGKTYTMLGTDHEPGIYVRTLNDLFRAIEETSNDMEYEVSMSYLEI-----------------------------------------MQLLMKGNRQRTQEPTAANQTSSRSHAVLQVAVRQRSRVKNILQEVRQGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSDKGSNKYINYRDSKLTRLLKDSLGGNSRTVMIAHISPASTAFEESRNTLTYAGRAKNIRTRVKQNLLNVSYHIAQYTSIIADLRGEIQRLKCKID--QQAGRGQARGKLDRGDIRHIQAEVQLHSGQEGPAEMGQLREQLISAFHEQMDVRRRLLELENQAMEVQIDTSRHLLTIAGWEHEKSRRALKWREERRKESYTK--EDSEKDSDTGDEPDNLEPPEVASARENIAALVGEQKKLRKEKLALEQRCRELRARGRRLEETLPRRIGSEEQREVLSLLCRVHELEVENTEMQS-HALLRDSALRHRR-EAVRRLEQHRSLCDEIIQGQRQIIDDYNLEVPRHLEELYEVYLRE 596          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif18b (kinesin family member 18B [Source:MGI Symbol;Acc:MGI:2446979])

HSP 1 Score: 284.263 bits (726), Expect = 1.519e-81
Identity = 159/319 (49.84%), Postives = 216/319 (67.71%), Query Frame = 3
Query:  315 FVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKL 1265
            FVFD VF    +QE+VF+ +T  ++   L GY  +VFAYGATG GKT+TMLG    PGIM+     +++++   +++  F++ +SYLEVYNE I DLL      L +RED + GV V GL+  +  +  +++++L RGN  RT   T AN  SSRSHA+ Q+ V  + RV    + +   K+ LIDLAGSERAS+T  +G+R+ EGA+INRSLLAL N +NALAD  G++ +V YRDSKLTRLLKD++GGNCRTVMIA I PS+L +ED+ NTL YADRAK IR  +  NV  V+ H+ QY  +  +L+ E+  LR KL
Sbjct:   72 FVFDRVFGEMATQEDVFQHTTHNILDSFLQGYNCSVFAYGATGAGKTHTMLGREGEPGIMYLTTMELYRRLEARQEEKQFEVLISYLEVYNEQIHDLLEPKGP-LTIREDPDKGVVVPGLSFHQPASAEQLLEMLTRGNCSRTQHPTDANATSSRSHAIFQIFVKQQDRVPGLTQALRVAKMSLIDLAGSERASSTHAKGERLREGANINRSLLALINVLNALADAKGRKSHVPYRDSKLTRLLKDSIGGNCRTVMIAAISPSSLTYEDTYNTLKYADRAKEIRLTLKSNVISVDHHISQYATICQQLQAEVAFLREKL 389          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif18a (kinesin family member 18A [Source:MGI Symbol;Acc:MGI:2446977])

HSP 1 Score: 273.092 bits (697), Expect = 3.992e-77
Identity = 167/387 (43.15%), Postives = 244/387 (63.05%), Query Frame = 3
Query:  156 LMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRAN---------RSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR---YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQ 1277
            + V +R+RP N  E  +    + H +D ++       E+     R           ++++  FVFD VF+ + +Q EVF+ +T P++   L+GY  TVFAYGATG+GKT+TMLG    PG+M+  +  +FK +  ++++     ++SYLEVYNE IRDLL +NS  L +RED Q GV V GLT  +  ++ E++ LL+ GN  RT   T  N  SSRSHAV Q+ +  + +  +  + +   K+ LIDLAGSERAS +  +G R  EG +IN+SLLALGN INALA  N KR   ++ YR+SKLTRLLKD+LGGNC+T+MIA + PS+L ++D+ NTL YA+RAK I++ +  NV ++N H+ QY  + +  K EI  L+ KL + +
Sbjct:   12 MKVVVRVRPENTKEKAVQFCKVVHVVDKHILSFDPKQEEISFFHRKKTTNFDITKRQNKDLKFVFDAVFDETSTQMEVFEHTTKPILHSFLNGYNCTVFAYGATGSGKTHTMLGSAAEPGVMYLTMLDLFKCIDEIKEEKECSTAVSYLEVYNEQIRDLL-TNSGPLAVREDSQKGVVVQGLTLHQPKSSEEILQLLDNGNKNRTQHPTDVNAVSSRSHAVFQIYLRQQDKTASINQNVRIAKMSLIDLAGSERASVSGAKGSRFVEGTNINKSLLALGNVINALA--NTKRRNQHIPYRNSKLTRLLKDSLGGNCQTIMIAAVSPSSLFYDDTYNTLKYANRAKEIKSSLKSNVLNLNSHISQYVKICNMQKAEILMLKEKLKAYE 395          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q99PT9|KIF19_MOUSE (Kinesin-like protein KIF19 OS=Mus musculus OX=10090 GN=Kif19 PE=1 SV=2)

HSP 1 Score: 481.871 bits (1239), Expect = 1.933e-152
Identity = 285/641 (44.46%), Postives = 411/641 (64.12%), Query Frame = 3
Query:  126 KNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGV-QVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSG--------------DPEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERI----SERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSV--LLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            K++  S DQ LMV LR+RP++  E   G  +IAH MD  M VL+DP+EDPDDILRA+RSRE+ ++FD  F+ + +QE V++ +T  LI  V+ GY ATVFAYG TG GKTYTMLG +  PGI  + L  +F+ +    +D  +++S+SYLE+YNEMIRDLL      L+LRED  GV QVAG+TE+      E+M LL +GN  RT E T AN+ SSRSHAVLQV V  RSRV+N  +++ +G+LF+IDLAGSERAS T NRG+RM EGAHINRSLLALGNCINAL+D    +Y+NYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YA RAK+IRT++ +N+ +V++H+ QY ++I++L+ EI RL+ K+D     G                E  +        E  ++++ L+ AF + +  ++ L E      ++ ++ +R  + I  WE +K+ R      ER  +S  K  ED EK+ +        E   V S R  +     E+ +L+ ++  LEQ   +   + + LE  +P ++ +   R++L LLC++H+LE++ T++++ + +LR  A +H   ++V  L +H  LC  II  Q  +I DY +++P+ LE LY++Y R+
Sbjct:    2 KDSGDSKDQQLMVALRVRPISVAELEEGATLIAHKMDEQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFTATQEMVYQATTKSLIEGVISGYNATVFAYGPTGCGKTYTMLGTDHEPGIYVRTLNDLFRAIEETSNDMEYEVSMSYLEIYNEMIRDLLNPALGYLELREDSKGVIQVAGITEVSTINAKEIMQLLMKGNRQRTQEPTAANQTSSRSHAVLQVAVRQRSRVKNILQEVRQGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSDKGSNKYINYRDSKLTRLLKDSLGGNSRTVMIAHISPASTAFEESRNTLTYAGRAKNIRTRVKQNLLNVSYHIAQYTSIIADLRGEIQRLKCKIDQQAGRGQARGKLDRGDIRHIQAEVQLHSGQEGPAEMGQLREQLISAFHEQMDVRRRLLELENQAMEVQIDTSRHLLTIAGWEHEKSRRALKWREERRKESYTK--EDSEKDSDTGDEPDNLEPPEVASARENIAALVGEQKKLRKEKLALEQRCRELRARGRRLEETLPRRIGSEEQREVLSLLCRVHELEVENTEMQS-HALLRDSALRHRR-EAVRRLEQHRSLCDEIIQGQRQIIDDYNLEVPRHLEELYEVYLRE 638          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q7ZXX2|KIF19_XENLA (Kinesin-like protein KIF19 OS=Xenopus laevis OX=8355 GN=kif19 PE=2 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 8.376e-151
Identity = 278/643 (43.23%), Postives = 408/643 (63.45%), Query Frame = 3
Query:  126 KNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGV-QVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSG-----------DPEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISE-----------RENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            K+   S +Q L V LRIRP+NE E   G  IIAH +D  M VL+DP+ED DDILRANRSRE+ ++FD  F+ + +Q+ V++ +T  LI  V+ GY ATVFAYG TG GKTYTMLG +  PGI  + L  +FK +    DD  +++ +SY+E+YNEMIRDLL  +   LDLRED  GV QVAG+TE+      E+M LL +GN  RT E T ANK SSRSHA+LQV V  +SRV+N  +++  G+LF+IDLAGSERAS T NRG RM EGAHINRSLLALGNCINAL++    +YVNYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YADRAK+I+T++ +N+ +V++H+ QY ++IS+L++EI RL+ K+D                   E  +  S   + E  ++K+ L+ AF++ +  ++ L E   S  ++ +E +R  +I  EWE +K  R  +           +++   D +  D++ ++         E   V + R  +++ + ++ +L+ Q+ +LE+         + LE A+P+++ ++  R++L LLC++H+LEI+ T++++  ++      + D +     +H  LC  II  Q  +I D+ + +P  L  LY+LY R+
Sbjct:    2 KDGGESKEQQLTVALRIRPINETELAEGATIIAHKVDKQMVVLMDPMEDSDDILRANRSREKSYMFDVAFDYTATQDTVYRFTTKGLIEGVISGYNATVFAYGPTGCGKTYTMLGTDWEPGIYIRTLNDLFKAIEETSDDMEYEVLMSYMEIYNEMIRDLLNPSLGYLDLREDSKGVIQVAGITEVSTINAKEIMQLLMKGNRQRTQEPTAANKTSSRSHAILQVTVRQKSRVKNITQEVRVGRLFMIDLAGSERASQTQNRGLRMKEGAHINRSLLALGNCINALSERGSNKYVNYRDSKLTRLLKDSLGGNSRTVMIAHISPASTSFEESRNTLTYADRAKNIKTRVKRNLLNVSYHIAQYTSIISDLRKEIQRLKKKIDEQGLKQIRSEKSDIRNIQAEVQLHSSTYGRHEMEQLKEQLIRAFREQMDIRRQLMEIENSSMEMQMETSRHFLITAEWEQEKTRRARKWRDEHRKETYGKDDSEKDSDTGDDQSDF--------IEPPEVITARETIQILEGDQNKLRRQKLELEKRFRDVRHHARRLEEALPKRISSDDQREILSLLCKVHELEIENTEMQSHALLKDNMIRQKDYMVQRFEQHRSLCDEIIQQQRRIIYDHNLTVPHQLNDLYELYFRE 636          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q2TAC6|KIF19_HUMAN (Kinesin-like protein KIF19 OS=Homo sapiens OX=9606 GN=KIF19 PE=2 SV=2)

