NADH dehydrogenase subunit 4

Overview
NameNADH dehydrogenase subunit 4 (YP_008592439.1)
Smed IDSMED30019959
Length (bp)1377
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NADH dehydrogenase subunit 4 (SMED30019959) t-SNE clustered cells

Violin plots show distribution of expression levels for NADH dehydrogenase subunit 4 (SMED30019959) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NADH dehydrogenase subunit 4 (SMED30019959) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NADH dehydrogenase subunit 4 (SMED30019959) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019959

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 32

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30019959 dd_Smed_v4_344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019959 dd_Smed_v4_344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019959 dd_Smed_v4_344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019959 dd_Smed_v4_344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019959 dd_Smed_v4_344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019959 dd_Smed_v4_344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019959 dd_Smed_v4_344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019959 dd_Smed_v4_344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019959 dd_Smed_v4_344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019959 dd_Smed_v4_344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019959 dd_Smed_v4_344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019959 Contig44099newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019959 Contig44099uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019959 Contig26072newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019959 Contig26072uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019959 Contig50699newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019959 Contig50699uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019959 Contig38381newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019959 Contig38381uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30019959 dd_Smed_v4_292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019959 dd_Smed_v4_292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019959 dd_Smed_v4_292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019959 dd_Smed_v4_292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019959 dd_Smed_v4_292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019959 dd_Smed_v4_292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019959 dd_Smed_v4_292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019959 dd_Smed_v4_292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019959 dd_Smed_v4_292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019959 dd_Smed_v4_292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019959 dd_Smed_v6_344_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30019959 dd_Smed_v6_344_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30019959 dd_Smed_v6_292_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Human
Match: MT-ND4 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4 [Source:HGNC Symbol;Acc:HGNC:7459])

HSP 1 Score: 120.553 bits (301), Expect = 3.381e-29
Identity = 104/338 (30.77%), Postives = 162/338 (47.93%), Query Frame = 1
Query:  265 FYVISLLSFFVSLF--YTCNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCSKVSFFSYIFMVFNVIFCGFYCVLFYLFVSLGFGSYT 1272
