Voltage-gated hydrogen channel 1

Overview
NameVoltage-gated hydrogen channel 1
Smed IDSMED30019965
Length (bp)1796
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage-gated hydrogen channel 1 (SMED30019965) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage-gated hydrogen channel 1 (SMED30019965) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage-gated hydrogen channel 1 (SMED30019965) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage-gated hydrogen channel 1 (SMED30019965) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019965

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019965SMESG000077167.1 SmedASXL_010044SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30019965SMESG000077167.1 dd_Smed_v6_14047_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
whole organismSMED30019965SMESG000077556.1 SMESG000077167.1 SMESG000071434.1 SMESG000021640.1 SMESG000018675.1 Contig19453newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30019965SMESG000077556.1 SMESG000077167.1 SMESG000071434.1 SMESG000021640.1 SMESG000018675.1 Contig19453uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 62.7734 bits (151), Expect = 2.893e-10
Identity = 34/91 (37.36%), Postives = 58/91 (63.74%), Query Frame = 1
Query:  856 ASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQ--EISVMIIFLLWRIVRVINGLIMHEKQRDE 1122
            A+ + H+ SI +L  F++E+  K+      FF  +FE++DA+V++ SFI DIV++    Q   + ++I+  LWR+ R+ING+I+  K R E
Sbjct:  115 AAMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE 205          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 62.7734 bits (151), Expect = 3.134e-10
Identity = 34/91 (37.36%), Postives = 58/91 (63.74%), Query Frame = 1
Query:  856 ASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQ--EISVMIIFLLWRIVRVINGLIMHEKQRDE 1122
            A+ + H+ SI +L  F++E+  K+      FF  +FE++DA+V++ SFI DIV++    Q   + ++I+  LWR+ R+ING+I+  K R E
Sbjct:  135 AAMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE 225          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 62.7734 bits (151), Expect = 3.440e-10
Identity = 34/91 (37.36%), Postives = 58/91 (63.74%), Query Frame = 1
Query:  856 ASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQ--EISVMIIFLLWRIVRVINGLIMHEKQRDE 1122
            A+ + H+ SI +L  F++E+  K+      FF  +FE++DA+V++ SFI DIV++    Q   + ++I+  LWR+ R+ING+I+  K R E
Sbjct:  135 AAMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE 225          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 62.7734 bits (151), Expect = 3.440e-10
Identity = 34/91 (37.36%), Postives = 58/91 (63.74%), Query Frame = 1
Query:  856 ASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQ--EISVMIIFLLWRIVRVINGLIMHEKQRDE 1122
            A+ + H+ SI +L  F++E+  K+      FF  +FE++DA+V++ SFI DIV++    Q   + ++I+  LWR+ R+ING+I+  K R E
Sbjct:  135 AAMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE 225          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 62.7734 bits (151), Expect = 3.440e-10
Identity = 34/91 (37.36%), Postives = 58/91 (63.74%), Query Frame = 1
Query:  856 ASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQ--EISVMIIFLLWRIVRVINGLIMHEKQRDE 1122
            A+ + H+ SI +L  F++E+  K+      FF  +FE++DA+V++ SFI DIV++    Q   + ++I+  LWR+ R+ING+I+  K R E
Sbjct:  135 AAMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE 225          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Zebrafish
Match: hvcn1 (hydrogen voltage-gated channel 1 [Source:NCBI gene;Acc:436618])

HSP 1 Score: 68.1662 bits (165), Expect = 2.246e-12
Identity = 39/108 (36.11%), Postives = 64/108 (59.26%), Query Frame = 1
Query:  856 ASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQE-----ISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISE 1164
            A ++ H+ S+ALL  F+VEL  KI      F   +FEV D IV++ SFI DI+ +   S+E     + ++I+  LWR+ R+ING+++  + R   R+   +K + I+E
Sbjct:  100 APQVFHYLSLALLTFFMVELAGKIFAYRLEFLHHKFEVFDGIVVVVSFILDIIYI---SKEDAFDAMGLLILLRLWRVARIINGILVSVQNRANHRV---EKLKEINE 201          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Zebrafish
Match: tmem266 (transmembrane protein 266 [Source:ZFIN;Acc:ZDB-GENE-070112-2382])

HSP 1 Score: 50.8322 bits (120), Expect = 3.767e-6
Identity = 30/112 (26.79%), Postives = 57/112 (50.89%), Query Frame = 1
Query:  865 MLHFASIALLGLFVVELTVKILCIG-PTFFKARFEVIDAIVILTSFIADIVIVVVGS-----QEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDL 1182
            ++H+ S+ +L +F  E   +I+ +G   + + + EV D  VI+ S    +   V          IS++I   +WR+ R+I+  ++  K   EL I   +K++ + E +LE L
Sbjct:  132 IIHWISLVILSVFFTETVFRIVVLGIWDYIENKVEVFDGAVIVLSLAPMVASTVANGPSSPWDAISLIITLRIWRVKRIIDAYVLQVKVEMELEIQQYEKSKAVREEQLERL 243          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Xenopus
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:NCBI gene;Acc:496712])

HSP 1 Score: 67.0106 bits (162), Expect = 5.423e-12
Identity = 35/99 (35.35%), Postives = 60/99 (60.61%), Query Frame = 1
Query:  850 HKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQE-----ISVMIIFLLWRIVRVINGLIMHEKQRDELRI 1131
            H   E+ H+ SI++L  F++E+  K+      FF  +FEV DA +++ SFI DIV +   S+E     + ++I+  LWR+ R++NG+I+  K + E +I
Sbjct:   91 HIIPEIFHYLSISVLSFFILEIAGKLYAFRLEFFHHKFEVFDAAIVVISFIIDIVYI---SREDIFNAVGLLILLRLWRVARIVNGIIVSVKTQAEDKI 186          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Xenopus
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:NCBI gene;Acc:496712])