HSP 1 Score: 470.315 bits (1209), Expect = 5.248e-148
Identity = 278/640 (43.44%), Postives = 414/640 (64.69%), Query Frame = 3
Query:  126 KNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGV-QVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLD---------SMQTSGD-----PEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEW---ESKKAERISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHA--SKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            K++  S DQ LMV LR+RP++  E   G  +IAH +D  M VL+DP+EDPDDILRA+RSRE+ ++FD  F+ + +QE V++ +T  LI  V+ GY ATVFAYG TG GKTYTMLG ++ PGI  + L  +F+ +    +D  +++S+SYLE+YNEMIRDLL  +   L+LRED  GV QVAG+TE+      E+M LL +GN  RT E T AN+ SSRSHAVLQV V  RSRV+N  +++ +G+LF+IDLAGSERAS T NRG+RM EGAHINRSLLALGNCINAL+D    +Y+NYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YA RAK+I+T++ +N+ +V++H+ QY ++I++L+ EI RL+ K+D           Q  GD      E  +     ++    ++++ L  AFQ+ +  ++ L E      ++ ++ +R  + I  W   +S++A +  E + K    + + E+ +        + E   V + R  +     E+ +L+ Q+  LEQ   +   + + LE  +P ++ +   R++L LLC++H+LE++ T++++ + +LR  A   +H+ ++  L +H  LC  II  Q  +I DY + +P+ LE LY++Y R+
Sbjct:    2 KDSGDSKDQQLMVALRVRPISVAELEEGATLIAHKVDEQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFTATQEMVYQATTKSLIEGVISGYNATVFAYGPTGCGKTYTMLGTDQEPGIYVQTLNDLFRAIEETSNDMEYEVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKEIMQLLMKGNRQRTQEPTAANQTSSRSHAVLQVTVRQRSRVKNILQEVRQGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSDKGSNKYINYRDSKLTRLLKDSLGGNSRTVMIAHISPASSAFEESRNTLTYAGRAKNIKTRVKQNLLNVSYHIAQYTSIIADLRGEIQRLKRKIDEQTGRGQARGRQDRGDIRHIQAEVQLHSGQGEKAGMGQLREQLASAFQEQMDVRRRLLELENRAMEVQIDTSRHLLTIAGWKHEKSRRALKWREEQRKECYAKDDSEKDSDTGDDQPDILEPPEVAAARESIAALVDEQKQLRKQKLALEQRCRELRARGRRLEETLPRRIGSEEQREVLSLLCRVHELEVENTEMQS-HALLRDGALRHRHEAVRR-LEQHRSLCDEIIQGQRQIIDDYNLAVPQRLEELYEVYLRE 639          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|O14343|KLP5_SCHPO (Kinesin-like protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=klp5 PE=1 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 1.194e-88
Identity = 169/370 (45.68%), Postives = 254/370 (68.65%), Query Frame = 3
Query:  291 ANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSV----VLDLREDQNG-VQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLD----SMQTSGDPEENITLSMSDQIEEMKIKDNLLVAFQK 1373
            A   R+  + FD VF+ + +Q++V++ +  PL+  +LDG+ AT+FAYGATG GKT+T+ G  + PG+++  L+ +F++M  + D+ IF + LSYLE+YNE IRDLL S +      L+LRED +  + V GLT +   +  E++D++ +GNA RT+  T AN  SSRSHAVLQV +I + R     E      L +IDLAGSERA+ T  RG R+ EGA+IN+SLLALGNCINAL DP+ + +V YRDSKLTRLLK +LGGNCRTVMI  + PS++H+E++ NTL YA+RAK+I+T++ +N+  V+ H+ QY   I EL+++I+ L N+L     S Q++G  ++ +T S + + +  + ++ L + F++
Sbjct:   97 AGFGRDLRYAFDRVFDETATQQQVYERTARPLLDNILDGFNATIFAYGATGCGKTHTISGTMQDPGLIYLTLKELFERMDHLRDEKIFDLRLSYLEIYNETIRDLLVSPTPNQAKPLNLREDADRRITVPGLTSLSPESLEEIIDIIMKGNANRTMSPTEANAASSRSHAVLQVTLIQKPRTAGINEDHTLATLSIIDLAGSERATATKLRGSRLFEGANINKSLLALGNCINALCDPHRRAHVPYRDSKLTRLLKFSLGGNCRTVMIVCVSPSSVHYEETHNTLKYANRAKNIKTEVLRNMISVDRHVSQYVKAIVELREQISELENRLAQIDLSSQSNGSDQDAVTQSFAHESKLAEARNLLRMTFEE 466          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|P53086|KIP3_YEAST (Kinesin-like protein KIP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIP3 PE=1 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 2.264e-83
Identity = 171/334 (51.20%), Postives = 235/334 (70.36%), Query Frame = 3
Query:  303 RERH-----FVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLG--SNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR--YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSM 1274
            R RH     FVFD +F+ + SQ  V+K +T PL+  VLDG+ +TVFAYGATG GKTYT+ G   +PGI+F A+E +F ++  ++D+  F++SLSYLE+YNE IRDLL   + S  L +RED QN ++VA L+    NT  +VMDL+ +GN  RT   T AN+ SSRSHAVLQ++++  +++ +   Q     L +IDLAGSERA+ T NRG R+ EGA+INRSLLALGNCINAL   +G R  ++ YRDSKLTRLLK +LGGNC+TVMI  I PS+ H++++ NTL YA+RAK I+TKI +N   ++ H+  Y  +I+E K++I  LR + + M
Sbjct:  144 RRRHGGEIKFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETPSKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQQSLSRHVGSYLKMITEQKRQIEELREREEKM 477          
BLAST of Kinesin-like protein vs. TrEMBL
Match: D5JG74 (Kinesin-like protein OS=Dugesia japonica OX=6161 GN=KIF-19 PE=2 SV=1)

HSP 1 Score: 1443.71 bits (3736), Expect = 0.000e+0
Identity = 747/913 (81.82%), Postives = 831/913 (91.02%), Query Frame = 3
Query:  111 MSFIRKNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEEN-ITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRDDLTMTNNINMGLLDIDKDLYTYERILPAEIDSTSDIRDITSNMSVNEVQQEDESVASLPLINNPHATPESWDNESLRQGHKKLSMNNYAQSNFDIKYNDNGPKPAFESVPSTNRNLMISKPPISQLPYRLTQRYALPDLRSRQLAVQPEKKGNSRSRSFEPDLEISKXXXXXXXXXXXXXXXXXXXXXVRKLIVGPRSDKYDSGIFDLDLRGKKYLPKYEAYKTTPMSHRNDKKKKRSNSQKRIPKNTQTVKQAEEKYS-NHLILRANEIKKLNERKALDNFDDVDS 2843
            M F RKNTAGSSDQNLMVCLRIRP+NEDE NL +PIIAHSMDGN+ +LLDPLEDPDDILRANRSRER FVFD+VFNSSCSQEEVFKLSTLPLISQVLDGYTATVFAYGATGTGKTYTMLG+NE+PGIMFKALES+FK M MMED++I++MSLSYLEVYNEMIRDLLGSNSV LDLREDQNGVQVAGLTEI+VNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNV+SR R+RNTQEQI+KGKLFLIDLAGSERASNTLNRGKR+TEGAHINRSLLALGNCINAL+DPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKN+YDVNFHLVQYNNVIS+LK EINRLRNKLDSMQTSGDPE+N + +SM++QIEEMKIKD LLVAFQKHV CKKILSENIT+D DL+LEETRCQ IIKEWE+KKAERI ERENKS DKE E EEK  E+SGL  L E EN+K  +NELR+ QMERLRLKTQR+KLEQDL+ ++ +IK+LES+I EKVKNNHARQMLQLLC+MHKLEIQQTDLRTEN+VLRQHASKHDL+QSVL+KHNELCKRIIT QSSLIKDYG+DLPK+LEMLY+LY+ DD+TMTNNI +GLLDIDKDLY Y+R LP EIDS+SDIRD+TSN+SVNEV++EDES+ASLPLINNPHATPESWDNESLRQGHKK S N+Y Q+NFD KYN  GPKPAFE++ ++NRN MISKPPI+QLPYR T R  LPDLR RQL    EKK NSRSRSFEP+ + S+     +N   +   NRYANSNVRKL+VGPR D + + I+DLDLRGKKY+ KY+AYK+TP+SHR DK KKRS SQK+IPK+TQ  KQ +E+Y+ NHL+LRANEIKKLNERKALDNFD++DS
Sbjct:    1 MMFSRKNTAGSSDQNLMVCLRIRPMNEDEINLDVPIIAHSMDGNVVILLDPLEDPDDILRANRSRERRFVFDNVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFAYGATGTGKTYTMLGVNEQPGIMFKALESLFKHMRMMEDEFIYQMSLSYLEVYNEMIRDLLGSNSVYLDLREDQNGVQVAGLTEIDVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVVSRPRIRNTQEQILKGKLFLIDLAGSERASNTLNRGKRLTEGAHINRSLLALGNCINALSDPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNIYDVNFHLVQYNNVISDLKLEINRLRNKLDSMQTSGDPEDNTVVVSMNEQIEEMKIKDQLLVAFQKHVDCKKILSENITNDIDLNLEETRCQAIIKEWENKKAERIPERENKSRDKETEVEEKRSEISGLSLLDEPENIKLTKNELRLTQMERLRLKTQRQKLEQDLENHSNKIKNLESSILEKVKNNHARQMLQLLCRMHKLEIQQTDLRTENIVLRQHASKHDLVQSVLMKHNELCKRIITTQSSLIKDYGIDLPKELEMLYELYSEDDITMTNNIKIGLLDIDKDLYNYDRNLPVEIDSSSDIRDMTSNVSVNEVREEDESLASLPLINNPHATPESWDNESLRQGHKKSSFNSYFQTNFDTKYN-TGPKPAFENISNSNRNFMISKPPINQLPYRTTHRSILPDLRGRQLVGPIEKKSNSRSRSFEPEPDTSR-----NNGNSTTLNNRYANSNVRKLVVGPRLDPFGNTIYDLDLRGKKYVSKYDAYKSTPISHRPDKTKKRSTSQKKIPKSTQITKQTDERYANNHLVLRANEIKKLNERKALDNFDEMDS 907          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A210PH89 (Kinesin-like protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05175 PE=3 SV=1)

HSP 1 Score: 547.74 bits (1410), Expect = 6.324e-176
Identity = 314/626 (50.16%), Postives = 428/626 (68.37%), Query Frame = 3
Query:  138 GSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXX-RANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGD---------PEENITLSMSDQIEEM-KIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEK-NYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLY 1976
            G  +Q L V LRIRP+NEDE  +G   IAH +   M VL+DP +   D + RANRSRE+ FVFD+ F+S+ SQEEVFK +   LI  V+ GY ATVFAYGATG GKTYTMLG N+ PGIM  +L  +F++M    +D ++K+S+SYLE+YNEMIRDLL  ++ +LDLRED + GVQVAGL+E+  +TT+EVM++L  GN  RT E T ANK SSRSHAVLQV V  ++RVRNT +++  GKLF++DLAGSERA+ T NRGKRM EGAHINRSLLALGNCINAL+D NG +YVNYRDSKLTRLLKDALGGNC+TVMIAHI P+++HFE+SRNTL+YADRAKHIRTK+ +NV DV++H+ QY N+I EL++EINRLR +L     SG            E ++    +  E++ K+K+ LL++F+  +  +K L E   +  ++SLE  R Q+II EW+ +KA ++  RE    D   ED +       G + +SE + V+  R ELR+   E+ R +  R  ++++LD    +   L+  IP+++     R++L LL ++H LEI+ T++++  ++      K D++ S   +H  L  +II  Q  L+ +  +  PKDLE LYDLY
Sbjct:    8 GGGEQTLTVALRIRPLNEDETMMGAGTIAHKVQKKMVVLMDPSDSEHDDVLRANRSREKKFVFDYTFDSNASQEEVFKSTAGFLIPSVVSGYNATVFAYGATGAGKTYTMLGNNDNPGIMAMSLNVLFQEMERTREDMVYKVSMSYLEIYNEMIRDLLSPSAGILDLREDAKGGVQVAGLSEVTTHTTSEVMEMLLMGNKERTQEPTAANKTSSRSHAVLQVLVKQQNRVRNTNQEVRMGKLFMVDLAGSERAAATHNRGKRMVEGAHINRSLLALGNCINALSDKNGPKYVNYRDSKLTRLLKDALGGNCKTVMIAHISPASIHFEESRNTLIYADRAKHIRTKVRRNVADVSYHIAQYTNIIQELREEINRLRVRLHDSVESGPVNGAKIKTVQAEVLSTQHGEAREQLNKVKEQLLISFKDQMELRKSLMELNNASMEISLETNRNQLIISEWDVEKA-KLPRREGGE-DMYREDTKTMELSGLGSDDVSEPDEVRMAREELRVLHEEKHRTEKIRGTVQKELDTAKTKTTRLQENIPQRINGEDQREILSLLYKVHILEIENTEVQSACLLREFQIKKKDMVLSRFRQHQNLTDQIIKRQRVLLAEKNIATPKDLEELYDLY 631          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A267FUD2 (Kinesin-like protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000596g1 PE=3 SV=1)

HSP 1 Score: 545.814 bits (1405), Expect = 3.557e-175
Identity = 316/646 (48.92%), Postives = 430/646 (66.56%), Query Frame = 3
Query:  144 SDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLY-----TRDDLTMTNNINMGLLDIDKDLYTYERIL 2063
             DQNLMVC+RIRP++E+E   G  +IAH++D  + VLLDP EDPDDILRANRSRER FVFD  F+ + +QEEV++ +T  LI  V +GY ATVFAYGATG GKTYTMLG +  PGIM++ LE +F QM    DD ++K S+SYLE+YNE +RDLL   S VLD+RED + GVQVAGL+EI+ N T EV+ LL +GN  RT E T AN+ SSRSHAVLQV V+ RSRVR+  E++  GKLFLIDLAGSERA++T NRGKRM EGAHINRSLLALGNCINALAD  G RYVN+RDSKLTRLLK+ALGGNC+TVMIA+I P+ LHFEDSRNTLVYADRAK IRTK+ +NV DV+ H+ QY  VI+EL+QEI RLR +L+   ++G   + +  +   +      K+ +L AFQ+ +  +K +     +  DL+LE  R  ++I ++E  +  ++   E+ + D      +     +    + E   V + R EL + Q ERLR +  R +   ++     + + LE+++  K+ N   R++L+LL Q++ LE++  +++ E  +      K DL+ S    H +LC  II+ Q  L+   G  LPK L  +++LY       DD     ++ + L D+D+ L ++ R+L
Sbjct:   10 GDQNLMVCVRIRPISEEEILNGSNVIAHTVDDRVVVLLDPSEDPDDILRANRSRERQFVFDRAFDCNSTQEEVYESTTKFLIDTVTNGYNATVFAYGATGAGKTYTMLGTDREPGIMYRTLEDLFNQMQKTSDDSVYKFSMSYLEIYNEQLRDLLNPASGVLDMREDTRGGVQVAGLSEIQANNTGEVLHLLTQGNLARTTEPTAANETSSRSHAVLQVTVLKRSRVRDVTEEVRTGKLFLIDLAGSERAAHTQNRGKRMLEGAHINRSLLALGNCINALADRTGHRYVNFRDSKLTRLLKEALGGNCKTVMIANISPANLHFEDSRNTLVYADRAKQIRTKVRRNVTDVSHHIAQYTGVINELRQEIFRLRGRLEGGASTGTASKALFSAAKQRRVFNTTKEQILTAFQEVMELRKGVMSLDNTLGDLALEIGRANLLISQYEIDRVIKLPRSESATSDSPGTAPDTEAAAAASSVVEEPSEVAAARAELSVLQDERLRSEKMRFQAVVEMKAARDRARQLENSVRAKLTNEEEREILKLLSQLNALEMENAEVQAEAFLKSMEIRKRDLLLSRFRSHRQLCHAIISRQKRLLASMGARLPKSLARMHELYDSGPVDEDDAVFQRSMGVSLPDLDQ-LESHARVL 654          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A267GR45 (Kinesin-like protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001281g3 PE=3 SV=1)