             Y+  L+S  +SL   +T   L+  +I FE +      +I   G  PER+ A +YFL Y+  GSLP+  A    ++ + ++L  GSL  +L  +     L   W     +L   + F  K P+ GLH  LPKAHVEAP+ GS++LAA+++KLG YG++R    L   +        +     + + M++    RQ D KS IAYSSI HM ++       +  S   A+IL  +HGL S  LF  +   Y  THSR   L++G   +  L  F   +  + N + P  +    E+  +      S  + +    N++    Y    Y+F +  +GS T
Sbjct:   94 LYLSMLISLQISLIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIA----LIYTHNTL--GSL-NILLLTLTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSL--WGMIMTSSICLRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYS--LYMFTTTQWGSLT 420          
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Celegans
Match: nduo-4 (NADH-ubiquinone oxidoreductase chain 4 [Source:UniProtKB/Swiss-Prot;Acc:P24892])

HSP 1 Score: 56.9954 bits (136), Expect = 1.398e-8
Identity = 95/318 (29.87%), Postives = 149/318 (46.86%), Query Frame = 1
Query:  277 SLLSFFVSLFYTCNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLP---IFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFI---YLCSKVSFFSYIFMVFNVIF 1212
             +L F   +F+  + ++ +++ FE S F + ++I+  G   E+I +  Y + Y+   S P   ++F  +F++V                  F Y +  + W     F ++ L F  KFPI  LH  LPKAHVEAP   S+LLA L++KLG  G +R   SL       +I           + + +F    Q D+K+  AYSS+ HM+ + L+    ++ S  S+++L  +HG  S  +F   G  Y  + SR  Y    +     +   L SV+ + N   P  L F SE + I    L SK S F  IF+ F V F
Sbjct:   75 EILVFICIIFFIPSNMMMLYMFFELSMFPILVMILGYGSQIEKINSSYYLMFYAAFCSFPFLFVYFKSNFLLV------------------FTYYNFVISWEM---FFILSLSFMMKFPIYFLHLWLPKAHVEAPTTASMLLAGLLLKLGTAGFLRILGSLSFVHNNVWILIAF-----LGMILGSFCCVFQSDSKALAAYSSVTHMSFLLLSLVFITMSSKISSVMLMLAHGYTSTLMFYLIGEFYHTSGSRMIYFMSSFFSSSMIMGILFSVVFLSNSGVPPSLSFLSEFLVISNSMLISK-SMFVMIFIYFVVSF 365          
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Fly
Match: mt:ND4 (gene:FBgn0262952 transcript:FBtr0433500)

HSP 1 Score: 96.6709 bits (239), Expect = 2.822e-21
Identity = 87/288 (30.21%), Postives = 138/288 (47.92%), Query Frame = 1
Query:  343 FEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSV---FMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCSKVSFFSYIFMV 1197
            FE S      +I+  GY PER++A  Y L Y+   SLP+   + +++        +GS+   L  +F ++       +   +  ++  F  K P+  +H  LPKAHVEAPV GS++LA +M+KLG YG++R                + FV++S S+    + +    RQ D K+ IAYSS+ HM ++     + +   L  +  L  +HGL S GLF  +   Y    SRS  +N+G L           +L   N + P  L    E   IYL + +  +S+I M+
Sbjct:  116 FESSLIPTLFLILGWGYQPERLQAGLYLLFYTLLVSLPMLIGIFYLMNK------IGSMNFYLMNNFMFN-------YDLLYFCLLCAFLVKMPMFLVHLWLPKAHVEAPVSGSMILAGIMLKLGGYGMLR-----VISFLQLMNLKYSFVWISISLVGGVLVSLVCLRQTDLKALIAYSSVAHMGIVLSGLLTMTYWGLCGSYTLMIAHGLCSSGLFCLANVSYERLGSRSMLINKGLLNFMPSMTLWWFLLSSANMAAPPTLNLLGE---IYLLNSIVSWSWISMI 382          
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Zebrafish
Match: mt-nd4 (NADH dehydrogenase subunit 4 [Source:NCBI gene;Acc:140534])

HSP 1 Score: 110.538 bits (275), Expect = 8.501e-26
Identity = 97/329 (29.48%), Postives = 152/329 (46.20%), Query Frame = 1
Query:  283 LSFFVSLFYTCNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLE-WLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCSKVSFFSYIFMVFNVIFCGFYCVLFYLFVSLGFGS 1266
            L  F+ + +   +++  +I FE +     ++I   G   ER+ A +YFL Y+  GS      +   +++   S    S+  VL+YS     L L  W    ++   ++ F  K P+ G+H  LPKAHVEAPV GS++LAA+++KLG YG++R    L   S        +     + V M+     RQ D KS IAYSS+ HM ++A      +      A+IL  +HGL S  LF  +   Y  THSR+  L RG   +  L      +  + N + P       E++ I      S ++ I      +    Y    Y+F++   GS