HSP 1 Score: 66.2402 bits (160), Expect = 1.236e-11
Identity = 35/99 (35.35%), Postives = 60/99 (60.61%), Query Frame = 1
Query:  850 HKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQE-----ISVMIIFLLWRIVRVINGLIMHEKQRDELRI 1131
            H   E+ H+ SI++L  F++E+  K+      FF  +FEV DA +++ SFI DIV +   S+E     + ++I+  LWR+ R++NG+I+  K + E +I
Sbjct:   91 HIIPEIFHYLSISVLSFFILEIAGKLYAFRLEFFHHKFEVFDAAIVVISFIIDIVYI---SREDIFNAVGLLILLRLWRVARIVNGIIVSVKTQAEDKI 186          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Xenopus
Match: mcf2l2 (MCF.2 cell line derived transforming sequence-like 2 [Source:Xenbase;Acc:XB-GENE-6037884])

HSP 1 Score: 53.9138 bits (128), Expect = 5.310e-7
Identity = 34/116 (29.31%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  853 KASEMLHFASIALLGLFVVELTVKILCIG-PTFFKARFEVIDAIVILTSFIADIVIVVVGS-----QEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDL 1182
            + S ++H+ S+A+L +F VE  ++I+ +G   + + + EVID  VI+ S    +   V          IS+ I   +WR+ R+I+  I+  K   E+ +   +KA+ I E ++E L
Sbjct:   72 QCSGIIHWISLAILSMFFVETVLRIVILGIWDYIENKVEVIDGAVIVLSLAPMVASTVANGPSSPWDAISLFISLRIWRVKRIIDAYILPVKVEMEILVQQYEKAKLIQEEQMEHL 187          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Match: Hvcn1 (hydrogen voltage-gated channel 1 [Source:MGI Symbol;Acc:MGI:1921346])

HSP 1 Score: 61.2326 bits (147), Expect = 6.648e-10
Identity = 34/99 (34.34%), Postives = 59/99 (59.60%), Query Frame = 1
Query:  856 ASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGS--QEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKK 1146
            A    H+ S A+L  F++E+  KI      FF  +FE++DA V++ SF+ D+V++      + + ++I+  LWR+ R+ING+I+  K R E +I   K+
Sbjct:  131 AVTAFHYMSFAILVFFMLEIFFKIFVFRLEFFHHKFEILDAFVVVVSFVLDLVLLFKSHHFEALGLLILLRLWRVARIINGIIISVKTRSERQILRLKQ 229          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Match: Hvcn1 (hydrogen voltage-gated channel 1 [Source:MGI Symbol;Acc:MGI:1921346])

HSP 1 Score: 61.2326 bits (147), Expect = 6.648e-10
Identity = 34/99 (34.34%), Postives = 59/99 (59.60%), Query Frame = 1
Query:  856 ASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGS--QEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKK 1146
            A    H+ S A+L  F++E+  KI      FF  +FE++DA V++ SF+ D+V++      + + ++I+  LWR+ R+ING+I+  K R E +I   K+
Sbjct:  131 AVTAFHYMSFAILVFFMLEIFFKIFVFRLEFFHHKFEILDAFVVVVSFVLDLVLLFKSHHFEALGLLILLRLWRVARIINGIIISVKTRSERQILRLKQ 229          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Match: Tmem266 (transmembrane protein 266 [Source:MGI Symbol;Acc:MGI:2142980])