HSP 1 Score: 544.273 bits (1401), Expect = 1.242e-174
Identity = 315/646 (48.76%), Postives = 430/646 (66.56%), Query Frame = 3
Query:  144 SDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLY-----TRDDLTMTNNINMGLLDIDKDLYTYERIL 2063
             DQNLMVC+RIRP++E+E   G  +IAH++D  + VLLDP EDPDDILRANRSRER FVFD  F+ + +QEEV++ +T  LI  V +GY ATVFAYGATG GKTYTMLG +  PGIM++ LE +F QM    DD ++K S+SYLE+YNE +RDLL   S VLD+RED + GVQVAGL+EI+ N T EV+ LL +GN  RT E T AN+ SSRSHAVLQV V+ RSRVR+  E++  GKLFLIDLAGSERA++T NRGKRM EGAHINRSLLALGNCINALAD  G RYVN+RDSKLTRLLK+ALGGNC+TVMIA+I P+ LHFEDSRNTLVYADRAK IRTK+ +NV DV+ H+ QY  VI+EL+QEI RLR +L+   ++G   + +  +   +      K+ +L AFQ+ +  +K +     +  DL+LE  R  ++I ++E  +  ++   E+ + D      +     +    + E   V + R EL + Q ERLR +  R +   ++     + + LE+++  K+ N   R++L+LL Q++ LE++  +++ E  +      K DL+ S    H +LC  II+ Q  L+   G  LPK L  ++++Y       DD     ++ + L D+D+ L ++ R+L
Sbjct:   10 GDQNLMVCVRIRPISEEEILNGSNVIAHTVDERVVVLLDPSEDPDDILRANRSRERQFVFDRAFDCNSTQEEVYESTTKFLIDTVTNGYNATVFAYGATGAGKTYTMLGTDREPGIMYRTLEDLFNQMQKTSDDSVYKFSMSYLEIYNEQLRDLLNPASGVLDMREDTRGGVQVAGLSEIQANNTGEVLHLLTQGNLARTTEPTAANETSSRSHAVLQVTVLKRSRVRDVTEEVRTGKLFLIDLAGSERAAHTQNRGKRMLEGAHINRSLLALGNCINALADRTGHRYVNFRDSKLTRLLKEALGGNCKTVMIANISPANLHFEDSRNTLVYADRAKQIRTKVRRNVTDVSHHIAQYTGVINELRQEIFRLRGRLEGGASTGTASKALFSAAKQRRVFNTTKEQILTAFQEVMELRKGVMSLDNTLGDLALEIGRANLLISQYEIDRVIKLPRSESATSDSPGTAPDTEAAAAASSVVEEPSEVAAARAELSVLQDERLRSEKMRFQAVVEMKAARDRARQLENSVRAKLTNEEEREILKLLSQLNALEMENAEVQAEAFLKSMEIRKRDLLLSRFRSHRQLCHAIISRQKRLLASMGARLPKSLARMHEVYDSGPVDEDDAVFQRSMGVSLPDLDQ-LESHARVL 654          
BLAST of Kinesin-like protein vs. TrEMBL
Match: K1R617 (Kinesin-like protein KIF19 OS=Crassostrea gigas OX=29159 GN=CGI_10026784 PE=3 SV=1)

HSP 1 Score: 549.28 bits (1414), Expect = 9.203e-171
Identity = 312/630 (49.52%), Postives = 436/630 (69.21%), Query Frame = 3
Query:  138 GSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKL-DSMQTSGDPEENITLSMSDQIEEM-----KIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEK-NYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYT--RDDLTM 1997
            G  +QNL V LRIRP+NEDE  +G   IAH +   M VL+DP+EDP+D+LRANRSRE+ FVFD  F+   SQEEV++ ++  LI  V+ GY ATVFAYGATG GKTYTMLG ++ PGIM +AL  +F +M     D  +K+++SYLE+YNEMIRDLL  ++ +LDLRED + GVQVAGL+E+   +T+EV+D+L +GN  RT E T ANK SSRSHAVLQV+V  ++RVR+T +++  G+LF+IDLAGSERA+NT NRGKRM EGAHINRSLLALGNCINAL D  G +YVNYRDSKLTRLLK+ALGGNC+TVMIAHI P+++HFE+SRNTLVYADRAKHI+TK+ +NV DV++H+ QY N+I EL++EI RLR++L D    S  P  NI    ++ +E       K+K+ LL++F+  +  +K L E   +  ++SLE  R Q++I EWE  K  R S R+      + ED +      +G + L E+E+VK  R EL++   E+ R +  R  + ++L++  ++ + +E  IP+++     R++L LLC++H+LEI+ T+ ++  ++      + D++     +H  LC +II  Q  ++++  +   +DLE LY LY   RDD  M
Sbjct:    8 GGGEQNLTVALRIRPMNEDEILMGATQIAHKVQKKMCVLMDPMEDPEDVLRANRSREKQFVFDCTFDGGASQEEVYRTTSRFLIPSVISGYNATVFAYGATGAGKTYTMLGAHDEPGIMAQALNDLFLEMDRTSQDMSYKVTMSYLEIYNEMIRDLLNPSAGILDLREDAKGGVQVAGLSEVTARSTDEVIDMLLKGNKERTQEPTAANKTSSRSHAVLQVSVKQQNRVRSTTQEVRIGRLFMIDLAGSERAANTHNRGKRMVEGAHINRSLLALGNCINALTDTKGSKYVNYRDSKLTRLLKEALGGNCKTVMIAHISPASIHFEESRNTLVYADRAKHIKTKVRRNVTDVSYHIAQYTNIIQELREEIQRLRHRLHDKSTGSPRPGVNIQAVQAEVVEAKREELNKLKEQLLISFKDQMELRKSLMELNNASMEVSLETNRNQLVISEWELDKV-RSSRRKEGGDKADTEDSKALELAGAGSDELQETEDVKLAREELKVLHDEKHRTEKLRATVMKELEQARVKTRQIEETIPKRINTEDQREILSLLCKVHELEIENTETQSACLLREFQIKRKDMVILKFRQHQNLCDQIIQRQKQIMEENKIAPTQDLEELYSLYKHERDDRIM 636          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif19 (kinesin family member 19 [Source:ZFIN;Acc:ZDB-GENE-080215-2])

HSP 1 Score: 445.662 bits (1145), Expect = 1.071e-139
Identity = 253/594 (42.59%), Postives = 383/594 (64.48%), Query Frame = 3
Query:  288 RANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNG-VQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKL---DSMQTSGDP------EENITLS-MSDQIEEM-------------KIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAER----ISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            RA+RSRE+ ++FD  F+ + +QEEV++ +T  LI  ++ GY ATVFAYG TG GKTYTMLG ++ PGI  + L  +FK +    DD  + +S+SYLE+YNEMIRDLL  +S  LDLRED  G +QVAG+TE+      E+M+LL +GN  RT E T AN+ SSRSHAVLQV V  +SR R+  +++   +LF+IDLAGSERA+ T NRG+R+ EGAHINRSLLALGNCINAL++ NG +YVNYRDSKLTRLLKD+LGGN RTVMIAHI P++L FE+SRNTL YADRAK IRT++ +N+ +V++H+ QY ++IS+L+ EI RL+ K+    S Q + D       ++  +LS  S  I E+             ++++ L+ AF++ +  +K L E   ++ ++ ++ ++  + I +WE +++ +      ER  +S +K+ E E+ +         +E++ V   R  L     E+ ++  QR  LE+ L +   + + LE  +P +V +   R++L LLC++H+LEI+  ++++  ++      + +++     +H +LC  II  Q   I D+ + +P  L+ LY++Y RD
Sbjct:   16 RAHRSREKTYMFDVAFDYTATQEEVYRATTKGLIEGLISGYNATVFAYGPTGCGKTYTMLGTDKEPGIYVRTLNDLFKAIEETSDDMQYSVSMSYLEIYNEMIRDLLNPSSGFLDLREDSKGEIQVAGITEVSTINAREIMELLVKGNKQRTQEPTAANQTSSRSHAVLQVAVKQQSRCRDVLQEVRFARLFMIDLAGSERAAQTQNRGQRLKEGAHINRSLLALGNCINALSEKNGNKYVNYRDSKLTRLLKDSLGGNSRTVMIAHISPASLAFEESRNTLTYADRAKSIRTRVKRNLLNVSYHIAQYTSIISDLRSEIQRLKKKIAEQASRQNNSDRADIRHVQDTGSLSPSSGGIAEVQAHSTQQSRAAMDQLREQLIEAFRQQMEIRKRLMELDNTNMEIQIDTSKHLLTIADWEQERSRQRRKWQGERRKESFNKD-ESEKDSDTPESPPDSTETQEVAMARENLVTLMGEQKKISKQRAGLERRLAELRERARRLEELLPRRVSSEEQREVLGLLCKVHELEIENAEMQSHALLKDNVIRQKNVVVQRFEQHRQLCHEIIQQQRQFIDDHSLLVPPHLQELYEMYIRD 608          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif18a (kinesin family member 18A [Source:ZFIN;Acc:ZDB-GENE-040426-862])

HSP 1 Score: 290.426 bits (742), Expect = 2.593e-83
Identity = 175/389 (44.99%), Postives = 248/389 (63.75%), Query Frame = 3
Query:  138 GSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXX-----------XXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKL 1265
            G    ++ V +R+RP+N  E +  +  +   +D +M V    +E+                RAN+  +  FVFD VF    SQ EVF+ +T  ++  VL+GY  TVFAYGATG GKT+TMLG ++ PG+M+  ++ +F +M  ++++ +F+++ SYLEVYNE IRDLL +NS  L +RED   GV V GLT  +  +   +++ L+ GN  RT   T  N  SSRSHAV Q+ +  + +  +    +   K+ LIDLAGSERAS T  +G R+ EGA+INRSLLALGN IN LADP  K+ ++ YRDSKLTRLLKD+LGGNCRTVMIA++ PS+L +ED+ NTL YA+RAK I++ +  NV  ++ H+ QY  +  + K EI  L+ KL
Sbjct:    4 GQVCSHVKVVVRVRPLNSKEVDGNLSKVVQVVDSHMLVFDPKVEEVTFFRGQKVGNRDVRKRANK--DLKFVFDRVFGEDSSQVEVFENTTKGVVDGVLNGYNCTVFAYGATGAGKTHTMLGSSDNPGVMYLTMKELFSRMDQIKEEKVFEVAFSYLEVYNEQIRDLL-ANSGPLAVREDGAKGVVVQGLTLHQPKSAEHILEALDFGNRNRTQHPTDMNATSSRSHAVFQIYLRQQDKTASLNPNVRVAKMSLIDLAGSERASATNAKGARLREGANINRSLLALGNVINTLADPKSKKTHIPYRDSKLTRLLKDSLGGNCRTVMIANVSPSSLSYEDTHNTLKYANRAKEIKSTLKSNVVSLDSHIGQYAVICEKQKAEIILLKQKL 389          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif4 (kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1545])