Sbjct:  103 LQTFMIMAFGATKIIMFYIMFEATLIPTLIIITRWGNQAERLNAGTYFLFYTLAGS----LPLLVALLLLQQSTGTLSML-VLQYS---DPLLLNSWGHKIWWAGCLIAFLVKMPLYGMHLWLPKAHVEAPVAGSMILAAVLLKLGGYGMMRMMVMLDPLSKQLAYPFIILAL--WGVIMTGLVCLRQTDLKSLIAYSSVGHMGLVAGGILIQTPWGFTGAIILMIAHGLTSSALFCLANTSYERTHSRTMILARGLQMVLPLATVWWFIANLANLALPPLPNLMGELMIITALFNWSPWTIIITGMGTLITANYS--LYMFLTSQRGS 419          
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Xenopus
Match: ampd1 (adenosine monophosphate deaminase 1 [Source:Xenbase;Acc:XB-GENE-6085943])

HSP 1 Score: 105.145 bits (261), Expect = 6.739e-24
Identity = 95/317 (29.97%), Postives = 147/317 (46.37%), Query Frame = 1
Query:  307 YTCNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCSKVSFFSYIFMVFNVIFCGFYCVLFYLFVSLG 1257
            ++   L+  +I FE +     ++I   G   ER+ A +YFL Y+  GSLP+  A+  +        + G+L   L      + + L W    ++   +L F  K P+ G H  LPKAHVEAP+ GS++LAA+++KLG YGIIR   +L            +     + + M++    RQ D KS IAYSS+ HM ++       +  SL  A+IL  +HGLIS  LF  +   Y  THSR+  L+RG   I  L      +  + N + P       E+  +      S ++ I      +    Y +  +L    G
Sbjct:  110 FSATELILFYIMFEITLIPTLIIITRWGNQAERLNAGTYFLFYTLAGSLPLLVALLSLYS------YTGTLSLSLLQLLP-NHIPLSWANKLWWFACLLAFMVKMPLYGTHLWLPKAHVEAPIAGSMVLAAILLKLGGYGIIRISITLTPAMKDLAYPFLILSL--WGIIMTSSICLRQTDLKSMIAYSSVSHMGLVISAAMIQTPWSLTGAMILMIAHGLISSALFCLANTNYERTHSRALLLSRGLQSILPLMGTWWLLSNLANMALPPSPNLMGEITIMTALFNWSNWTIILTGIGTLLTASYSLYMFLITQRG 417          
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Mouse
Match: mt-Nd4 (mitochondrially encoded NADH dehydrogenase 4 [Source:MGI Symbol;Acc:MGI:102498])

HSP 1 Score: 106.301 bits (264), Expect = 1.917e-24
Identity = 85/287 (29.62%), Postives = 137/287 (47.74%), Query Frame = 1
Query:  283 LSFFVSLFYTCNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEV 1143
            L   + + ++   L+  +I FE +     ++I   G   ER+ A  YFL Y+  GS      +  +I +      VG+L  ++  SF   +L   W     +L  ++ F  K P+ G+H  LPKAHVEAP+ GS++LAA+++KLG YG+IR    L   +        L     + + M++    RQ D KS IAYSS+ HM ++  +    +  S   A +L  +HGL S  LF  +   Y   HSR+  + RG   ++ L      +  + N + P  +    E+
Sbjct:  102 LQILLIMTFSATELIMFYILFEATLIPTLIIITRWGNQTERLNAGIYFLFYTLIGS------IPLLIALILIQNHVGTL-NLMILSFTTHTLDASWSNNLLWLACMMAFLIKMPLYGVHLWLPKAHVEAPIAGSMILAAILLKLGSYGMIRISIILDPLTKYMAYPFILLSL--WGMIMTSSICLRQTDLKSLIAYSSVSHMALVIASIMIQTPWSFMGATMLMIAHGLTSSLLFCLANSNYERIHSRTMIMARGLQMVFPLMATWWLMASLANLALPPSINLMGEL 379          
BLAST of NADH dehydrogenase subunit 4 vs. UniProt/SwissProt
Match: sp|Q34949|NU4M_LUMTE (NADH-ubiquinone oxidoreductase chain 4 OS=Lumbricus terrestris OX=6398 GN=ND4 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.009e-37
Identity = 103/332 (31.02%), Postives = 162/332 (48.80%), Query Frame = 1
Query:  319 RLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTT----RQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCSKVSFFSYIFMVFNVIFCGFYCVLFYLFVSLGFGSYTVSFRLISDFS 1302
             L+  +I FE S     ++I+  GY PER +A  Y +IY+   SLP+   +  + ++S +++    +F  +E+   Y S+ L W+          GF  K P+  +H  LPKAHVEAP+ GS++LAA+++KLG YGI+R        S   ++       LS    +   ST+    RQ D KS IAYSS+ HM ++       S     +AL +  +HGL S  LFV +   Y LTH+RS +L +G L +         +    N + P  +   SE++ I    K+S  ++I +     F   YC   Y++ S+  G   ++   I  F 
Sbjct:  109 NLIMFYIWFEASLIPTMVLIMTWGYQPERSQASMYLMIYTVAASLPMLMVLCKIFIVSKTAMM--PMFMNMEFPMDYPSMALAWVLTLG------GFLVKLPMFTVHLWLPKAHVEAPIAGSMILAAILLKLGGYGILR------MLSLFHYMAKSTSSLLSSVALVGAVSTSLICLRQSDLKSLIAYSSVGHMGLMVAGALMSSNWGFQAALAMMIAHGLSSSALFVMANMNYELTHTRSLFLMKGLLVLAPTLTMWWFLFTASNMAAPPSINLLSEIMLITSILKMSTSAFILLGLTSFFTAAYC--LYMYTSMHHGPLMLTSNPIPQFK 424          