HSP 1 Score: 51.2174 bits (121), Expect = 3.455e-6
Identity = 32/120 (26.67%), Postives = 63/120 (52.50%), Query Frame = 1
Query:  841 TNLHKASEMLHFASIALLGLFVVELTVKILCIG-PTFFKARFEVIDAIVILTSFIADIVIVVVGSQE-----ISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDL 1182
            +N  + + ++H+ S+ +L +F  E  ++I+ +G   + + + EV D  VI+ S    +   V          IS++I+F +WR+ RVI+  ++  K   E+     +KA+ I + +LE L
Sbjct:  129 SNAFQFAGVIHWISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIILSLAPMVASTVANGPRSPWDAISLIIMFRIWRVKRVIDAYVLPVKLEMEMVTQQYEKAKAIQDEQLERL 248          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q5F4C0|HVCN1_CHICK (Voltage-gated hydrogen channel 1 OS=Gallus gallus OX=9031 GN=HVCN1 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.689e-14
Identity = 36/93 (38.71%), Postives = 62/93 (66.67%), Query Frame = 1
Query:  850 HKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGS--QEISVMIIFLLWRIVRVINGLIMHEKQRDE 1122
            H A ++ H+ S+++L +F+VE+  KI   G  FF  +FEV+D+IV++ SFI D+V++      + + ++I+  LWR+ R+ING+I+  K R E
Sbjct:   95 HIAPKVFHYLSLSILTIFLVEVGFKIFVYGREFFHHKFEVLDSIVVVVSFILDLVLLFREHEFEAVGLLILLRLWRVARIINGIILSVKTRSE 187          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q6DHQ1|HVCN1_DANRE (Voltage-gated hydrogen channel 1 OS=Danio rerio OX=7955 GN=hvcn1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.971e-11
Identity = 39/108 (36.11%), Postives = 64/108 (59.26%), Query Frame = 1
Query:  856 ASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQE-----ISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISE 1164
            A ++ H+ S+ALL  F+VEL  KI      F   +FEV D IV++ SFI DI+ +   S+E     + ++I+  LWR+ R+ING+++  + R   R+   +K + I+E
Sbjct:  100 APQVFHYLSLALLTFFMVELAGKIFAYRLEFLHHKFEVFDGIVVVVSFILDIIYI---SKEDAFDAMGLLILLRLWRVARIINGILVSVQNRANHRV---EKLKEINE 201          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q5M7E9|HVCN1_XENLA (Voltage-gated hydrogen channel 1 OS=Xenopus laevis OX=8355 GN=hvcn1 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.554e-11
Identity = 35/96 (36.46%), Postives = 58/96 (60.42%), Query Frame = 1
Query:  850 HKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQE-----ISVMIIFLLWRIVRVINGLIMHEKQRDE 1122
            H   E+ H+ SI++L  F++E+  K+      FF  +FEV DA +++ SFI DIV +   S+E     + ++I+  LWR+ R++NG+I+  K R E
Sbjct:   91 HIIPEIFHYLSISVLTFFILEIAGKLYAFRLEFFHHKFEVFDAAIVVISFIIDIVYI---SREDIFNAVGLLILLRLWRVARIVNGVIVSVKTRAE 183          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q5M8L8|HVCN1_XENTR (Voltage-gated hydrogen channel 1 OS=Xenopus tropicalis OX=8364 GN=hvcn1 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 6.548e-11
Identity = 35/99 (35.35%), Postives = 60/99 (60.61%), Query Frame = 1
Query:  850 HKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQE-----ISVMIIFLLWRIVRVINGLIMHEKQRDELRI 1131
            H   E+ H+ SI++L  F++E+  K+      FF  +FEV DA +++ SFI DIV +   S+E     + ++I+  LWR+ R++NG+I+  K + E +I
Sbjct:   91 HIIPEIFHYLSISVLSFFILEIAGKLYAFRLEFFHHKFEVFDAAIVVISFIIDIVYI---SREDIFNAVGLLILLRLWRVARIVNGIIVSVKTQAEDKI 186          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q96D96|HVCN1_HUMAN (Voltage-gated hydrogen channel 1 OS=Homo sapiens OX=9606 GN=HVCN1 PE=1 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.652e-9
Identity = 34/91 (37.36%), Postives = 58/91 (63.74%), Query Frame = 1
Query:  856 ASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQ--EISVMIIFLLWRIVRVINGLIMHEKQRDE 1122
            A+ + H+ SI +L  F++E+  K+      FF  +FE++DA+V++ SFI DIV++    Q   + ++I+  LWR+ R+ING+I+  K R E
Sbjct:  135 AAMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE 225          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: A0A1I8GWV1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 5.936e-58
Identity = 114/232 (49.14%), Postives = 151/232 (65.09%), Query Frame = 1
Query:  847 LHKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAHATNKFIHKFVFHSNSTSPVFSNKTQGNSY-VISEESSI----NSSKANCNYKPML 1527
            LH AS +LHF SIA+L LFV E+ +KI+C+G  F + RFEV+DA+VI  SF+AD+V V + S E+SV+++FLLWRIVRVINGL+MHEKQRDE RI LQK+ARRISEMK E L   +++QEKH I+LEELC   GA+ +    CKPKF  I+K  +NN +KS+AA+++G  G I  +H        F     S S   S     +    I+E+ +I    N     C  +P L
Sbjct:   78 LHSASAVLHFVSIAILALFVSEVALKIVCLGRGFLRDRFEVVDAVVIAVSFVADVVFVKLESSEVSVIVLFLLWRIVRVINGLMMHEKQRDEFRIQLQKRARRISEMKCESLENDRDLQEKHAIMLEELCRELGATEEQTANCKPKFVCISKQQSNNAVKSMAAMSAGIFGGIAASHHRRTLNATFSTGEASASATASPGASSSRLDPIAEDQAISMATNGENGGCR-RPQL 308          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: A0A0X3NWB3 (Voltage-gated hydrogen channel 1 OS=Schistocephalus solidus OX=70667 GN=HVCN1 PE=4 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 9.646e-58
Identity = 145/408 (35.54%), Postives = 228/408 (55.88%), Query Frame = 1
Query:  301 WLNDTKFLQQLSEDNIDIDILNKELYAEESCRKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQMRD-----TIHFLNHTFVDTHIFDNVDIQALEESPST-HKEXXXXXXXX---XXXXXXXXXXXXXXXXXCFKNSPVNGSHPKEK--TQITKHGH--QEATYIKQHRST------NLHKASEMLHFA-------SIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAH-ATNKFIHKFVFHSNSTSPVFSN 1443
            W N   F +QL++DNID+DILN EL      R+    Q+ +L+ L+    Q L+  LVL+D+ +VIAEI+LEI S++N  + ++ + R+         L +T ++T   ++     +  S +  H E     Q L    +L       ++ +   C++   + G +P +   +QI        + + + Q  S       NL   S  LHFA       SI +  LF+V + +K++C+   FF   +EVIDA+VIL SF++DI  V V SQEIS M++ LLWRI R+IN ++M+E+QR E R+ LQK+ARR+ E K++ L   KE+ +K    LEEL    G+  + I+ CKP++   +K  T N LKSIAALT+GFMG ++GA  +  + + +F  ++N+ SP+  N
Sbjct:   39 WTNSKTFTKQLAKDNIDVDILNDELMRHAERRRSRRFQERLLSKLRSSAAQFLLCFLVLLDSCLVIAEIILEIRSIQNFKQLFTIKGRELGSLMLTQALKNTALNTSCLNSEGSNKVPPSSNEIHTETANGFQRLFSHTVLNDERTIEELDNFILCWQKLFLLGDNPSQSHDSQILCESDLLSKCSVVSQTSSAEKELNENLTDPSS-LHFASEVMHFISIGVTSLFIVCIVLKLVCLRRKFFTNVYEVIDALVILVSFLSDICYVRVDSQEISAMVVLLLWRIARLINAMLMYERQRCEFRVTLQKRARRLEEKKVDILERDKELFQKQISALEELSRSLGSPEENIRDCKPRYVRHSKEQTQNALKSIAALTTGFMGGMIGAPISRQEELARFAGNNNAGSPLPPN 445          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: A0A0X3PUC0 (Voltage-gated hydrogen channel 1 OS=Schistocephalus solidus OX=70667 GN=HVCN1 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 6.376e-56
Identity = 145/408 (35.54%), Postives = 225/408 (55.15%), Query Frame = 1
Query:  301 WLNDTKFLQQLSEDNIDIDILNKELYAEESCRKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQMRD-----TIHFLNHTFVDTHIFDNVDIQALEESPST-HKEXXXXXXXXXXXXXXXXXXXXXXXXX---CFKNSPVNGSHPKEK--TQITKHGH--QEATYIKQHRST------NLHKASEMLHFA-------SIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAH-ATNKFIHKFVFHSNSTSPVFSN 1443
            W N   F +QL++DNID+DILN EL      R+    Q+ +L+ L+    Q L+  LVL+D+ +VIAEI+LEI S++N  + ++ + R+         L +T ++T   ++     +  S +  H E     Q L           I+       C++   + G +P +   +QI        + + + Q  S       NL   S  LHFA       SI +  LF+V + +K++C+   FF   +EVIDA+VIL SF++DI  V V SQEIS M++ LLWRI R+IN ++M+E+QR E R+ LQK+ARR+ E K++ L   KE+ +K    LEEL    G+  + I+ CKP++   +K  T N LKSIAALT+GFMG ++GA  +  + + +F  ++N+ SP+  N
Sbjct:   39 WTNSKTFTKQLAKDNIDVDILNDELMRHAERRRSRRFQERLLSKLRSSAAQFLLCFLVLLDSCLVIAEIILEIRSIQNFKQLFTIKGRELGSLMLTQALKNTALNTSCLNSEGSNKVPPSSNEIHTETANGFQRLFSHTVLNDERTIEELDNFILCWQKLFLLGDNPSQSHDSQILCESDLLSKCSVVSQTSSAEKELNENLTDPSS-LHFASEVMHFISIGVTSLFIVCIVLKLVCLRRKFFTNVYEVIDALVILVSFLSDICYVRVDSQEISAMVVLLLWRIARLINAMLMYERQRCEFRVTLQKRARRLEEKKVDILERDKELFQKQISALEELSRSLGSPEENIRDCKPRYVRHSKEQTQNALKSIAALTTGFMGGMIGAPISRQEELARFAGNNNAGSPLPPN 445          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: A0A0X3Q7V7 (Voltage-gated hydrogen channel 1 OS=Schistocephalus solidus OX=70667 GN=HVCN1 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 7.325e-56
Identity = 142/408 (34.80%), Postives = 225/408 (55.15%), Query Frame = 1
Query:  301 WLNDTKFLQQLSEDNIDIDILNKELYAEESCRKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQMRD-----TIHFLNHTFVDTHIFDNVDIQALEESPST-HKEXXXXXXXXXXXXXXXXXXXXXXXXX---CFKNSPVNGSHPKEK--TQITKHGH--------QEATYIKQHRSTNLHKASEMLHFA-------SIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAH-ATNKFIHKFVFHSNSTSPVFSN 1443
            W N   F +QL++DNID+DILN EL      R+    Q+ +L+ L+    Q L+  LVL+D+ +VIAEI+LEI S++N  + ++ + R+         L +T ++T   ++     +  S +  H E     Q L           I+       C++   + G +P +   +QI              + +  ++  + NL   S + HFA       SI +  LF+V + +K++C+   FF   +EVIDA+VIL SF++DI  V V SQEIS M++ LLWRI R+IN ++M+E+QR E R+ LQK+ARR+ E K++ L   KE+ +K    LEEL    G+  + I+ CKP++   +K  T N LKSIAALT+GFMG ++GA  +  + + +F  ++N+ SP+  N
Sbjct:   39 WTNSKTFTKQLAKDNIDVDILNDELMRHAERRRSRRFQERLLSKLRSSAAQFLLCFLVLLDSCLVIAEIILEIRSIQNFKQLFTIKGRELGSLMLTQALKNTALNTSCLNSEGSNKVPPSSNEIHTETANGFQRLFSHTVLNDERTIEELDNFILCWQKLFLLGDNPSQSHDSQILCESDLLSKCSVVSQTSSAEKELNENLTDPSSL-HFASEVMHFISIGVTSLFIVCIVLKLVCLRRKFFTNVYEVIDALVILVSFLSDICYVRVDSQEISAMVVLLLWRIARLINAMLMYERQRCEFRVTLQKRARRLEEKKVDILERDKELFQKQISALEELSRSLGSPEENIRDCKPRYVRHSKEQTQNALKSIAALTTGFMGGMIGAPISRQEELARFAGNNNAGSPLPPN 445          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: A0A0R3T0R3 (Ion_trans domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS428 PE=4 SV=2)