HSP 1 Score: 226.868 bits (577), Expect = 1.876e-60
Identity = 151/393 (38.42%), Postives = 223/393 (56.74%), Query Frame = 3
Query:  162 VCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGI------NERP-GIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLL--GSNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGK-RYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEENIT 1307
            V LR RP+   E N G       + G   V++                ++ F +D+VF+ +  QEEVF ++  PL+S +  GY ATV AYG TG+GKT++M G       NE   G++ + +  +F++     D   F +++SYLE+YNE I DLL    +  VL +RED + G+++ GLTE  V T  E++  L  GN+ RTV +T  N  SSRSHA+  +++  R   R ++   +  KL L+DLAGSER   T   G R+ EG  INR LL+LGN I+AL D + K  +V YRDSKLTRLL+D+LGGN  T+MIA I P+  + E++ NTL YADRA+ I+ K   N+      + +    + EL+  +   R  +  + +  +P EN++
Sbjct:   13 VALRCRPLVPKEINEGCQCCLTFVPGEPQVVV--------------GSDKAFTYDYVFDPTTEQEEVFNMAVSPLLSGLFKGYNATVLAYGQTGSGKTFSMGGTYTSAQENEPTVGVIPRVVRKIFQEKSKRMDSE-FLLNVSYLEIYNEEILDLLCTSKDKPVLSIREDPKEGIKIVGLTEKAVLTAQEMVGCLEVGNSARTVGSTAMNAASSRSHAIFTISLEQR---RGSENDAVVSKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLSLGNVISALGDESKKGSFVPYRDSKLTRLLQDSLGGNSHTLMIACISPADSNIEETINTLRYADRARKIKNKPVLNIDPQAAEMKRLKQQVQELQVMLLHARGGVAPVLSGAEPAENVS 387          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif3a (kinesin family member 3A [Source:NCBI gene;Acc:103027986])

HSP 1 Score: 218.779 bits (556), Expect = 1.931e-59
Identity = 144/377 (38.20%), Postives = 220/377 (58.36%), Query Frame = 3
Query:  153 NLMVCLRIRPVNEDEHNLG--IPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERH-----FVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERP---GIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVV-LDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEI 1244
            N+ V +R RP+N+ E  +G    +    M G + V              N++   H     F FD VF+    Q +V+ L+  P++  VL+GY  T+FAYG TGTGKT+TM G+   P   GI+  +   +F  +   E D  F + +SYLE+YNE +RDLLG + +  L+++E  + GV +  L+   VN  +++  ++  G+  R+V AT  N+HSSRSHA+  + +    +  +  + +  GKL L+DLAGSER   T   G+R+ E   IN SL  LGN I+AL D  GK  +V YR+SKLTRLL+D+LGGN +T+M A+IGP+  +++++ +TL YA+RAK+I+ K   N    +  L Q+   I ELK+++
Sbjct:   17 NVKVVVRCRPLNQKEKMMGHKQSVTVDEMRGTITV--------------NKTETPHEPPKTFTFDTVFSPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVD--GKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKRKL 377          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif3a (kinesin family member 3A [Source:NCBI gene;Acc:103027986])

HSP 1 Score: 218.009 bits (554), Expect = 1.990e-59
Identity = 144/377 (38.20%), Postives = 220/377 (58.36%), Query Frame = 3
Query:  153 NLMVCLRIRPVNEDEHNLG--IPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERH-----FVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERP---GIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVV-LDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEI 1244
            N+ V +R RP+N+ E  +G    +    M G + V              N++   H     F FD VF+    Q +V+ L+  P++  VL+GY  T+FAYG TGTGKT+TM G+   P   GI+  +   +F  +   E D  F + +SYLE+YNE +RDLLG + +  L+++E  + GV +  L+   VN  +++  ++  G+  R+V AT  N+HSSRSHA+  + +    +  +  + +  GKL L+DLAGSER   T   G+R+ E   IN SL  LGN I+AL D  GK  +V YR+SKLTRLL+D+LGGN +T+M A+IGP+  +++++ +TL YA+RAK+I+ K   N    +  L Q+   I ELK+++
Sbjct:    7 NVKVVVRCRPLNQKEKMMGHKQSVTVDEMRGTITV--------------NKTETPHEPPKTFTFDTVFSPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDVGVYIKDLSGYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVD--GKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKRKL 367          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010887.1 (pep scaffold:Pmarinus_7.0:GL482947:9977:16429:1 gene:ENSPMAG00000009864.1 transcript:ENSPMAT00000010887.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.553 bits (828), Expect = 3.460e-103
Identity = 168/275 (61.09%), Postives = 211/275 (76.73%), Query Frame = 3
Query:  351 QEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGK-RYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKI 1169
            Q+EV+  +T  LI  V+ GY ATVFAYG TG GKTYTMLG +  PGI  + L  +F+ +    DD  + +++SYLE+YNEMIRDLL  ++  LDLRED + G+Q+AG+TE+  +   E+M LL +GN  RT E T ANK SSRSHAVLQV V   SRVR+  +++  G+LFLIDLAGSERA+ T NRGKRM EGAHINRSLLALGNCINAL++  G+ +YVNYRDSKLTRLLKD+LGGN RTVMIAHI P+++ FE+SRNTL YADRAK+I+ ++
Sbjct:    6 QDEVYLATTKELIEGVISGYNATVFAYGPTGAGKTYTMLGTDRDPGIYMRTLSDLFRAIEATSDDMKYGVTMSYLEIYNEMIRDLLNPSTGFLDLREDHKGGIQIAGITEVSTSNAKEIMQLLVKGNRQRTQEPTAANKASSRSHAVLQVTVRQSSRVRDISQEVRTGRLFLIDLAGSERAAQTQNRGKRMKEGAHINRSLLALGNCINALSERGGRAQYVNYRDSKLTRLLKDSLGGNSRTVMIAHISPASISFEESRNTLTYADRAKNIKNRV 280          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 222.246 bits (565), Expect = 2.242e-62
Identity = 149/383 (38.90%), Postives = 224/383 (58.49%), Query Frame = 3
Query:  144 SDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGIN---ERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSN-SVVLDLRE-DQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHI--RTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLD 1268
            S + + V +R RP+N  E        A S +  + + +   +      RAN    R F FD V+     Q ++++ S  PL+  VL G+  T+FAYG TGTGKTYTM G+    ER G++  + E +F  +   ++  + ++  SYLE+Y E IRDLL  + S  L+LRE    G+ V  L+     +  E+  ++  GN  R+V AT  N+HSSRSHA+  + V       + +  I  GKL L+DLAGSER + T  +G+R+ E   IN SL ALGN I+AL D  GK  +V YRDSKLTRLL+D+LGGN RTVM+A++GP++ ++++S  TL YA+RAK+I  R +++++  D          ++ E ++EI RL+ +L+
Sbjct:   16 SAETVRVVVRCRPMNPRES-------AASYESVITIDVRAGQVAIRNPRANADPARTFTFDAVYGGDAKQLDIYEESFRPLVDSVLCGFNGTIFAYGQTGTGKTYTMEGVRSDPERRGVIPNSFEHIFTHISRSQNQPVPEVRASYLEIYQEEIRDLLSRDQSRRLELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSRSHAIFVITVECSELGADGESHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVD--GKSTHVPYRDSKLTRLLQDSLGGNARTVMVANVGPASYNYDESLTTLRYANRAKNIRNRPRVNEDPKDA---------LLREFQEEIARLKEQLE 380          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: KIF27 (kinesin family member 27 [Source:HGNC Symbol;Acc:HGNC:18632])

HSP 1 Score: 228.794 bits (582), Expect = 1.247e-61
Identity = 157/392 (40.05%), Postives = 217/392 (55.36%), Query Frame = 3
Query:  162 VCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGIN------ERPGIMFKALESMF---KQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDL--REDQNG-VQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVR--------NTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYN---NVISELKQEINRLRNKL 1265
            V +RIRP+  +E           + GN  +LL               ++R F FDHVF S  +QEEV+K    PL+   +DGY  TVFAYG TG+GKT+T+ G N      +  GI+ +A+  +F   K+ H  +    F + +SY+EVY E +RDLL   ++  D+  RED  G   + G  E  V T +EV+ LL  GNA R    T  N+HSSRSH +  + V  R            N + + +  K   +DLAGSER S T N G+R  E   IN  LLALGN I+AL DP  K  ++ YRD+K+TR+LKD+LGGN +T+MIA I PS+ +F+++ N+L YA+RAK+IR K           +V YN   + I E++QEI  LR  L
Sbjct:    8 VAVRIRPLLRNEILYSQQTCVRVVPGNQQILL--------------GKDRAFTFDHVFGSKVAQEEVYKTCIQPLVKSFVDGYNVTVFAYGQTGSGKTFTIGGANIASSIEDERGIIPRAIADLFFAMKESHNTD----FSVGVSYIEVYKEELRDLLDIETLSKDMHIREDDKGNTVIIGTKESVVETEDEVLSLLEAGNAARHTGTTQMNEHSSRSHTIFTLTVTQRRPYGSSNSGDNLNNESESLSSKFHFVDLAGSERVSKTGNTGERFKESIQINSGLLALGNVISALGDPKRKSSHIPYRDAKITRILKDSLGGNAKTLMIACISPSSGNFDETINSLKYANRAKNIRNK----------PVVNYNPDWDRIDEMEQEIKTLREAL 371          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 221.861 bits (564), Expect = 2.475e-61
Identity = 145/382 (37.96%), Postives = 221/382 (57.85%), Query Frame = 3
Query:  123 RKNTAGSSDQNLMVCLRIRPVNEDEHNLG--IPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERP---GIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVV-LDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEI 1244
            R   + S   N+ V +R RP+N  E   G  + ++   M G +AV              N    + F FD VF +   Q +V+ L+  P++  VL+GY  T+FAYG TGTGKT+TM GI   P   GI+  +   +F  +   E D  F + +SYLE+YNE ++DLLG +    L+++E  + GV V  L+   VN  +++  ++  G+  R+V +T  N+HSSRSHA+  + +    +  +    +  GKL L+DLAGSER + T   G+R+ E   IN SL  LGN I+AL D  GK  +V YR+SKLTRLL+D+LGGN +T+M A+IGP+  +++++ +TL YA+RAK+I+ K   N    +  L Q+   I +LK+++
Sbjct:    5 RSEKSDSGGDNVKVVVRCRPINGKETGAGHRMAVLVDEMRGQIAVQRPD---------CNDEPPKTFTFDTVFGTESKQVDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGIRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVKDLLGKDQTQRLEVKERPDVGVYVKDLSAFVVNNADDMDRIMTLGHKNRSVGSTNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISALVD--GKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLKKKL 375          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001811.1 (pep scaffold:Pmarinus_7.0:GL477555:33781:61877:1 gene:ENSPMAG00000001600.1 transcript:ENSPMAT00000001811.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.468 bits (550), Expect = 2.592e-58
Identity = 138/362 (38.12%), Postives = 210/362 (58.01%), Query Frame = 3
Query:  135 AGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERP---GIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQ-VAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQ-EQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLV 1205
            A  ++ N+ V  R+RP+N  E   G   IA    GN  V++                 + +V+D VF+   +QE+V+      +   VL+GY  T+FAYG T +GKT+TM G+   P   G++ + ++ +F  ++ M+++  F + +SY E+Y + IRDLL  +   L + ED+N V  V G TE  V++  EVMD+++ G A R V  T  N+HSSRSH++  +NV    +  N + EQ + GKL+L+DLAGSE+ S T   G  + E  +IN+SL ALGN I ALA+   + +V YRDSK+TR+L+D+LGGNCRT +I    PS  +  ++++TL++  RAK I     KN   +N  L 
Sbjct:    2 ADPAECNIKVMCRVRPINNSEEARGDKFIA-KFQGNDTVIVSN---------------KPYVYDGVFHPETTQEQVYNACARQITKDVLEGYNGTIFAYGQTASGKTHTMEGVLHDPEHMGVIPRIVKDIFHYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINV----KQENVETEQKLSGKLYLVDLAGSEKVSKTGAEGSVLDEAKNINKSLSALGNVIAALAE-GTRTHVPYRDSKMTRILQDSLGGNCRTTVIICCSPSIYNEAETKSTLLFGQRAKTI-----KNTVTINMELT 337          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 291.197 bits (744), Expect = 3.261e-85
Identity = 171/334 (51.20%), Postives = 235/334 (70.36%), Query Frame = 3
Query:  303 RERH-----FVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLG--SNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR--YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSM 1274
            R RH     FVFD +F+ + SQ  V+K +T PL+  VLDG+ +TVFAYGATG GKTYT+ G   +PGI+F A+E +F ++  ++D+  F++SLSYLE+YNE IRDLL   + S  L +RED QN ++VA L+    NT  +VMDL+ +GN  RT   T AN+ SSRSHAVLQ++++  +++ +   Q     L +IDLAGSERA+ T NRG R+ EGA+INRSLLALGNCINAL   +G R  ++ YRDSKLTRLLK +LGGNC+TVMI  I PS+ H++++ NTL YA+RAK I+TKI +N   ++ H+  Y  +I+E K++I  LR + + M
Sbjct:  144 RRRHGGEIKFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETPSKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQQSLSRHVGSYLKMITEQKRQIEELREREEKM 477          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 173.711 bits (439), Expect = 1.215e-44
Identity = 142/411 (34.55%), Postives = 216/411 (52.55%), Query Frame = 3
Query:  129 NTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLG---------------INERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSV-------------VLDLREDQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQV--NVISRSRVRNTQEQ--IMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKL 1265
            N A +SD N+ V +R R  N+ E      ++  ++          +   +   ++  S ++ + FD VF +   QE VF  +    I ++L GY  T+FAYG TGTGKTYTM G               + E  GI+ + L  +FK++  +  +Y  K  +S+LE+YNE ++DLL  +               + D   + + + V G+ EI +N+ +E ++LL +G+  R V AT  N  SSRSH V  +  N++ +    + Q +  +  GKL L+DLAGSE  + +    KR  E   IN+SLL LG  INAL D     ++ YR+SKLTRLL+D+LGG  +T +IA I P+ +  E++ +TL YA RAK I     KN   VN  L + +  + +  QEI +LRN L
Sbjct:   44 NGAATSDSNIHVYVRCRSRNKREIEEKSSVVISTL----GPQGKEIILSNGSHQSYSSSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVK--ISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD--HSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSI-----KNTPQVNQSLSK-DTCLKDYIQEIEKLRNDL 440          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 144.821 bits (364), Expect = 4.283e-36
Identity = 120/343 (34.99%), Postives = 174/343 (50.73%), Query Frame = 3
Query:  315 FVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQM--HMMEDDYIFKMSLSYLEVYNEMIRDLLGSN------------------------SVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINAL--------------------------ADPNG---KRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHK 1175
            F FDHVF S C+  EV++ ++ P+I ++L G+ AT+FAYG TG+GKT+TM G  +  G++  ++  +F  +    M  D  F + +SYLE+YNE I DLL S                          V L +R+D Q GV+V GLTE    ++ E++  +  G+  R +  T  N  SSRSHA++ + + S + V+N   +     L L DLAGSERA+    R K   EG+ IN+SLLALG  I+ L                          A  NG     ++ YRDSKLTRLL+ AL G+     I  +        ++ NTL +A RAK++   + K
Sbjct:  163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTS-TNVKNGTSR--SSTLSLCDLAGSERATGQQERRK---EGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVALHVSK 499          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 140.584 bits (353), Expect = 1.115e-34
Identity = 114/350 (32.57%), Postives = 187/350 (53.43%), Query Frame = 3
Query:  153 NLMVCLRIRPVNEDEHNLGIPII-AHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDD-YIFKMSLSYLEVYNEMIRDLLGSN-------SVVL--DLREDQNGVQVAGLTEIEVNTTNEVMD--LLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNG-KRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIR 1160
            N+ V  RIRP  ++  N    +I  +  D N  V    +         N ++   F FD +F+   +  +VFK     L+   LDGY   +FAYG TG+GKT+TML  N   GI+   +  +F  ++ ++   + +K++  ++E+YNE I DLL S+       S+ L  ++R DQ                +E M   +L + N +R+  +T +N+HSSRSH++  ++ +S S  +        G L L+DLAGSER + +   G R+ E  +IN+SL  LG+ I+AL  P+  KR++ +R+SKLT LL+ +L G+ +T+M  +I PS+ H  ++ N+L +A +    R
Sbjct:  386 NIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQ-----NTAQVHEFKFDKIFDQQDTNVDVFK-EVGQLVQSSLDGYNVCIFAYGQTGSGKTFTML--NPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIH-LSGSNAKTGAHSY--GTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNSTR 724          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 124.02 bits (310), Expect = 3.149e-29
Identity = 68/174 (39.08%), Postives = 106/174 (60.92%), Query Frame = 3
Query:  648 NGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMK-GKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTK 1166
            NG+ +  L E  +    E ++LL +G   R V +T  N  SSRSH +  + +  +      Q+++ +  K+ L+DLAGSE  + +    +R  E   IN+SLL LG  INAL D +G  ++ +R+SKLTRLL+D+LGGN +T +IA I P+ +  E++ +TL YA +AK+I+ K
Sbjct:  314 NGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-----QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480          