BLAST of NADH dehydrogenase subunit 4 vs. UniProt/SwissProt
Match: sp|O03204|NU4M_CERSI (NADH-ubiquinone oxidoreductase chain 4 OS=Ceratotherium simum OX=9807 GN=MT-ND4 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 3.166e-33
Identity = 101/335 (30.15%), Postives = 163/335 (48.66%), Query Frame = 1
Query:  271 VISLLSFFVSLFYTCNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCS-KVSFFSYIFMVFNVIFCGFYCVLFYLFVSLGFGSYT 1272
            +I+L +F + + +T   L++ +I FE +     ++I   G   ER+ A  YFL Y+  GSLP+  A++ +  ++ S         +L   +   +L   W   F +L  ++ F  K P+ GLH  LPKAHVEAP+ GS++LAA+++KLG YG++R    L   +        +     + + M++    RQ D KS IAYSS+ HM ++ +     +  S   A  L  +HGL S  LF  +   Y  THSR+  L RG   +  L      +  + N + P  +    E +F+ + S   S  + I M  N+I    Y    Y+ ++   G YT
Sbjct:   99 LITLQTFLI-MTFTATELIFFYILFEATLIPTLIIITRWGNQTERLNAGFYFLFYTLTGSLPLLIALTHIQNLTGS-------LNLLLIQYSTQTLPSSWSNAFLWLACMMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAILLKLGGYGMLRITMILNPLTSYMAYPFLMLSL--WGMIMTSSICLRQTDLKSLIAYSSVSHMALVIVAVLIQTPWSYMGATALMIAHGLTSSVLFCLANSNYERTHSRTMILARGLQTLLPLMAMWWLLASLTNLALPPTINLVGE-LFVVMSSFSWSNITIILMGTNIIITALYS--LYMLITTQRGKYT 420          
BLAST of NADH dehydrogenase subunit 4 vs. UniProt/SwissProt
Match: sp|P38601|NU4M_HALGR (NADH-ubiquinone oxidoreductase chain 4 OS=Halichoerus grypus OX=9711 GN=MT-ND4 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 3.393e-33
Identity = 100/334 (29.94%), Postives = 155/334 (46.41%), Query Frame = 1
Query:  280 LLSFFVSLFYTCNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEY---SFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCSKVSFFSYIFMVFNVIFCGFYCVLFYLFVSLGFGSYT 1272
            LL  F+ + +T   L+  +I FE +     ++I   G   ER+ A +YFL Y+  GSLP+  A+          LF+ +  G L +         L   W     +L  ++ F  K P+ GLH  LPKAHVEAP+ GS++LAA+++KLG YG++R  + L   +        +     + + M++    RQ D KS IAYSS+ HM ++ +     +  S   A  L  +HGL S  LF  +   Y  THSR+  L RG   +  L      +  + N + P  +    E+  +      S  + I M  N+I    Y    Y+ ++   G YT
Sbjct:  101 LLQLFLIMTFTATELIMFYILFEATLVPTLIIITRWGNQTERLNAGTYFLFYTLVGSLPLLVAL----------LFIQNNMGTLNFLMIQLWAQPLPSSWSNTLLWLACMMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRITALLSPLTSFMAYPFMMLSL--WGMTMTSSICLRQTDLKSLIAYSSVSHMALVIVAILIQTPWSYMGATALMIAHGLTSSVLFCLANSNYERTHSRTMILARGLQVLLPLMAAWWLLASLTNLALPPTINLIGELFVVMASFSWSNITIILMGTNIIITALYS--LYMLITTQRGKYT 420          
BLAST of NADH dehydrogenase subunit 4 vs. UniProt/SwissProt
Match: sp|Q00506|NU4M_PHOVI (NADH-ubiquinone oxidoreductase chain 4 OS=Phoca vitulina OX=9720 GN=MT-ND4 PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 4.346e-33
Identity = 100/334 (29.94%), Postives = 153/334 (45.81%), Query Frame = 1
Query:  280 LLSFFVSLFYTCNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEY---SFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCSKVSFFSYIFMVFNVIFCGFYCVLFYLFVSLGFGSYT 1272
            LL  F+ + +T   L+  +I FE +     ++I   G   ER+ A +YFL Y+  GSLP+  A+          LF+ +  G L +         L   W     +L  ++ F  K P+ GLH  LPKAHVEAP+ GS++LAA+++KLG YG++R    L   +        +     + + M++    RQ D KS IAYSS+ HM ++ +     +  S   A  L  +HGL S  LF  +   Y  THSR+  L RG   +  L      +  + N + P  +    E+  +      S  + I M  N+I    Y    Y+  +   G YT
Sbjct:  101 LLQLFLIMTFTATELIMFYILFEATLVPTLIIITRWGNQTERLNAGTYFLFYTLVGSLPLLVAL----------LFIQNNMGTLNFLMIQLWAQPLPSSWSNTLLWLACMMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRITVLLSPLTNFMAYPFMMLSL--WGMIMTSSICLRQTDLKSLIAYSSVSHMALVIMAILIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERTHSRTMILARGLQVLLPLMAAWWLLASLTNLALPPTINLIGELFVVMASFSWSNITIILMGTNIIITALYS--LYMLTTTQRGKYT 420          