HSP 1 Score: 203.371 bits (516), Expect = 8.848e-55
Identity = 100/195 (51.28%), Postives = 139/195 (71.28%), Query Frame = 1
Query:  847 LHKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAHATNK-FIHKFVFHSNSTS 1428
            LH+ASE +H+ SI + GLF+V   +KI+C+G  FF   +EVIDA+VILTSFI+DI  + + SQEI+ M++ LLWRIVR+IN ++M+E+QR E R+ LQK+ARR+ E K+++L   KE+QEKH   LEEL    G S + ++ CKP++   +K  T N LKSIAALT+GFMG +VGA  T K  I +F  +S  T+
Sbjct:  275 LHRASEAMHYISIGVTGLFIVTTVLKIVCLGRKFFSNVYEVIDALVILTSFISDISYIKLDSQEIAAMVLLLLWRIVRLINAMLMYERQRCEFRVVLQKRARRLQERKVDNLQRTKELQEKHITNLEELARNIGCSEETLRDCKPRYVYHSKEQTQNALKSIAALTTGFMGGLVGAPFTQKDSIARFATNSLPTA 469          

HSP 2 Score: 67.0106 bits (162), Expect = 6.141e-8
Identity = 34/78 (43.59%), Postives = 50/78 (64.10%), Query Frame = 1
Query:  301 WLNDTKFLQQLSEDNIDIDILNKELYAEESCRKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKN 534
            W N   F++QL++DN D  +LN+EL      R++   +   L   + +  QIL+ ILVLID+GIVI EI+LEI S++N
Sbjct:   57 WANSKAFIKQLAKDNTDPSLLNEELQRHAENRRRRSWRAKCLGRFRSNIAQILLCILVLIDSGIVITEIILEIRSIQN 134          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Cavefish
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:NCBI gene;Acc:103044620])

HSP 1 Score: 70.8626 bits (172), Expect = 1.640e-13
Identity = 36/92 (39.13%), Postives = 58/92 (63.04%), Query Frame = 1
Query:  856 ASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQE-----ISVMIIFLLWRIVRVINGLIMHEKQR 1116
            A ++ H+ S+ALL  F+VEL +K+      FFK +FEV D IV++ SF+ DIV +   S+E     +  +I+  LWR+ R+ING+++  + R
Sbjct:   94 APQVFHYLSLALLTFFMVELLLKLFAYRLEFFKHKFEVFDGIVVVVSFVLDIVYI---SKEDAFDGMGFLILLRLWRVARIINGILVTVENR 182          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Cavefish
Match: tmem266 (transmembrane protein 266 [Source:ZFIN;Acc:ZDB-GENE-070112-2382])