HSP 2 Score: 63.5438 bits (153), Expect = 1.475e-10
Identity = 54/173 (31.21%), Postives = 88/173 (50.87%), Query Frame = 3
Query:  132 TAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMD--GNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLG--------INERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNS 620
            T  + + N+ V +R R  NE E ++   ++ +  D  G+  + ++   D     + N  R   +  D VF    SQ+ +F     PL    + GY  TV  YG T TGKTYTM G        +++  GI+ + L  +F  + + ++DY+ K   S++E+YNE ++DLL SNS
Sbjct:   29 TVPNEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKR---YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVK--CSFIELYNEELKDLLDSNS 196          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO38070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY9])

HSP 1 Score: 412.535 bits (1059), Expect = 2.721e-134
Identity = 225/369 (60.98%), Postives = 280/369 (75.88%), Query Frame = 3
Query:  162 VCLRIRPVNEDEHN-LGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKL 1265
            V LR+RP+N  E N LG   I H +D N+ VL DP ED DDILR NRSRE+ +VFDH F  + SQ EVF  +T PLI  V+ GY ATVFAYGATG GKTYTMLG +   GIM   L ++F QM    DD  +K+++SYLE+YNEMIRDLL  +S  L+LRED  GV VAG++E+E  TT+EV+ +L+ GN  RT E T ANK SSRSHA+LQV V   SRV+N   ++  GKLF+IDLAGSERA+ T NRGKRM EGAHINRSLLALGNCINAL++  G  YVNYRDSKLTRLLKD+LGGNC TVMIAH+ P++  FE+SRNTL+YADRAK I+TK+ +N ++V++H+ QY N+I++L++EI RL+ K+
Sbjct:    1 VALRVRPINATELNVLGSSEIIHCLDENLVVLRDPNEDTDDILRVNRSREKQYVFDHAFGPTASQVEVFSKTTKPLIDGVVSGYNATVFAYGATGAGKTYTMLGTDSEIGIMGLTLNNLFSQMDETNDDMAYKVTMSYLEIYNEMIRDLLNPSSGYLELREDGKGVNVAGISEVEAKTTSEVLGMLHMGNKQRTSEPTAANKTSSRSHAILQVTVTQESRVKNIIREMRVGKLFMIDLAGSERAAQTKNRGKRMIEGAHINRSLLALGNCINALSENRG-HYVNYRDSKLTRLLKDSLGGNCHTVMIAHVSPASRMFEESRNTLLYADRAKSIKTKVKRNQFNVSYHIAQYTNIIADLRKEIFRLKTKI 368          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO49131 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGY3])

HSP 1 Score: 295.434 bits (755), Expect = 6.005e-91
Identity = 179/382 (46.86%), Postives = 241/382 (63.09%), Query Frame = 3
Query:  153 NLMVCLRIRPVN--EDEHNLGIPIIAHSMDGNMAVX-----------XXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRL 1253
            N+ V +R+RP N  E  +N G   +   MD N+ V                      +   R+R+  F+FD VFN   +  +VF+ +T  +I  VLDG+  TVFAYGATG GKT+TMLG N  PG+MF  +  +++++H M+D+    +++SYLEVYNE IRDLL      L +RED Q GV V+GLT  + ++  E++ +L  GN  RT   T AN  SSRSHAV QV V  + R    +  +   K+ LIDLAGSERA+ T NRG R  EGA+IN+SLLALGNCINALAD   K  ++ YR+SKLTRLLKD+LGGNC+TVMIA + PS L +ED+ NTL YADRAK I+  + +NV  V+FH+ +Y  ++ EL+ E+  L
Sbjct:    1 NMRVVVRVRPPNPLEISNNSGASSV-RVMDQNVLVFDPDEECEAINFPGASRKRARSVTGRRARDLRFIFDRVFNEEANNTDVFENTTKDIIDGVLDGFNCTVFAYGATGAGKTHTMLGSNNNPGVMFLTMMDLYRRIHEMKDEKTCDVAVSYLEVYNETIRDLLLPGPA-LAVREDPQRGVCVSGLTLHKPHSAEELLSMLEFGNNNRTQHPTDANAQSSRSHAVFQVFVRQKDRTAGLKANVRLAKMSLIDLAGSERATVTTNRGARFREGANINKSLLALGNCINALADKENKSGHIPYRNSKLTRLLKDSLGGNCKTVMIAAVSPSMLSYEDTYNTLKYADRAKSIKVSLKRNVVSVDFHVSRYAKIVDELRTEVYYL 380          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO37529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFN7])

HSP 1 Score: 212.616 bits (540), Expect = 6.506e-61
Identity = 136/315 (43.17%), Postives = 195/315 (61.90%), Query Frame = 3
Query:  309 RHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERP---GIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSN-SVVLDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQ 1238
            + F FD  +    + E ++     PL+  VL+GY  TVFAYG TG GK+++M+GI + P   GI+ +A E +F+ +++  DD  F +  SYLE+YNE IRDLLG +    LDL+E  + GV V  LT I VN  +E+  +++ G+  R+V AT  N  SSRSH++  +N+          E I  GKL L+DLAGSER S T   G R+ E   IN SL ALGN I+AL D   K ++ YRDSKLTRLL+D+LGGN +T+M+A + P+  +++++ +TL YA+RAK+I+ K   N    +  L QY+  I  LK+
Sbjct:   49 KAFTFDGAYFIDSTTENIYNDICFPLVEGVLEGYNGTVFAYGQTGCGKSFSMMGITDPPTQRGIIPRAFEHIFESINVA-DDSKFLVHASYLEIYNEEIRDLLGKDHKAKLDLKEHPDKGVYVKDLTMIPVNCVSEIEHVMDLGSKNRSVGATLMNADSSRSHSIFSINLEILDDDSEGNEHIRAGKLNLVDLAGSERQSKTGATGGRLKEATKINLSLSALGNVISALVDGKAK-HIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIKNKPKINEDPKDALLRQYSEEIERLKK 361          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO38591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCK0])

HSP 1 Score: 207.608 bits (527), Expect = 9.634e-55
Identity = 160/417 (38.37%), Postives = 241/417 (57.79%), Query Frame = 3
Query:  162 VCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERH-FVFDHVFNS-------SCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMED-DYIFKMSLSYLEVYNEMIRDLLG--SNSVVLDLREDQ-NGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMK--GKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPN-------GKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYN---NVISELKQEINRLRNKLDSMQTSGDP--EENITLSMSDQIEE 1334
            V +R+RP+N  E +LG  ++   M+ N  +LL    +     +    R  H F FDH F S         +Q++V++     ++    +GY A +FAYG TG+GKTYTM+G  E  GI+ +   ++F+ +   ++ D  +K+ +SY+E+YNE +RDLL     S  L +RE +  G  V GLT++ V++  ++  ++  GN  RTV AT  N  SSRSHAV  + +++R+   +  E I +   KL L+DLAGSERA  T   G R+ EG++INRSL+ LG  I++LA+ +       G  +V YRDS LT LLKD LGGN +TVM+A I PSA ++E++ +TL YADRAK I          VN  +V  +    +I EL++E+ RL++ L S + +G P  EE   L + + I E
Sbjct:    7 VAVRVRPLNRREIDLGSKVVV-DMEENQTILLPSRGNDRKQAKV---RMVHNFAFDHCFWSIDAAKTKFAAQDKVYECLGSDVLENAFEGYNACIFAYGQTGSGKTYTMMGAGEDKGIIPRLCVNLFRGISQNDNHDITYKVEVSYIEIYNEKVRDLLCPRGGSASLRVREHKVMGPYVEGLTKLVVSSFEDIEAIMMEGNKSRTVAATRMNTESSRSHAVFNI-LLARTEYDHQTESIGEKVSKLSLVDLAGSERACKTGAEGDRLKEGSNINRSLVTLGQVISSLAEQSAGKHGKKGAHFVPYRDSVLTWLLKDNLGGNSKTVMVATISPSADNYEETLSTLRYADRAKKI----------VNHAVVNEDPNARIIRELREEVERLKHLLQS-KIAGFPIQEETGELEIQEMISE 407          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO40836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5X0])

HSP 1 Score: 203.371 bits (516), Expect = 1.094e-54
Identity = 136/332 (40.96%), Postives = 199/332 (59.94%), Query Frame = 3
Query:  315 FVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERP---GIMFKALESMFKQM-HMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVV-LDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVL-------QVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLD 1268
            F +D V++ +  Q +++  +   L+  VL+GY  T+FAYG TGTGKT+TM G+   P   G++  + + +F  +       Y+ + S  YLE+Y E +RDLLG +    L+L+E  + GV V  L      +  E+  ++N GN  R+V AT  N+HSSRSHA+        Q+N +    +R        GKL ++DLAGSER + T   G R+ E   IN SL ALGN I+AL D  GK  ++ YRDSKLTRLL+D+LGGN RTVM+A+IGP++ ++E+S  TL YA+RAK+I+ K H N           + ++ E ++EI RL+N+LD
Sbjct:   38 FTYDAVYDWNSKQIDLYDETFRQLVESVLEGYNGTIFAYGQTGTGKTFTMEGVRSDPDLRGVIPNSFDHIFTHIARTTNQQYLVRAS--YLEIYQEEVRDLLGKDQKKRLELKERPDTGVYVKDLQSFVCKSVKEIEHVMNVGNQNRSVGATKMNEHSSRSHAIFIITIECSQLNAVGECHIR-------VGKLNMVDLAGSERQTKTEATGDRLKEATKINLSLSALGNVISALVD--GKSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNYEESITTLRYANRAKNIKNKPHINEDP-------KDALLREFQEEIARLKNELD 351          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif19 (kinesin family member 19 [Source:NCBI gene;Acc:101166996])