BLAST of NADH dehydrogenase subunit 4 vs. UniProt/SwissProt
Match: sp|P48655|NU4M_HORSE (NADH-ubiquinone oxidoreductase chain 4 OS=Equus caballus OX=9796 GN=MT-ND4 PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 2.571e-32
Identity = 100/338 (29.59%), Postives = 163/338 (48.22%), Query Frame = 1
Query:  271 VISLLSFFVSLFYTCNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEY---SFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCS-KVSFFSYIFMVFNVIFCGFYCVLFYLFVSLGFGSYT 1272
            ++++L  F+ + +T   L+  +I FE +     ++I   G   ER+ A  YFL Y+  GSLP+  A+          + + +L G L +    +   +L   W  +F +L  ++ F  K P+ GLH  LPKAHVEAP+ GS++LAA+++KLG YG++R  + L   +        +     + + M++    RQ D KS IAYSS+ HM ++ +     +  S   A  L  +HGL S  LF  +   Y  THSR+  L RG   +  L      +  + N + P  +    E +F+ + S   S  + I M  N+     Y    Y+ ++   G YT
Sbjct:   98 MLTMLQTFLIMTFTATELISFYILFEATLVPTLIIITRWGNQTERLNAGLYFLFYTLMGSLPLLVAL----------ISIQNLTGSLNFLLIQYWNQALPDSWSNIFLWLACMMAFMVKMPVYGLHLWLPKAHVEAPIAGSMVLAAILLKLGGYGMLRITTMLNPQTSFMAYPFLMLSL--WGMIMTSSICLRQTDLKSLIAYSSVSHMALVIVAVLIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERTHSRTMILARGLQTLLPLMAAWWLLASLTNLALPPSINLIGE-LFVVMSSFSWSNITIILMGANITITALYS--LYMLITTQRGKYT 420          
BLAST of NADH dehydrogenase subunit 4 vs. TrEMBL
Match: T1PUZ3 (NADH-ubiquinone oxidoreductase chain 4 OS=Schmidtea mediterranea OX=79327 GN=ND4 PE=3 SV=1)

HSP 1 Score: 518.079 bits (1333), Expect = 5.562e-179
Identity = 360/370 (97.30%), Postives = 360/370 (97.30%), Query Frame = 1
Query:  265 FYVISLLSFFVSLFYTCNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCSKVSFFSYIFMVFNVIFCGFYCVLFYLFVSLGFGSYTVSFRLISDFSXXXXXXXXXXXXXXXXXXXSFLIF 1374
            FYVISLLSFFVSLFYTCN LLYVFICFEFSFFLLYLVIVV GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI GLHS LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYFSSLFGFSFVSFIFPFLFVYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIALTF SGSLLSLFSALILSFSHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYSLFVFLLSVLLVFNCSFPL LGFFSEVIFIYLCS VSFFSYIFMVFNVIFCGFYCVLFYLFVSLGFGSYTVSF LISDFSVYF LFVV LVCVLMMLALSFLIF
Sbjct:   89 FYVISLLSFFVSLFYTCNSLLYVFICFEFSFFLLYLVIVVWGYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPIWGLHSWLPKAHVEAPVLGSVLLAALMVKLGVYGIIRYFSSLFGFSFVSFIFPFLFVYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIALTFWSGSLLSLFSALILSFSHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYSLFVFLLSVLLVFNCSFPLSLGFFSEVIFIYLCSNVSFFSYIFMVFNVIFCGFYCVLFYLFVSLGFGSYTVSFSLISDFSVYFSLFVVSLVCVLMMLALSFLIF 458          
BLAST of NADH dehydrogenase subunit 4 vs. TrEMBL
Match: A0A0B4VJ62 (NADH-ubiquinone oxidoreductase chain 4 OS=Schmidtea mediterranea OX=79327 GN=ND4 PE=3 SV=1)

HSP 1 Score: 507.679 bits (1306), Expect = 6.936e-175
Identity = 349/370 (94.32%), Postives = 355/370 (95.95%), Query Frame = 1
Query:  265 FYVISLLSFFVSLFYTCNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCSKVSFFSYIFMVFNVIFCGFYCVLFYLFVSLGFGSYTVSFRLISDFSXXXXXXXXXXXXXXXXXXXSFLIF 1374
            FYVISLLSFFVSLFYTCN LLYVFICFEFSFFLLYLV+VV GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYS  YSSLGLEWLFVFYFLVI+LGFFFKFPI GLHS LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYFSSLFGFSFVSF+FPFLFVYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMI+LTF SGSLLSLFSALILSFSHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYSLF+FLLSVLLVFNCSFPL LGFFSEVIFIYLCS VSFFSY FMV NVI CGFYCVLFYLFVSLGFGSYTVSF LISDFSVYF LF+V LVCVLMMLALSFLIF