HSP 1 Score: 53.5286 bits (127), Expect = 4.523e-7
Identity = 32/120 (26.67%), Postives = 61/120 (50.83%), Query Frame = 1
Query:  841 TNLHKASEMLHFASIALLGLFVVELTVKILCIG-PTFFKARFEVIDAIVILTSFIADIVIVVVGS-----QEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDL 1182
            TN  + + ++H+ S+ +L +F  E   +I+ +G   + + + EV D  VI+ S    +   V          IS++I   +WR+ R+I+  ++  K   EL +   +KA+ + E +LE L
Sbjct:  123 TNAFQFAGIIHWISLVILSVFFTETVFRIVVLGIWDYIENKVEVFDGAVIVLSLAPMVASTVANGPSSPWDAISLIITLRIWRVKRIIDAYVLQVKVEMELELQQYEKAKAVREEQLERL 242          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Sea Lamprey
Match: hvcn1 (hydrogen voltage-gated channel 1 [Source:NCBI gene;Acc:436618])

HSP 1 Score: 70.8626 bits (172), Expect = 3.358e-14
Identity = 46/136 (33.82%), Postives = 69/136 (50.74%), Query Frame = 1
Query:  817 TYIKQHRSTNLHKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVV--GSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCI 1218
            + IK H+ +    A E+LH+ S+A+L LF+VEL VK+      FF    EV+D  V+  SF  DI       G    + +I+  LWRI R+ NG++M  K R           RR++ +K E     KE  ++ C+
Sbjct:   83 SIIKTHKDS---VAPEVLHYMSLAILSLFMVELAVKLFAFRLEFFWHPLEVLDGAVVAISFALDIFYASRHDGFDATAFLILLRLWRIARIANGIVMSVKNR---------TGRRVAVLKRE-----KEALQRRCL 201          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Nematostella
Match: EDO34401 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPG1])

HSP 1 Score: 78.1814 bits (191), Expect = 2.839e-16
Identity = 41/93 (44.09%), Postives = 59/93 (63.44%), Query Frame = 1
Query:  856 ASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQE-ISVMIIFLLWRIVRVINGLIMHEKQRDELRI 1131
            A  +LH  SIA+L LF++EL VKI  +G  FF  + EV D IV++ SF  DI      + E  S++II  LWR+ R++NG+I+  K +DE +I
Sbjct:  100 APHILHDVSIAILSLFIIELIVKIYAMGMEFFHHKLEVFDGIVVIVSFALDIAFSGGNAAEGASLLIILRLWRVTRIVNGIILSVKMQDEKKI 192          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Nematostella
Match: EDO37671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF11])

HSP 1 Score: 58.9214 bits (141), Expect = 5.252e-10
Identity = 30/97 (30.93%), Postives = 57/97 (58.76%), Query Frame = 1
Query:  850 HKASEMLHFASIALLGLFVVELTVKILCIGPTFFK-ARFEVIDAIVILTSFIADIVIVVV----GSQEISVMIIFLLWRIVRVINGLIMHEKQRDEL 1125
            H AS +LHF  I++L +F +E+ +K+  +G  +FK  + E+ DA++++T+ I +I++         + +  +I   LWR+ RVI  +I   ++  EL
Sbjct:   85 HFASRLLHFVGISILAIFALEVFLKLFALGIEYFKIEKLEIFDAVIVITALIVEILLSATHTSKAWKSLGFVIGLRLWRVCRVITNIIEFREELYEL 181          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:NCBI gene;Acc:101159070])

HSP 1 Score: 71.633 bits (174), Expect = 9.300e-14
Identity = 38/114 (33.33%), Postives = 68/114 (59.65%), Query Frame = 1
Query:  850 HKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVV--VGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKA-----RRISEMK 1170
            H A E+ H+ S+A+L  F++EL  K+      FF  +FE+ D +V++ SFI DIV +        + ++I+  LWR+ R+ING+++  K R + RI   K++     +R++E++
Sbjct:   89 HIAPEVFHYLSLAVLTFFMMELAGKLFAFRLEFFHHKFEMFDGLVVVVSFILDIVFIFHEDAFDGMGLLILLRLWRVARIINGIVVSVKNRADQRIHKLKESYDHVVQRVTELQ 202          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Match: ENSORLT00000015469.2 (transmembrane protein 266 [Source:NCBI gene;Acc:101174011])

HSP 1 Score: 50.0618 bits (118), Expect = 6.191e-6
Identity = 32/120 (26.67%), Postives = 60/120 (50.00%), Query Frame = 1
Query:  841 TNLHKASEMLHFASIALLGLFVVELTVKILCIG-PTFFKARFEVIDAIVILTSFIADIVIVVVGS-----QEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDL 1182
            +N  + + ++H+ S+ +L LF  E   +I+ +G   + + + EV D  VI+ S    +   V          IS++I   +WR+ R+I+  ++  K   EL I   +K + + E +LE L
Sbjct:  123 SNAFQFASIIHWISLIILSLFFSETVFRIVVLGIWDYIENKVEVFDGAVIVLSLAPMMASTVANGPSSPWDAISLIITLRIWRVKRIIDAYVLQVKVEMELEIQQCEKTKAVREEQLERL 242          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Match: ENSORLT00000046304.1 (transmembrane protein 266 [Source:NCBI gene;Acc:101174011])

HSP 1 Score: 49.6766 bits (117), Expect = 6.743e-6
Identity = 32/120 (26.67%), Postives = 60/120 (50.00%), Query Frame = 1
Query:  841 TNLHKASEMLHFASIALLGLFVVELTVKILCIG-PTFFKARFEVIDAIVILTSFIADIVIVVVGS-----QEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDL 1182
            +N  + + ++H+ S+ +L LF  E   +I+ +G   + + + EV D  VI+ S    +   V          IS++I   +WR+ R+I+  ++  K   EL I   +K + + E +LE L
Sbjct:  122 SNAFQFASIIHWISLIILSLFFSETVFRIVVLGIWDYIENKVEVFDGAVIVLSLAPMMASTVANGPSSPWDAISLIITLRIWRVKRIIDAYVLQVKVEMELEIQQCEKTKAVREEQLERL 241          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Match: tmem266 (transmembrane protein 266 [Source:NCBI gene;Acc:101156009])