HSP 1 Score: 497.664 bits (1280), Expect = 4.002e-159
Identity = 290/645 (44.96%), Postives = 421/645 (65.27%), Query Frame = 3
Query:   99 FNCDMSFIRKNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGV-QVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKL---DSMQTSGD--------PEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERIS----ERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
             + D   I K+T  S DQ L V LRIRP+++ E   G  I+AH +D  M VL+DP+EDPDDILRANRSRE+ ++FD  F+ S SQEEV++ +T PLI  ++ GY ATVFAYG TG GKTYTMLG ++ PGI  + L  +F  +    DD ++ +S+SYLE+YNEMIRDLL  +S  LDLRED  GV QVAG+TE+      E+M+LL +GN  RT E T AN+ SSRSHAVLQV V  +SR R+  +++   +LF+IDLAGSERA+ T NRG+R+ EGAHINRSLLALGNCINAL+D NG +YVNYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YADRAK IRT++ KN+ +V++H+ QY N+IS+L+ EI RL+ K+    S Q S +         E      +  + +  ++++ LL AF++ +  +K L E   S+ ++ +++++  +II +WE +++ R S    ER  +S+ K+ E E+ +         +E+++V   R  L     E+ +++ Q+  LE    +   Q + LE  +P +V +   R++L LLC++H+LEI+  ++++  ++      + + +     +++ LC  II  Q   I D+ + +P  L+ LYD+Y R+
Sbjct:    5 LHPDNKTIMKDTGESKDQQLTVALRIRPLSDAEQEEGSTIVAHRVDDQMIVLMDPMEDPDDILRANRSREKTYLFDVAFDFSASQEEVYRATTKPLIEGLISGYNATVFAYGPTGCGKTYTMLGTDKEPGIYVRTLNDLFHAIEETSDDMLYSVSMSYLEIYNEMIRDLLNPSSGFLDLREDSKGVIQVAGITEVSTINAQEIMELLVKGNKQRTQEPTAANQTSSRSHAVLQVAVKQQSRSRDVSQEVRFARLFMIDLAGSERAAQTQNRGQRLKEGAHINRSLLALGNCINALSDKNGNKYVNYRDSKLTRLLKDSLGGNSRTVMIAHISPASTAFEESRNTLTYADRAKSIRTRVKKNLMNVSYHIAQYTNIISDLRCEIERLKKKIAEQSSRQLSSERADIRNVQAEVQAHAGLQSRADMEQLREQLLHAFRQQMDIRKSLMELENSNMEIQIDKSKHLLIITDWEQERSRRRSKWRAERRKESVKKD-ESEKDSDSTESPPDTTETQDVLLARENLTFLAAEQKKIQKQKNLLEHQFVELRDQARRLEELLPRRVSSEEQREVLGLLCKVHELEIENAEMQSHALLKDNVIRQKNFVVQRFEQYSHLCDEIIQQQRQFIDDHSLPVPPYLQELYDMYMRE 648          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif19 (kinesin family member 19 [Source:NCBI gene;Acc:101166996])

HSP 1 Score: 496.123 bits (1276), Expect = 5.738e-159
Identity = 288/636 (45.28%), Postives = 418/636 (65.72%), Query Frame = 3
Query:  126 KNTAGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGV-QVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKL---DSMQTSGD--------PEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERIS----ERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRD 1985
            K+T  S DQ L V LRIRP+++ E   G  I+AH +D  M VL+DP+EDPDDILRANRSRE+ ++FD  F+ S SQEEV++ +T PLI  ++ GY ATVFAYG TG GKTYTMLG ++ PGI  + L  +F  +    DD ++ +S+SYLE+YNEMIRDLL  +S  LDLRED  GV QVAG+TE+      E+M+LL +GN  RT E T AN+ SSRSHAVLQV V  +SR R+  +++   +LF+IDLAGSERA+ T NRG+R+ EGAHINRSLLALGNCINAL+D NG +YVNYRDSKLTRLLKD+LGGN RTVMIAHI P++  FE+SRNTL YADRAK IRT++ KN+ +V++H+ QY N+IS+L+ EI RL+ K+    S Q S +         E      +  + +  ++++ LL AF++ +  +K L E   S+ ++ +++++  +II +WE +++ R S    ER  +S+ K+ E E+ +         +E+++V   R  L     E+ +++ Q+  LE    +   Q + LE  +P +V +   R++L LLC++H+LEI+  ++++  ++      + + +     +++ LC  II  Q   I D+ + +P  L+ LYD+Y R+
Sbjct:    2 KDTGESKDQQLTVALRIRPLSDAEQEEGSTIVAHRVDDQMIVLMDPMEDPDDILRANRSREKTYLFDVAFDFSASQEEVYRATTKPLIEGLISGYNATVFAYGPTGCGKTYTMLGTDKEPGIYVRTLNDLFHAIEETSDDMLYSVSMSYLEIYNEMIRDLLNPSSGFLDLREDSKGVIQVAGITEVSTINAQEIMELLVKGNKQRTQEPTAANQTSSRSHAVLQVAVKQQSRSRDVSQEVRFARLFMIDLAGSERAAQTQNRGQRLKEGAHINRSLLALGNCINALSDKNGNKYVNYRDSKLTRLLKDSLGGNSRTVMIAHISPASTAFEESRNTLTYADRAKSIRTRVKKNLMNVSYHIAQYTNIISDLRCEIERLKKKIAEQSSRQLSSERADIRNVQAEVQAHAGLQSRADMEQLREQLLHAFRQQMDIRKSLMELENSNMEIQIDKSKHLLIITDWEQERSRRRSKWRAERRKESVKKD-ESEKDSDSTESPPDTTETQDVLLARENLTFLAAEQKKIQKQKNLLEHQFVELRDQARRLEELLPRRVSSEEQREVLGLLCKVHELEIENAEMQSHALLKDNVIRQKNFVVQRFEQYSHLCDEIIQQQRQFIDDHSLPVPPYLQELYDMYMRE 636          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: KIF18A (kinesin family member 18A [Source:NCBI gene;Acc:101168106])

HSP 1 Score: 286.189 bits (731), Expect = 7.726e-82
Identity = 169/406 (41.63%), Postives = 260/406 (64.04%), Query Frame = 3
Query:  162 VCLRIRPVNEDEHNLGIPIIAHSMDGNMAV-----------XXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEENITLSMSDQIEEMK 1340
            V +R+RP N+ E       +   +D +M +               + + +   RAN+  +  FVFD VF+ + +Q EVF+ +T  ++  V++G+  TVFAYGATG GKT+TM+G  + PG++++ ++ +FK+M  ++++  F ++ SYLEVYNE IRDLL +N+  L++RED + GV V GLT  +  +   +++ L+ GN  RT   T  N  SSRSHAV Q+ +  + +  +  + +   K+ LIDLAGSERAS T  +G R+ EGA+INRSLLALGN INALADP  K+ ++ YRDSKLTR+LKD+LGGNCRTVMIA++ PS+  ++D+ NTL YA+RAK I+T +  NV  ++ H+ QY  +  + ++EI +L+ KL   +   +   +++L  S ++ E K
Sbjct:   11 VVVRVRPTNDSEKRENFRNVVQVVDNHMLIFDPKEENLSCFGPQRVRNRNINKRANK--DLKFVFDRVFDENSTQVEVFENTTKGVLDGVMNGFNCTVFAYGATGAGKTHTMIGSPDDPGVIYRTMKELFKRMEDVKEEKEFAVTFSYLEVYNEQIRDLL-ANAGPLNVREDSSKGVVVQGLTLHQPKSAEHLLEALDSGNRNRTQHPTDMNATSSRSHAVFQIYLRQQDKTASLNQNVCMAKMSLIDLAGSERASATNAKGARLREGANINRSLLALGNVINALADPKSKKAHIPYRDSKLTRILKDSLGGNCRTVMIANVSPSSKSYDDTHNTLKYANRAKEIKTSLKSNVVSLDSHIGQYAVICEKQRKEILQLKQKLKEYEAKREEPGSLSLISSQKLAEFK 413          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: KIF18A (kinesin family member 18A [Source:NCBI gene;Acc:101168106])

HSP 1 Score: 281.952 bits (720), Expect = 3.655e-80
Identity = 215/621 (34.62%), Postives = 345/621 (55.56%), Query Frame = 3
Query:   81 NVNINKFNCDMSFIRKNTAGSSDQN-----LMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXX-----------XXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQD--LDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNE 1883
            ++NI  F+  +      T+GS+  N     + V +R+RP N+ E       +   +D +M +     E+                RAN+  +  FVFD VF+ + +Q EVF+ +T  ++  V++G+  TVFAYGATG GKT+TM+G  + PG++++ ++ +FK+M  ++++  F ++ SYLEVYNE IRDLL +N+  L++RED + GV V GLT  +  +   +++ L+ GN  RT   T  N  SSRSHAV Q+ +  + +  +  + +   K+ LIDLAGSERAS T  +G R+ EGA+INRSLLALGN INALADP  K+ ++ YRDSKLTR+LKD+LGGNCRTVMIA++ PS+  ++D+ NTL YA+RAK I+T +  NV  ++ H+ QY  +  + ++EI +L+ KL   +     EE  +LS              L++ QK     + L +  +S   +  E+   +  +KE E +  +R SE +N  +      E+     +          + S+R + +    +RL+ + +   LE D  L +   ++K L++       N+   ++L+     H+LE+Q  D       L+QH  +  ++Q  LL+  E
Sbjct:    3 SINIYTFHYLVCRYSPATSGSTMANDVCSHVKVVVRVRPTNDSEKRENFRNVVQVVDNHMLIFDPKEENLSCFGPQRVRNRNINKRANK--DLKFVFDRVFDENSTQVEVFENTTKGVLDGVMNGFNCTVFAYGATGAGKTHTMIGSPDDPGVIYRTMKELFKRMEDVKEEKEFAVTFSYLEVYNEQIRDLL-ANAGPLNVREDSSKGVVVQGLTLHQPKSAEHLLEALDSGNRNRTQHPTDMNATSSRSHAVFQIYLRQQDKTASLNQNVCMAKMSLIDLAGSERASATNAKGARLREGANINRSLLALGNVINALADPKSKKAHIPYRDSKLTRILKDSLGGNCRTVMIANVSPSSKSYDDTHNTLKYANRAKEIKTSLKSNVVSLDSHIGQYAVICEKQRKEILQLKQKLKEYEAKR--EEPGSLS--------------LISSQKLAEVSEALQQIFSSRGQIRREQLDLERQLKENELR--QRYSEEDNLQVQYFCAKEK-----TEKATCKHERKIASLRTQQKHT-CQRLK-EAEARFLENDGLLHRVENEMKLLKT-------NDQTSEVLEKDLHCHRLELQVND-------LQQHVKQ--MVQLTLLQDQE 579          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: ENSORLT00000022071.2 (kinesin-like protein KIF3C [Source:NCBI gene;Acc:101173427])

HSP 1 Score: 226.868 bits (577), Expect = 2.467e-62
Identity = 155/392 (39.54%), Postives = 227/392 (57.91%), Query Frame = 3
Query:  144 SDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSR-ERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGI---NERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVV---LDLRED-QNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEIN--RLRNKLDSMQTSGD 1289
            S +++ V +R RP+N  E + G       + G + + L   +      RA+ S  ++ F FD V++ +  Q +++  S  PLI  VL G+  T+FAYG TGTGKTYTM G     E+ G++  A + +F  +   + D  + +  SYLE+Y E IRDLL  N      LDLRE  + GV V  LT     +  E+ +++N GN  R V AT  N+HSSRSHA+  + V       + ++ I  G+L L+DLAGSER + T   G+R+ E A IN SL ALGN I+ALAD     +V YRDSKLTRLL+D+LGGN +TVM+A +GP+  H++++  TL YA+RAK+I+ +   N    +  L ++   I+ LK ++N  R R+K    Q  G+
Sbjct:    6 SSESVKVVVRCRPLNRKEESSG------PVGGIVQMDLRLGQVILRNPRASPSEPQKTFTFDAVYDGNSKQRDLYDESVRPLIDSVLAGFNGTIFAYGQTGTGKTYTMQGAWLDPEKRGVIPNAFDHIFTHISRSQSDKQYLVRASYLEIYREEIRDLLDPNHSTTRGLDLRESPETGVYVQDLTSCVCKSIKEIEEVMNVGNQTRVVGATDMNEHSSRSHALFLITVECSQPGPDGRKHIRVGRLNLVDLAGSERQAKTGVHGERLKEAAKINLSLSALGNVISALADGRSG-HVPYRDSKLTRLLQDSLGGNAKTVMVATLGPAPAHYDETLTTLRYANRAKNIQNQPKVNEDPKDALLREFQKEIARLKAQLNHRRWRSKQKKEQVDGE 390          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000017021.1 (SMESG000017021.1)