Sbjct:   89 FYVISLLSFFVSLFYTCNSLLYVFICFEFSFFLLYLVVVVWGYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSLCYSSLGLEWLFVFYFLVIVLGFFFKFPIWGLHSWLPKAHVEAPVLGSVLLAALMVKLGVYGIIRYFSSLFGFSFVSFVFPFLFVYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMISLTFWSGSLLSLFSALILSFSHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYSLFIFLLSVLLVFNCSFPLSLGFFSEVIFIYLCSNVSFFSYTFMVLNVILCGFYCVLFYLFVSLGFGSYTVSFSLISDFSVYFSLFIVSLVCVLMMLALSFLIF 458          
BLAST of NADH dehydrogenase subunit 4 vs. TrEMBL
Match: G9M8V0 (NADH-ubiquinone oxidoreductase chain 4 OS=Dugesia japonica OX=6161 GN=nd4 PE=3 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.908e-62
Identity = 162/312 (51.92%), Postives = 208/312 (66.67%), Query Frame = 1
Query:  319 RLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVF-YFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCSKVSFFSYIFMVFNVIFCGFYCVLFYLFVS 1251
             +LY+F+ FEFSF ++YL +V+ GYNPER+E++SYFLIYS CGS P+F  VS  I    SS     +F +L     + S      F   Y L++ILGFFFKFPI G HS LPK HVEAP  GSVLLA LMVKLG+YGI  ++S    F+ V   F FL  YL  S+ +SNF T RQ D KS+IAYSSIVHM ++A++F SGSL S+  +L+LS SHG +S  LF+S+ + Y  + +R+ YLNRGYLY YS+FVF   + LV N S P  LGFFSE+  +Y+     FFS  F+ FN+ FCG YC+  Y+ VS
Sbjct:   99 NVLYMFLYFEFSFVVIYLFVVLWGYNPERLESLSYFLIYSVCGSFPLFGVVSIFIFYVGSSFCFDCIFQLLLAGSFFYSFSSYSWFFSIYSLIVILGFFFKFPIWGFHSWLPKVHVEAPYFGSVLLAGLMVKLGLYGIYFFYSFFLFFNLVFLFFCFLISYLCVSLIISNFCTVRQLDIKSYIAYSSIVHMGLVAISFWSGSLFSVVGSLLLSVSHGFVSSSLFISTNFFYFFSGTRNLYLNRGYLYSYSVFVFFWFLFLVINSSIPFSLGFFSELSLVYVAVNSLFFSSFFVCFNLFFCGLYCIYLYIVVS 410          
BLAST of NADH dehydrogenase subunit 4 vs. TrEMBL
Match: G9M8W1 (NADH-ubiquinone oxidoreductase chain 4 OS=Dugesia ryukyuensis OX=79738 GN=nd4 PE=3 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 1.553e-60
Identity = 162/314 (51.59%), Postives = 209/314 (66.56%), Query Frame = 1
Query:  319 RLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEY-SFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCSKVSFFSYIFMVFNVIFCGFYCVLFYLFVSLG 1257
              LY+ + FEFSF ++YL+IV  GYNP+R+E++SYFLIYS CGS PIF  VS  +    SS        +L + SF   S    + F FY LVI+LGFFFKFP+ G HS LPKAHVEAP  GSVLLA LMVKLG+YG++ ++S    FSF   +  +L  YL FS   SN ST RQ+D KS+IAYSSIVHM +++++F SGS++S   ++ILS SHGLIS  LF+ S + Y  + +RS Y+NRGYLY YSLF+F   ++LVFN S P   GFFSE+   Y      F +  F+ FN+ FCGFYC+  Y+  S G
Sbjct:   99 NTLYMLLYFEFSFVVIYLLIVFWGYNPKRLESLSYFLIYSVCGSFPIFGVVSVFVYYVGSSFCFDCCSQLLLFTSFCLPSTYSLFCF-FYSLVIVLGFFFKFPVWGFHSWLPKAHVEAPYYGSVLLAGLMVKLGLYGVLYFYSYFLYFSFSFSLLCWLVSYLGFSFIFSNLSTVRQYDLKSYIAYSSIVHMGLVSISFWSGSVVSTLGSVILSISHGLISSLLFIGSNFFYLCSGTRSLYINRGYLYFYSLFIFFWFLVLVFNSSVPFSFGFFSELSLFYSIVNFLFSNSFFICFNLFFCGFYCIYLYMITSHG 411          
BLAST of NADH dehydrogenase subunit 4 vs. TrEMBL
Match: A0A0C4ZJY8 (NADH-ubiquinone oxidoreductase chain 4 OS=Girardia sp. ER-2015 OX=1608986 GN=ND4 PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 8.856e-58
Identity = 158/325 (48.62%), Postives = 213/325 (65.54%), Query Frame = 1
Query:  319 RLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFIYLCSKVSFFSYIFMVFNVIFCGFYCVLFYLF-------VSLGFGSYT 1272
             LLY+ + FEFSF ++YL+IV  G NPER+E++SYFLIYS CGS P+F  VS ++     S  +  L  +L     +      W F  Y  V++ GF+FKFPI GLHS LPKAHVE+P  GS+LLA LMVKLG+YG++ ++S    F+       F   YL FS+  SNFST RQ+D KS+IAYSSIVHM +++++F SGS++S+F  L+L+ SHG +S  LF+ + + Y+ + +RS YLNRGYLYIYSLFVF   + LV N S P  LGFFS+ +  Y+  +  F S  F VFN+ FCG YC+  Y         +SLGFGS++