HSP 1 Score: 49.6766 bits (117), Expect = 7.268e-6
Identity = 29/119 (24.37%), Postives = 60/119 (50.42%), Query Frame = 1
Query:  844 NLHKASEMLHFASIALLGLFVVELTVKILCIG-PTFFKARFEVIDAIVILTSFIADIVIVVVGS-----QEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDL 1182
            N  + + ++H+ S+A+L +F  E   +I+ +G   + + + EV D  +I+ S    +   V          I ++I   +WR+ R+I+  ++  K   EL +   +KA+ + E +L+ L
Sbjct:  121 NAFQFASIIHWISLAILSVFFTETVFRIVVLGIWDYIENKVEVFDGAIIVLSLAPMVASTVANGPSSPWDAIGLIITLRIWRVKRIIDAYVLQVKVDMELEMQQYEKAKALREEQLDRL 239          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000077167.1 (SMESG000077167.1)

HSP 1 Score: 951.044 bits (2457), Expect = 0.000e+0
Identity = 500/501 (99.80%), Postives = 500/501 (99.80%), Query Frame = 1
Query:  259 MGHFIKRSCSLHVRWLNDTKFLQQLSEDNIDIDILNKELYAEESCRKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQMRDTIHFLNHTFVDTHIFDNVDIQALEESPSTHKEXXXXXXXXXXXXXXXXXXXXXXXXXCFKNSPVNGSHPKEKTQITKHGHQEATYIKQHRSTNLHKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAHATNKFIHKFVFHSNSTSPVFSNKTQGNSYVISEESSINSSKANCNYKPMLINTLSLPKDETLNRRYKPAINTTKDSSKSKCFNKRNNFKSWNGKSTKNYYPDYDQHTNYLIDAFISSPVLPDEHDQKE 1761
            MGHFIKRSCSLHVRWLNDTKFLQQLSEDNIDIDILNKELYAEES RKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQMRDTIHFLNHTFVDTHIFDNVDIQALEESPSTHKELDLLAQILQLLPQSIASFQIQSQFQCFKNSPVNGSHPKEKTQITKHGHQEATYIKQHRSTNLHKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAHATNKFIHKFVFHSNSTSPVFSNKTQGNSYVISEESSINSSKANCNYKPMLINTLSLPKDETLNRRYKPAINTTKDSSKSKCFNKRNNFKSWNGKSTKNYYPDYDQHTNYLIDAFISSPVLPDEHDQKE
Sbjct:    1 MGHFIKRSCSLHVRWLNDTKFLQQLSEDNIDIDILNKELYAEESGRKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQMRDTIHFLNHTFVDTHIFDNVDIQALEESPSTHKELDLLAQILQLLPQSIASFQIQSQFQCFKNSPVNGSHPKEKTQITKHGHQEATYIKQHRSTNLHKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAHATNKFIHKFVFHSNSTSPVFSNKTQGNSYVISEESSINSSKANCNYKPMLINTLSLPKDETLNRRYKPAINTTKDSSKSKCFNKRNNFKSWNGKSTKNYYPDYDQHTNYLIDAFISSPVLPDEHDQKE 501          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000070756.1 (SMESG000070756.1)

HSP 1 Score: 358.607 bits (919), Expect = 3.762e-116
Identity = 198/406 (48.77%), Postives = 263/406 (64.78%), Query Frame = 1
Query:  268 FIKRSCSLHVRWLNDTKFLQQLSEDNIDIDILNKELYAEESCRKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQMRDTIHFLNHTFV---------DTH--------IFDNVDIQALEESPSTHKEXXXXXXXXXXXXXXXXXXXXXXXXXCFKNSPVNGSHPKEKTQITKHGHQEATYIKQHRSTNLHKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAHATNKFIHKFVF-HSNSTSP 1431
            F +RS S  V W+ D K L QL +DNIDI++   E   E + +    ++  +L  LQ +P+QI+IA+LVL+DAGIVIAEI+LEIHS+KN IEA+ EQ+R+TI F+N TF          D+H        I D ++  +   +    K +    +   L  +     +        K    N +H +  T  + H   E    K+H S  LH  SE LH+ASI +LGLFV+E+ +KI C+G  FFKA+FEV+DA+VI+TSF+ADI+IV +GSQEISVMIIFLLWRIVRVINGL+MHEKQRDE RI LQKKARR+SEMK+E L IQ EMQEKH + LE+    AG    +I++C+PK+    K  TNNPLKSIAA+T+GFMG +VGA  +NK I++F   +S S +P
Sbjct:   38 FAERSYSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKRSVKKKS-------KPKANNNNHGQNSTSTSSHKVSE----KKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTP 432          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000070756.1 (SMESG000070756.1)

HSP 1 Score: 357.451 bits (916), Expect = 1.911e-115
Identity = 199/420 (47.38%), Postives = 277/420 (65.95%), Query Frame = 1
Query:  211 VVKSLSIIIWNFIN**MGHFIKRSCSLHVRWLNDTKFLQQLSEDNIDIDILNKELYAEESCRKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQMRDTIHFLNHTFV---------DTHIFDNVD-IQALEESPSTHKEXXXXXXXXXXXXXXXXXXXXXXXXXCFKNSPV--NGSHPKEKTQITKHGHQEATYIKQHRSTNLHKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAHATNKFIHKFVF-HSNSTSP 1431
            ++ +L++ I+ +IN  +     +S S  V W+ D K L QL +DNIDI++   E   E + +    ++  +L  LQ +P+QI+IA+LVL+DAGIVIAEI+LEIHS+KN IEA+ EQ+R+TI F+N TF          D+H  D +  ++ + ++ + +       ++  +      S     +    K+ P   N +H +  T  + H   E    K+H S  LH  SE LH+ASI +LGLFV+E+ +KI C+G  FFKA+FEV+DA+VI+TSF+ADI+IV +GSQEISVMIIFLLWRIVRVINGL+MHEKQRDE RI LQKKARR+SEMK+E L IQ EMQEKH + LE+    AG    +I++C+PK+    K  TNNPLKSIAA+T+GFMG +VGA  +NK I++F   +S S +P
Sbjct:   33 LITNLNLKIFTWINLPIAILRSKSYSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSH--DEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKRSVKKKSKPKANNNNHGQNSTSTSSHKVSE----KKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTP 446          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000070756.1 (SMESG000070756.1)