HSP 1 Score: 1705.26 bits (4415), Expect = 0.000e+0
Identity = 895/895 (100.00%), Postives = 895/895 (100.00%), Query Frame = 3
Query:  159 MVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEKNYXXXXXXXXXXXXNVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRDDLTMTNNINMGLLDIDKDLYTYERILPAEIDSTSDIRDITSNMSVNEVQQEDESVASLPLINNPHATPESWDNESLRQGHKKLSMNNYAQSNFDIKYNDNGPKPAFESVPSTNRNLMISKPPISQLPYRLTQRYALPDLRSRQLAVQPEKKGNSRSRSFEPDLEISKXXXXXXXXXXXXXXXXXXXXXVRKLIVGPRSDKYDSGIFDLDLRGKKYLPKYEAYKTTPMSHRNDKKKKRSNSQKRIPKNTQTVKQAEEKYSNHLILRANEIKKLNERKALDNFDDVDS 2843
            MVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVLLDPLEDPDDILRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFAYGATGTGKTYTMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEKNYELSGLEFLSESENVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRDDLTMTNNINMGLLDIDKDLYTYERILPAEIDSTSDIRDITSNMSVNEVQQEDESVASLPLINNPHATPESWDNESLRQGHKKLSMNNYAQSNFDIKYNDNGPKPAFESVPSTNRNLMISKPPISQLPYRLTQRYALPDLRSRQLAVQPEKKGNSRSRSFEPDLEISKNNNNNSNNYYSNPPNRYANSNVRKLIVGPRSDKYDSGIFDLDLRGKKYLPKYEAYKTTPMSHRNDKKKKRSNSQKRIPKNTQTVKQAEEKYSNHLILRANEIKKLNERKALDNFDDVDS
Sbjct:    1 MVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVLLDPLEDPDDILRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFAYGATGTGKTYTMLGINERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLRNKLDSMQTSGDPEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSENITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEKNYELSGLEFLSESENVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKSLESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDLIQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRDDLTMTNNINMGLLDIDKDLYTYERILPAEIDSTSDIRDITSNMSVNEVQQEDESVASLPLINNPHATPESWDNESLRQGHKKLSMNNYAQSNFDIKYNDNGPKPAFESVPSTNRNLMISKPPISQLPYRLTQRYALPDLRSRQLAVQPEKKGNSRSRSFEPDLEISKNNNNNSNNYYSNPPNRYANSNVRKLIVGPRSDKYDSGIFDLDLRGKKYLPKYEAYKTTPMSHRNDKKKKRSNSQKRIPKNTQTVKQAEEKYSNHLILRANEIKKLNERKALDNFDDVDS 895          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000075065.1 (SMESG000075065.1)

HSP 1 Score: 221.09 bits (562), Expect = 7.369e-61
Identity = 148/372 (39.78%), Postives = 215/372 (57.80%), Query Frame = 3
Query:  153 NLMVCLRIRPVNEDEHNLGIPIIAH--SMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERP---GIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVV-LDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEI 1244
            N+ V +R RP+NE E   G  I A    ++G++ +        D          + F FD+VF  +  Q +V+     P++  VL GY  T+FAYG TGTGKT+TM G  + P   GI+  +   +F  +   E + +F + +SYLE+YNE +RDLLG +    L+++E  + GV V  L    V+  +E+  L+  GN  R   AT  N+HSSRSHA+  V V     + + ++   +GKL L+DLAGSER   T   G R+ E   IN SL  LGN I+AL D  GK  +V YR+SKLTRLL+D+LGGN +T+MIA+IGP+  +F++S ++L YA+RAK+IR K   N    +  L QY   +  L+Q++
Sbjct:    8 NVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPP--------KQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVD--GKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQL 369          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000075065.1 (SMESG000075065.1)

HSP 1 Score: 220.705 bits (561), Expect = 5.176e-60
Identity = 148/372 (39.78%), Postives = 215/372 (57.80%), Query Frame = 3
Query:  153 NLMVCLRIRPVNEDEHNLGIPIIAH--SMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGINERP---GIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVV-LDLREDQN-GVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR-YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEI 1244
            N+ V +R RP+NE E   G  I A    ++G++ +        D          + F FD+VF  +  Q +V+     P++  VL GY  T+FAYG TGTGKT+TM G  + P   GI+  +   +F  +   E + +F + +SYLE+YNE +RDLLG +    L+++E  + GV V  L    V+  +E+  L+  GN  R   AT  N+HSSRSHA+  V V     + + ++   +GKL L+DLAGSER   T   G R+ E   IN SL  LGN I+AL D  GK  +V YR+SKLTRLL+D+LGGN +T+MIA+IGP+  +F++S ++L YA+RAK+IR K   N    +  L QY   +  L+Q++
Sbjct:    8 NVKVVMRCRPLNEKELKQGCVIAAQVNELNGSITITNPKASVDDPP--------KQFTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGKDQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVD--GKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAIINEDPKDALLRQYQKELERLEQQL 369          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000024428.1 (SMESG000024428.1)

HSP 1 Score: 220.705 bits (561), Expect = 1.643e-58
Identity = 145/407 (35.63%), Postives = 227/407 (55.77%), Query Frame = 3
Query:  135 AGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGIN------ERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLL-------GSNSVVLDLREDQNGVQV-AGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVI-----------------SRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR--YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLR 1256
            + S++ N+ V  R+RP+          ++   ++G  + +    +    I+     ++R F FD VFN   +Q+E+++     L+  + DGY +T+FAYG TG+GKTYTM   N      E  GI+ +A+E +F  +   ++   F ++ S++EVY E +RDLL       G +   + +RED+ G  +  G+ E      +++++ L  G+A R  EAT  N+HSSRSH V  VNV+                 S S  +N  + ++ GK   +DLAGSERA  T N G R  E  HIN  LLALGN I+AL DP  K+  ++ YR+SK+TR+LKD+LGGN RT+MI  I P+  ++++S N+L YA+RA++IR K   N       +VQ  + I  L+++++R R
Sbjct:    4 SSSTETNVRVVTRVRPL----------LVKEKLNGEESCIRVSPDLKQVIV----GKDRGFTFDAVFNQKSNQDEIYQTCVKDLVKNIFDGYNSTIFAYGQTGSGKTYTMGTFNQEELIHEEKGIVPRAVEEIFTLITEKQNLVKFTVTASFIEVYKEEVRDLLDPSGNFSGQDGTSIQIREDERGNTILCGVYEHLCENQSDLLECLEIGSANRVTEATQMNEHSSRSHCVFTVNVVQEWSTSCVDLDLSYTENSESDKKNEIKNVVSGKFHFVDLAGSERAHKTGNVGDRFKESIHINSGLLALGNVISALGDPKKKKISHIPYRESKITRILKDSLGGNARTLMICCISPTISNYDESLNSLKYANRARNIRNKPIVNHDHTTRQIVQMQSEIIALREQLSRQR 396          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000024428.1 (SMESG000024428.1)