Sbjct:   99 NLLYILLYFEFSFVVIYLLIVFWGSNPERLESLSYFLIYSVCGSFPLFGVVSVLVFYFSGSFCLDCLLQLLLGLCFFCFSDYFWFFYIYSFVVVFGFYFKFPIWGLHSWLPKAHVESPYYGSILLAGLMVKLGLYGVLYFYSCFLFFNISLTFLCFFISYLCFSLLFSNFSTIRQYDLKSYIAYSSIVHMGLVSISFWSGSIVSVFGCLVLAVSHGCVSSLLFLGANFFYAGSGTRSLYLNRGYLYIYSLFVFFWFICLVLNSSVPFSLGFFSDFLLFYVSVQFLFTSSFFFVFNLFFCGLYCLYLYTVTSHGCASISLGFGSFS 423          
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Sea Lamprey
Match: ND4 (NADH dehydrogenase subunit 4 [Source:NCBI gene;Acc:807809])

HSP 1 Score: 102.064 bits (253), Expect = 8.576e-24
Identity = 83/280 (29.64%), Postives = 137/280 (48.93%), Query Frame = 1
Query:  313 CNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDSSLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFI 1152
             + LL  +I FE +     L+I   G   ER+ A  YFL Y+          +   ++M  + L   S++ ++  S     L   W    +++   L F  K P+   H  LPKAHVEAP+ GS++LAA+++KLG YG+IR  S     +    +   +     + + +++    RQ D KS IAYSS+ HM ++     + +  +   AL +  +HGL+S GL   +   Y  TH+RS ++NRG   ++ L  F   ++   N + P    F +E++ I
Sbjct:  113 ASNLLMFYIAFETTLIPTLLIITRWGNQKERLTAGLYFLFYTLS----ASLPLLLALIMIQTHLNSLSIY-IIPLSNLTLLLNTPWSETLWWIACFLAFLIKMPLYIFHLWLPKAHVEAPIAGSMILAAILLKLGGYGMIRMSSLFIPLTKDLAVPFMIIAM--WGMIVTSSICLRQTDLKSMIAYSSVSHMGLVVAGIFTMTPWAWSGALAMMIAHGLVSSGLLCLANITYERTHTRSIFMNRGLKTLFPLMSFWWLMMTFANMALPPFPNFMAEILII 385          
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Medaka
Match: ND4 (NADH dehydrogenase subunit 4 [Source:NCBI gene;Acc:805433])

HSP 1 Score: 104.76 bits (260), Expect = 5.685e-24
Identity = 93/291 (31.96%), Postives = 136/291 (46.74%), Query Frame = 1
Query:  283 LSFFVSLFYTCNRLLYVFICFEFSFFLLYLVIVV*GYNPERIEAVSYFLIYSFCGSLPIFFAVSFMIVMSDS-SLFVGSLFGVLEYSFGYSSLGLEWLFVFYFLVIILGFFFKFPI*GLHS*LPKAHVEAPVLGSVLLAALMVKLGVYGIIRYXXXXXXXXXXXXXXXXXXXYLSFSVFMSNFSTTRQFDNKSFIAYSSIVHMTMIAXXXXXXXXXXXXXXXXXXXXHGLISLGLFVSSGYMYSLTHSRSFYLNRGYLYIYXXXXXXXXXXXXXNCSFPLRLGFFSEVIFI 1152
            L  F+ L +    ++  +I FE +     ++I   G   ER+ A  YFL Y+  GSLP+  A+  +   + S S      F  L+     S         F++   +L F  K P+ G H  LPKAHVEAP+ GS++LAA+++KLG YG++R    L   +        +     + V M+     RQ D KS IAYSS+ HM ++A      +   L  ALIL  +HGL S  LF  +   Y  THSR+  L RG   I  L      +  + N + P       E++ I
Sbjct:  103 LQIFLVLAFGATEMIMFYIMFEATLIPTLIIITRWGNQTERLNAGIYFLFYTLAGSLPLLVALLLLQNSTGSLSFLTTQFFPPLQLHTEASK--------FWWAGCLLAFLVKMPLYGAHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRIIIILDPLTKQLSYPFIILAL--WGVVMTGSICLRQTDLKSLIAYSSVSHMGLVAAGILIQTPWGLTGALILMIAHGLTSSALFCLANTNYERTHSRTMLLARGLQMILPLLATWWFLFTLANLALPPLPNLMGELMII 383          
The following BLAST results are available for this feature:
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MT-ND43.381e-2930.77mitochondrially encoded NADH:ubiquinone oxidoreduc... [more]
back to top
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nduo-41.398e-829.87NADH-ubiquinone oxidoreductase chain 4 [Source:Un... [more]
back to top
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt:ND42.822e-2130.21gene:FBgn0262952 transcript:FBtr0433500[more]
back to top
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt-nd48.501e-2629.48NADH dehydrogenase subunit 4 [Source:NCBI gene;Acc... [more]
back to top
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ampd16.739e-2429.97adenosine monophosphate deaminase 1 [Source:Xenbas... [more]
back to top
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt-Nd41.917e-2429.62mitochondrially encoded NADH dehydrogenase 4 [Sour... [more]
back to top