HSP 1 Score: 343.969 bits (881), Expect = 4.582e-111
Identity = 192/394 (48.73%), Postives = 256/394 (64.97%), Query Frame = 1
Query:  304 LNDTKFLQQLSEDNIDIDILNKELYAEESCRKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQMRDTIHFLNHTFV---------DTH--------IFDNVDIQALEESPSTHKEXXXXXXXXXXXXXXXXXXXXXXXXXCFKNSPVNGSHPKEKTQITKHGHQEATYIKQHRSTNLHKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAHATNKFIHKFVF-HSNSTSP 1431
            + D K L QL +DNIDI++   E   E + +    ++  +L  LQ +P+QI+IA+LVL+DAGIVIAEI+LEIHS+KN IEA+ EQ+R+TI F+N TF          D+H        I D ++  +   +    K +    +   L  +     +        K    N +H +  T  + H   E    K+H S  LH  SE LH+ASI +LGLFV+E+ +KI C+G  FFKA+FEV+DA+VI+TSF+ADI+IV +GSQEISVMIIFLLWRIVRVINGL+MHEKQRDE RI LQKKARR+SEMK+E L IQ EMQEKH + LE+    AG    +I++C+PK+    K  TNNPLKSIAA+T+GFMG +VGA  +NK I++F   +S S +P
Sbjct:    1 MKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKRSVKKKS-------KPKANNNNHGQNSTSTSSHKVSE----KKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTP 383          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000002770.1 (SMESG000002770.1)

HSP 1 Score: 289.271 bits (739), Expect = 2.900e-89
Identity = 171/436 (39.22%), Postives = 261/436 (59.86%), Query Frame = 1
Query:  286 SLHVRWLNDTKFLQQLSEDNIDIDILNKELYAEESCRKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQMRDTIHFLNHTFVDTHIFDNVDIQALEESPSTH-KEXXXXXXXXXXXXXXXXXXXXXXXXXCF-----KNSPVNGSHPKEKTQITKHGHQEATYIKQHRSTNLHKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAHATNK-FIHKFVFHSNSTSPVFSNKTQGNSY----VISEESSINSSKANCNYKPMLINTLSLPKDET 1560
            ++++ WLN+ KF++QL +DNID+++L +EL  +   ++    ++  L +++ + +Q+L+++L+LIDAGIVI EI+LEIHSMKNK E Y ++     + +   F+ T +  N  + + +    TH K+L LL  I  +         +      F       S  + +H           H+  +    HRST LH+    LH+ SI +L +F++EL ++ILCIG  FFK + E+ D  +I+TSF+ADI+ V + S +ISVM++FLLWRIVR+INGL+MHEKQRDE RI LQKK RR+ +MK++ L  +KE+  KH + LEELC   GA+ D ++ CKP+F   +K  TNN LKSIAALT+GFMG +VGA ++N+  I++  +   S SP   + T          ISE    +   +     PM  +TL LP  ++
Sbjct:   30 TINIEWLNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIILEIHSMKNKKEHYEDE-----NVIYKNFIQTSL--NALLNSSKVVTGTHNKKLSLLEIISNISKFHSKYSLMPLCNLSFHLPKPSESQTSDNHDDSHKDSYSSDHKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKELLTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINR--YSGTSPSPSIQSPTSSKKLKVMRKISETPYSSFDNSELELTPMTSHTLFLPSSDS 456          
The following BLAST results are available for this feature:
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HVCN12.893e-1037.36hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
HVCN13.134e-1037.36hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
HVCN13.440e-1037.36hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
HVCN13.440e-1037.36hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
HVCN13.440e-1037.36hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hvcn12.246e-1236.11hydrogen voltage-gated channel 1 [Source:NCBI gene... [more]
tmem2663.767e-626.79transmembrane protein 266 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hvcn15.423e-1235.35hydrogen voltage gated channel 1 [Source:NCBI gene... [more]
hvcn11.236e-1135.35hydrogen voltage gated channel 1 [Source:NCBI gene... [more]
mcf2l25.310e-729.31MCF.2 cell line derived transforming sequence-like... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Hvcn16.648e-1034.34hydrogen voltage-gated channel 1 [Source:MGI Symbo... [more]
Hvcn16.648e-1034.34hydrogen voltage-gated channel 1 [Source:MGI Symbo... [more]
Tmem2663.455e-626.67transmembrane protein 266 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F4C0|HVCN1_CHICK1.689e-1438.71Voltage-gated hydrogen channel 1 OS=Gallus gallus ... [more]
sp|Q6DHQ1|HVCN1_DANRE1.971e-1136.11Voltage-gated hydrogen channel 1 OS=Danio rerio OX... [more]
sp|Q5M7E9|HVCN1_XENLA3.554e-1136.46Voltage-gated hydrogen channel 1 OS=Xenopus laevis... [more]
sp|Q5M8L8|HVCN1_XENTR6.548e-1135.35Voltage-gated hydrogen channel 1 OS=Xenopus tropic... [more]
sp|Q96D96|HVCN1_HUMAN1.652e-937.36Voltage-gated hydrogen channel 1 OS=Homo sapiens O... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GWV15.936e-5849.14Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0X3NWB39.646e-5835.54Voltage-gated hydrogen channel 1 OS=Schistocephalu... [more]
A0A0X3PUC06.376e-5635.54Voltage-gated hydrogen channel 1 OS=Schistocephalu... [more]
A0A0X3Q7V77.325e-5634.80Voltage-gated hydrogen channel 1 OS=Schistocephalu... [more]
A0A0R3T0R38.848e-5551.28Ion_trans domain-containing protein OS=Rodentolepi... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hvcn11.640e-1339.13hydrogen voltage gated channel 1 [Source:NCBI gene... [more]
tmem2664.523e-726.67transmembrane protein 266 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hvcn13.358e-1433.82hydrogen voltage-gated channel 1 [Source:NCBI gene... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO344012.839e-1644.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376715.252e-1030.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hvcn19.300e-1433.33hydrogen voltage gated channel 1 [Source:NCBI gene... [more]
ENSORLT00000015469.26.191e-626.67transmembrane protein 266 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000046304.16.743e-626.67transmembrane protein 266 [Source:NCBI gene;Acc:10... [more]
tmem2667.268e-624.37transmembrane protein 266 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077167.10.000e+099.80SMESG000077167.1[more]
SMESG000070756.13.762e-11648.77SMESG000070756.1[more]
SMESG000070756.11.911e-11547.38SMESG000070756.1[more]
SMESG000070756.14.582e-11148.73SMESG000070756.1[more]
SMESG000002770.12.900e-8939.22SMESG000002770.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019965 ID=SMED30019965|Name=Voltage-gated hydrogen channel 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1796bp
TGAAGGCAATAATGTGAAACAGAAACATTTGAAGTGTTTATTAACATCAA
AAATATACAACCGGTAATAAAACGGTAAGAGAAACTCAGAAAGAAGTTGA
AATTTTAACCAAGAATTTTTCAAGCGATTTGATTGGTTGAAAAATATTTT
GTTCAATTTTGGAGTTTATTAGATGATTTTTGATGTTATTTTAATATTGC
AACTTAACAGGTCGTCAAATCTTTATCGATAATTATTTGGAATTTTATTA
ATTAATAAATGGGCCATTTTATTAAAAGAAGTTGCTCGCTTCATGTTCGA
TGGTTAAATGATACGAAATTTCTCCAGCAATTATCCGAAGACAATATTGA
TATTGACATTTTAAACAAGGAATTGTACGCCGAGGAGTCATGCAGAAAAC
AAACTCACATTCAAAAAATCATTCTCAATATTCTTCAATGCCATCCAATG
CAAATATTGATTGCGATTCTCGTTTTGATCGATGCTGGCATCGTTATTGC
AGAAATTGTTTTGGAAATTCACTCGATGAAAAATAAAATTGAAGCGTATA
GTGAGCAAATGCGAGATACAATACATTTCTTAAATCATACGTTTGTGGAT
ACGCATATATTTGATAACGTCGACATCCAGGCCCTTGAAGAAAGCCCATC
AACTCACAAAGAACTTGATTTATTAGCACAAATTCTACAACTTCTTCCGC
AGTCTATAGCTAGTTTTCAAATTCAAAGTCAATTCCAATGCTTTAAAAAC
TCACCAGTAAATGGAAGTCATCCCAAAGAAAAGACCCAAATTACCAAACA
CGGCCATCAAGAGGCAACCTATATCAAACAGCACAGGTCGACTAATTTGC
ATAAGGCATCAGAAATGCTGCATTTTGCCAGCATTGCCCTTTTAGGTCTT
TTTGTTGTCGAATTAACTGTTAAAATCCTTTGCATCGGACCAACATTCTT
CAAAGCCCGATTCGAAGTAATTGATGCAATTGTCATTTTGACTTCATTTA
TCGCCGACATAGTCATTGTGGTTGTGGGATCTCAGGAAATATCAGTCATG
ATTATTTTTCTTTTATGGAGAATTGTGAGAGTTATAAATGGTTTAATTAT
GCATGAGAAACAGCGAGATGAATTGAGAATTTTCCTGCAGAAAAAAGCTC
GCCGAATATCAGAGATGAAACTTGAAGATTTGATAATTCAAAAGGAAATG
CAAGAAAAGCATTGTATTGTATTAGAAGAATTGTGCGTCCGAGCTGGGGC
TTCTCCGGATCTCATTCAGAAATGCAAACCAAAATTCACTCCGATCAACA
AATGTCATACAAATAATCCTTTAAAATCCATTGCAGCATTAACAAGTGGT
TTTATGGGAACAATTGTTGGAGCTCATGCGACTAACAAATTTATTCATAA
ATTTGTCTTTCATAGCAACTCAACTTCTCCAGTTTTTTCCAATAAAACGC
AAGGCAATTCTTATGTGATTTCTGAGGAAAGCTCCATCAATTCTTCAAAA
GCCAACTGTAACTACAAACCTATGCTTATAAATACTTTGTCTTTACCTAA
AGATGAAACTTTAAACAGACGTTACAAGCCAGCGATAAACACTACCAAAG
ATTCTTCAAAAAGTAAATGCTTTAATAAAAGAAACAATTTTAAATCTTGG
AACGGGAAAAGTACTAAAAATTATTATCCTGACTATGATCAGCACACAAA
CTACCTTATTGATGCCTTTATCTCCAGTCCGGTTCTACCAGATGAACATG
ACCAGAAGGAATAATATTTTATTTAATTAATAAAGTTTTGTTAATA
back to top