HSP 1 Score: 220.705 bits (561), Expect = 1.675e-58
Identity = 145/407 (35.63%), Postives = 227/407 (55.77%), Query Frame = 3
Query:  135 AGSSDQNLMVCLRIRPVNEDEHNLGIPIIAHSMDGNMAVXXXXXXXXXXXXRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFXXXXXXXXXXXXMLGIN------ERPGIMFKALESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLL-------GSNSVVLDLREDQNGVQV-AGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVI-----------------SRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALADPNGKR--YVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRLR 1256
            + S++ N+ V  R+RP+          ++   ++G  + +    +    I+     ++R F FD VFN   +Q+E+++     L+  + DGY +T+FAYG TG+GKTYTM   N      E  GI+ +A+E +F  +   ++   F ++ S++EVY E +RDLL       G +   + +RED+ G  +  G+ E      +++++ L  G+A R  EAT  N+HSSRSH V  VNV+                 S S  +N  + ++ GK   +DLAGSERA  T N G R  E  HIN  LLALGN I+AL DP  K+  ++ YR+SK+TR+LKD+LGGN RT+MI  I P+  ++++S N+L YA+RA++IR K   N       +VQ  + I  L+++++R R
Sbjct:    4 SSSTETNVRVVTRVRPL----------LVKEKLNGEESCIRVSPDLKQVIV----GKDRGFTFDAVFNQKSNQDEIYQTCVKDLVKNIFDGYNSTIFAYGQTGSGKTYTMGTFNQEELIHEEKGIVPRAVEEIFTLITEKQNLVKFTVTASFIEVYKEEVRDLLDPSGNFSGQDGTSIQIREDERGNTILCGVYEHLCENQSDLLECLEIGSANRVTEATQMNEHSSRSHCVFTVNVVQEWSTSCVDLDLSYTENSESDKKNEIKNVVSGKFHFVDLAGSERAHKTGNVGDRFKESIHINSGLLALGNVISALGDPKKKKISHIPYRESKITRILKDSLGGNARTLMICCISPTISNYDESLNSLKYANRARNIRNKPIVNHDHTTRQIVQMQSEIIALREQLSRQR 396          
The following BLAST results are available for this feature:
BLAST of Kinesin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF191.093e-14843.44kinesin family member 19 [Source:HGNC Symbol;Acc:H... [more]
KIF197.556e-13039.91kinesin family member 19 [Source:HGNC Symbol;Acc:H... [more]
KIF18B1.214e-8048.04kinesin family member 18B [Source:HGNC Symbol;Acc:... [more]
KIF18B1.517e-8048.18kinesin family member 18B [Source:HGNC Symbol;Acc:... [more]
KIF18B1.802e-8048.04kinesin family member 18B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-131.156e-7746.94Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-116.479e-5639.67Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
unc-1169.642e-5442.19Kinesin heavy chain [Source:UniProtKB/Swiss-Prot;... [more]
osm-31.231e-5338.96Osmotic avoidance abnormal protein 3 [Source:UniP... [more]
klp-204.965e-5337.77Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif19A1.875e-11136.36gene:FBgn0038205 transcript:FBtr0082912[more]
Klp67A1.801e-7145.40gene:FBgn0004379 transcript:FBtr0333886[more]
Klp67A4.490e-7145.40gene:FBgn0004379 transcript:FBtr0346530[more]
Klp67A4.490e-7145.40gene:FBgn0004379 transcript:FBtr0076499[more]
Klp68D1.442e-5636.54gene:FBgn0004381 transcript:FBtr0332129[more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-26i13.87.004e-14242.95si:dkey-26i13.8 [Source:ZFIN;Acc:ZDB-GENE-090312-1... [more]
kif196.423e-14143.64kinesin family member 19 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif191.823e-12542.37kinesin family member 19 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif18a6.920e-8645.48kinesin family member 18A [Source:ZFIN;Acc:ZDB-GEN... [more]
kif18a6.920e-8645.48kinesin family member 18A [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asah16.593e-15645.16N-acylsphingosine amidohydrolase (acid ceramidase)... [more]
asah14.092e-15445.17N-acylsphingosine amidohydrolase (acid ceramidase)... [more]
asah16.400e-15445.17N-acylsphingosine amidohydrolase (acid ceramidase)... [more]
asah11.466e-13941.72N-acylsphingosine amidohydrolase (acid ceramidase)... [more]
asah13.450e-12440.63N-acylsphingosine amidohydrolase (acid ceramidase)... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif19a2.763e-15344.46kinesin family member 19A [Source:MGI Symbol;Acc:M... [more]
Gm48694.478e-14542.52predicted gene 4869 [Source:MGI Symbol;Acc:MGI:364... [more]
Kif19a4.075e-13441.59kinesin family member 19A [Source:MGI Symbol;Acc:M... [more]
Kif18b1.519e-8149.84kinesin family member 18B [Source:MGI Symbol;Acc:M... [more]
Kif18a3.992e-7743.15kinesin family member 18A [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99PT9|KIF19_MOUSE1.933e-15244.46Kinesin-like protein KIF19 OS=Mus musculus OX=1009... [more]
sp|Q7ZXX2|KIF19_XENLA8.376e-15143.23Kinesin-like protein KIF19 OS=Xenopus laevis OX=83... [more]
sp|Q2TAC6|KIF19_HUMAN5.248e-14843.44Kinesin-like protein KIF19 OS=Homo sapiens OX=9606... [more]
sp|O14343|KLP5_SCHPO1.194e-8845.68Kinesin-like protein 5 OS=Schizosaccharomyces pomb... [more]
sp|P53086|KIP3_YEAST2.264e-8351.20Kinesin-like protein KIP3 OS=Saccharomyces cerevis... [more]
back to top
BLAST of Kinesin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG740.000e+081.82Kinesin-like protein OS=Dugesia japonica OX=6161 G... [more]
A0A210PH896.324e-17650.16Kinesin-like protein OS=Mizuhopecten yessoensis OX... [more]
A0A267FUD23.557e-17548.92Kinesin-like protein OS=Macrostomum lignano OX=282... [more]
A0A267GR451.242e-17448.76Kinesin-like protein OS=Macrostomum lignano OX=282... [more]
K1R6179.203e-17149.52Kinesin-like protein KIF19 OS=Crassostrea gigas OX... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif191.071e-13942.59kinesin family member 19 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif18a2.593e-8344.99kinesin family member 18A [Source:ZFIN;Acc:ZDB-GEN... [more]
kif41.876e-6038.42kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
kif3a1.931e-5938.20kinesin family member 3A [Source:NCBI gene;Acc:103... [more]
kif3a1.990e-5938.20kinesin family member 3A [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010887.13.460e-10361.09pep scaffold:Pmarinus_7.0:GL482947:9977:16429:1 ge... [more]
kif3ca2.242e-6238.90kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
KIF271.247e-6140.05kinesin family member 27 [Source:HGNC Symbol;Acc:H... [more]
kif3a2.475e-6137.96kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000001811.12.592e-5838.12pep scaffold:Pmarinus_7.0:GL477555:33781:61877:1 g... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIP33.261e-8551.20Kinesin-related antiparallel sliding motor protein... [more]
KIP11.215e-4434.55Kinesin-related motor protein; required for mitoti... [more]
KIP24.283e-3634.99Kinesin-related motor protein involved in mitotic ... [more]
KAR31.115e-3432.57Minus-end-directed microtubule motor; functions in... [more]
CIN83.149e-2939.08Kinesin motor protein; involved in mitotic spindle... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380702.721e-13460.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491316.005e-9146.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375296.506e-6143.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385919.634e-5538.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408361.094e-5440.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif194.002e-15944.96kinesin family member 19 [Source:NCBI gene;Acc:101... [more]
kif195.738e-15945.28kinesin family member 19 [Source:NCBI gene;Acc:101... [more]
KIF18A7.726e-8241.63kinesin family member 18A [Source:NCBI gene;Acc:10... [more]
KIF18A3.655e-8034.62kinesin family member 18A [Source:NCBI gene;Acc:10... [more]
ENSORLT00000022071.22.467e-6239.54kinesin-like protein KIF3C [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kinesin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017021.10.000e+0100.00SMESG000017021.1[more]
SMESG000075065.17.369e-6139.78SMESG000075065.1[more]
SMESG000075065.15.176e-6039.78SMESG000075065.1[more]
SMESG000024428.11.643e-5835.63SMESG000024428.1[more]
SMESG000024428.11.675e-5835.63SMESG000024428.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019972 ID=SMED30019972|Name=Kinesin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3105bp
TATGAAATAGATATATTACAACAAATCATTTATTAACGTTTTATTTTTCA
ATAATGATTAATAGAAGACTTTTCCACAAAAATGTAAATATCAACAAATT
CAACTGCGACATGTCGTTTATTAGGAAAAATACGGCCGGGAGTTCCGATC
AGAATCTGATGGTTTGCCTCAGAATCCGACCGGTGAATGAGGATGAACAC
AACCTCGGCATTCCCATTATAGCTCACAGTATGGACGGAAATATGGCAGT
GCTATTAGATCCCCTAGAAGATCCTGATGATATTCTACGAGCCAATAGAA
GTAGAGAGCGGCATTTCGTGTTTGATCACGTCTTCAATAGTTCTTGTAGT
CAGGAAGAAGTATTCAAGTTGTCAACATTACCACTTATCTCTCAAGTGCT
TGATGGCTATACAGCCACCGTGTTTGCCTACGGGGCGACCGGCACTGGTA
AAACCTACACCATGCTCGGAATAAATGAACGCCCAGGAATCATGTTTAAA
GCCTTGGAAAGCATGTTCAAACAGATGCACATGATGGAAGATGATTACAT
TTTCAAAATGTCTTTATCGTATTTGGAAGTGTACAATGAGATGATTCGAG
ATTTGTTGGGATCAAACTCAGTAGTGTTGGACCTGCGAGAAGACCAAAAC
GGAGTCCAAGTTGCCGGACTTACAGAAATCGAAGTAAACACCACAAATGA
GGTAATGGATTTGCTTAATCGAGGTAACGCCATGAGAACTGTCGAGGCTA
CTGGAGCCAACAAACATAGCAGTAGATCTCATGCTGTTCTTCAGGTAAAT
GTAATTTCTCGATCTCGGGTCAGAAATACTCAGGAACAAATCATGAAAGG
AAAGTTGTTTCTAATTGATCTAGCAGGTTCAGAAAGAGCTTCTAATACTC
TGAATCGAGGCAAAAGAATGACTGAAGGAGCTCATATCAATCGATCATTA
TTAGCTCTTGGTAATTGTATAAATGCGTTAGCTGACCCCAATGGCAAAAG
ATATGTCAATTATAGAGACAGTAAGTTAACTCGATTGCTTAAAGATGCTC
TGGGAGGAAATTGTAGAACTGTCATGATTGCTCATATCGGTCCAAGTGCG
TTACATTTTGAAGATAGTAGGAACACTTTGGTTTATGCTGATCGGGCTAA
ACATATTCGTACAAAGATCCATAAAAATGTATATGATGTCAATTTCCACT
TGGTGCAATACAATAATGTAATTTCTGAATTAAAACAAGAAATTAATCGA
CTTCGAAACAAATTAGATTCCATGCAGACTTCTGGTGATCCTGAAGAGAA
TATTACCTTATCGATGAGTGATCAAATTGAAGAAATGAAGATAAAAGATA
ATTTGTTGGTGGCCTTCCAAAAGCATGTTGGCTGCAAGAAAATTTTATCA
GAAAATATTACGAGTGATTTTGATTTGAGTTTAGAGGAAACTCGATGCCA
AGTCATTATCAAAGAATGGGAAAGTAAGAAAGCTGAAAGAATTTCCGAAA
GGGAAAACAAAAGTCTAGATAAGGAAATTGAAGACGAAGAGAAAAATTAC
GAATTATCGGGACTGGAATTTTTGAGCGAATCTGAAAACGTCAAATCAGT
ACGTAACGAATTGCGAATGGCCCAAATGGAGCGCTTGAGACTGAAAACGC
AAAGAGAGAAATTGGAACAAGACCTGGATAAATATGCCATTCAAATCAAA
TCTTTGGAATCCGCGATCCCGGAGAAAGTGAAGAACAATCATGCCAGACA
AATGTTGCAGCTCCTTTGCCAAATGCATAAATTGGAAATCCAGCAAACGG
ATTTGCGCACAGAAAATGTCGTCCTTCGGCAACATGCTTCAAAACATGAT
CTGATACAATCGGTATTATTGAAGCACAATGAGCTCTGCAAAAGGATTAT
CACAGCTCAATCATCACTCATTAAAGATTACGGCGTTGATTTGCCCAAGG
ATTTGGAAATGCTTTATGACTTGTACACTCGGGATGACCTGACCATGACC
AATAACATAAATATGGGCCTCCTCGATATTGATAAGGATTTATACACCTA
TGAAAGAATTCTGCCAGCGGAAATTGATTCGACAAGTGACATCCGTGATA
TCACGTCGAATATGAGTGTCAATGAGGTGCAGCAAGAGGATGAATCCGTT
GCCAGCTTACCCCTTATCAATAACCCCCACGCCACCCCAGAGTCCTGGGA
TAATGAAAGTTTGCGTCAAGGTCATAAGAAATTATCAATGAACAATTACG
CCCAATCAAATTTTGACATCAAATACAATGATAACGGACCCAAACCGGCT
TTTGAGTCTGTCCCAAGCACCAACAGAAATTTGATGATATCCAAACCTCC
AATTAGTCAATTGCCGTATCGTTTGACGCAGAGATATGCGTTACCGGATC
TTCGAAGTCGACAGTTGGCCGTACAGCCGGAAAAAAAAGGCAATTCTAGA
TCGCGGTCTTTCGAACCTGATCTTGAAATATCAAAGAATAACAACAACAA
CAGCAACAATTACTATTCCAATCCTCCTAATCGTTATGCGAATTCAAATG
TCCGTAAATTGATAGTCGGGCCGAGGTCTGATAAATATGATAGCGGGATT
TTCGATCTGGATCTGAGAGGTAAAAAGTATCTACCGAAATATGAAGCCTA
CAAAACGACCCCGATGTCCCACAGAAATGACAAAAAGAAAAAACGATCAA
ATTCCCAGAAAAGAATTCCTAAAAATACTCAAACTGTGAAACAAGCTGAA
GAGAAATATTCAAATCATCTCATTCTCAGAGCTAATGAAATCAAAAAGCT
CAACGAACGGAAAGCCCTTGACAATTTCGACGATGTCGACTCATGGAATA
ATTTACATTTGTAATGATGGAATTGTCTTTTGTCTTTTATACTTGATCAG
AGATTTCCAATGTGTGATTGTGTGTAATTTTTTTGTCATGTTTTCCTAAA
CTTATACATTTTCAATTTCTCTTCAAATCATGCTTTCAAAGTTGAAGCAA
CATATTCTTTAATTATTGAATTTATTTCTTTTTTGAGTGCTGTCAATTGA
ATTGGTTGAACATTCGGTTATTATTTCTATTATTATATTTATGCGCTAAA
AAAAA
back to top

protein sequence of SMED30019972-orf-1

>SMED30019972-orf-1 ID=SMED30019972-orf-1|Name=SMED30019972-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=937bp
MINRRLFHKNVNINKFNCDMSFIRKNTAGSSDQNLMVCLRIRPVNEDEHN
LGIPIIAHSMDGNMAVLLDPLEDPDDILRANRSRERHFVFDHVFNSSCSQ
EEVFKLSTLPLISQVLDGYTATVFAYGATGTGKTYTMLGINERPGIMFKA
LESMFKQMHMMEDDYIFKMSLSYLEVYNEMIRDLLGSNSVVLDLREDQNG
VQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNV
ISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLL
ALGNCINALADPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSAL
HFEDSRNTLVYADRAKHIRTKIHKNVYDVNFHLVQYNNVISELKQEINRL
RNKLDSMQTSGDPEENITLSMSDQIEEMKIKDNLLVAFQKHVGCKKILSE
NITSDFDLSLEETRCQVIIKEWESKKAERISERENKSLDKEIEDEEKNYE
LSGLEFLSESENVKSVRNELRMAQMERLRLKTQREKLEQDLDKYAIQIKS
LESAIPEKVKNNHARQMLQLLCQMHKLEIQQTDLRTENVVLRQHASKHDL
IQSVLLKHNELCKRIITAQSSLIKDYGVDLPKDLEMLYDLYTRDDLTMTN
NINMGLLDIDKDLYTYERILPAEIDSTSDIRDITSNMSVNEVQQEDESVA
SLPLINNPHATPESWDNESLRQGHKKLSMNNYAQSNFDIKYNDNGPKPAF
ESVPSTNRNLMISKPPISQLPYRLTQRYALPDLRSRQLAVQPEKKGNSRS
RSFEPDLEISKNNNNNSNNYYSNPPNRYANSNVRKLIVGPRSDKYDSGIF
DLDLRGKKYLPKYEAYKTTPMSHRNDKKKKRSNSQKRIPKNTQTVKQAEE
KYSNHLILRANEIKKLNERKALDNFDDVDSWNNLHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027640Kinesin-like_fam
IPR001752Kinesin_motor_dom
IPR019821Kinesin_motor_CS
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0005524ATP binding
GO:0003777microtubule motor activity
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 478..498
NoneNo IPR availableCOILSCoilCoilcoord: 513..554
NoneNo IPR availableCOILSCoilCoilcoord: 383..410
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 807..827
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 865..899
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 785..827
NoneNo IPR availablePANTHERPTHR24115:SF549KINESIN-LIKE PROTEINcoord: 35..646
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 233..250
score: 50.19
coord: 267..285
score: 53.55
coord: 118..139
score: 66.14
coord: 318..339
score: 61.44
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 32..376
e-value: 6.9E-143
score: 490.7
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 40..368
e-value: 3.3E-108
score: 361.5
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 34..368
score: 108.715
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 25..375
e-value: 2.7E-132
score: 442.8
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 35..646
IPR019821Kinesin motor domain, conserved sitePROSITEPS00411KINESIN_MOTOR_1coord: 266..277
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 34..406