BLAST of NADH dehydrogenase subunit 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q34949|NU4M_LUMTE1.009e-3731.02NADH-ubiquinone oxidoreductase chain 4 OS=Lumbricu... [more]
sp|O03204|NU4M_CERSI3.166e-3330.15NADH-ubiquinone oxidoreductase chain 4 OS=Ceratoth... [more]
sp|P38601|NU4M_HALGR3.393e-3329.94NADH-ubiquinone oxidoreductase chain 4 OS=Halichoe... [more]
sp|Q00506|NU4M_PHOVI4.346e-3329.94NADH-ubiquinone oxidoreductase chain 4 OS=Phoca vi... [more]
sp|P48655|NU4M_HORSE2.571e-3229.59NADH-ubiquinone oxidoreductase chain 4 OS=Equus ca... [more]
back to top
BLAST of NADH dehydrogenase subunit 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1PUZ35.562e-17997.30NADH-ubiquinone oxidoreductase chain 4 OS=Schmidte... [more]
A0A0B4VJ626.936e-17594.32NADH-ubiquinone oxidoreductase chain 4 OS=Schmidte... [more]
G9M8V02.908e-6251.92NADH-ubiquinone oxidoreductase chain 4 OS=Dugesia ... [more]
G9M8W11.553e-6051.59NADH-ubiquinone oxidoreductase chain 4 OS=Dugesia ... [more]
A0A0C4ZJY88.856e-5848.62NADH-ubiquinone oxidoreductase chain 4 OS=Girardia... [more]
back to top
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ND48.576e-2429.64NADH dehydrogenase subunit 4 [Source:NCBI gene;Acc... [more]
back to top
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase subunit 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ND45.685e-2431.96NADH dehydrogenase subunit 4 [Source:NCBI gene;Acc... [more]
back to top
BLAST of NADH dehydrogenase subunit 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019959
GenBankYP_008592439.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019959 ID=SMED30019959|Name=NADH dehydrogenase subunit 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1377bp
atggagaatctagtgttcttgttagttcacaaacttttacttcttattag
tttttttaatttaaattatttgtctgttgtttctttttataactttttgt
ttatttatttacttttattgtttaatgattcgtctttttctagtttagtt
tttaattctttgtattttagtttaggttctttaaattatttatttgtttt
gttggttgttttagttttttttcttctctatgttttagagtacttaaatt
tatcttattcgttgttttatgttattagtttgttgtctttttttgtttct
ttgttttatacttgtaatagattgttgtatgtttttatttgttttgagtt
ttctttttttttgttatatttggttattgttgtttgaggttataatcctg
aacgtattgaagctgttagttatttcttaatttattctttttgtggctct
cttcctattttctttgctgtttcttttatgattgttatgtcagattcttc
cttgtttgttggatctctgtttggagttttggagtattctttcggttatt
ctagtttaggtttagagtggctgtttgttttttattttttagttattatt
ttaggttttttttttaagtttcctatttgaggattacattcttgattgcc
taaggctcatgtagaggcacctgttttgggttctgttcttttagctgcat
tgatggtgaagttgggtgtttatggtattattcgttattttagttcttta
tttggtttttcttttgttagctttatttttcctttcttgtttgtttattt
gagttttagtgtgtttatgtctaattttagtactacccgtcagtttgaca
ataagtcctttatagcttattcttctattgtacatatgactatgattgct
ttaactttttgatctggtagtttgttgtctttgttttcagctttgattct
ttctttttcacatggtttaatttctttgggtttgtttgttagttctggtt
atatgtactctcttactcattctcgtagcttttatttaaatcgaggttat
ctttatatttactctttgtttgtttttctgttgtctgtgttattggtatt
taattgttcatttcctttaagattgggctttttttcagaagttattttta
tatatctgtgtagtaaagtttcttttttttcttatatttttatggtgttt
aatgttatattttgtgggttttattgtgttttgttttatttgtttgtatc
cttgggttttggttcttatactgtttcttttagattgatttcagatttta
gtgtttattttagattgtttgttgtaagattagtttgtgttttgatgatg
ttagctttgagttttttgatattttag
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031966mitochondrial membrane
GO:0070469respiratory chain
GO:0005739mitochondrion
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001750ND/Mrp_mem
Vocabulary: molecular function
TermDefinition
GO:0008137NADH dehydrogenase (ubiquinone) activity
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0042773ATP synthesis coupled electron transport
GO:0055114oxidation-reduction process