protein sequence of SMED30019965-orf-1

>SMED30019965-orf-1 ID=SMED30019965-orf-1|Name=SMED30019965-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=502bp
MGHFIKRSCSLHVRWLNDTKFLQQLSEDNIDIDILNKELYAEESCRKQTH
IQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQ
MRDTIHFLNHTFVDTHIFDNVDIQALEESPSTHKELDLLAQILQLLPQSI
ASFQIQSQFQCFKNSPVNGSHPKEKTQITKHGHQEATYIKQHRSTNLHKA
SEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIAD
IVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRI
SEMKLEDLIIQKEMQEKHCIVLEELCVRAGASPDLIQKCKPKFTPINKCH
TNNPLKSIAALTSGFMGTIVGAHATNKFIHKFVFHSNSTSPVFSNKTQGN
SYVISEESSINSSKANCNYKPMLINTLSLPKDETLNRRYKPAINTTKDSS
KSKCFNKRNNFKSWNGKSTKNYYPDYDQHTNYLIDAFISSPVLPDEHDQK
E*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0030171voltage-gated proton channel activity
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0034220ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000136whole organism
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR031846Hvcn1
IPR005821Ion_trans_dom
IPR027359Volt_channel_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 80..100
NoneNo IPR availableTMHMMTMhelixcoord: 63..85
NoneNo IPR availableTMHMMTMhelixcoord: 251..273
NoneNo IPR availableTMHMMTMhelixcoord: 209..231
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 197..280
e-value: 3.1E-6
score: 26.6
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 186..288
e-value: 1.9E-13
score: 52.1
IPR031846Voltage-gated hydrogen channel 1PANTHERPTHR46480FAMILY NOT NAMEDcoord: 21..462