Granulin precursor

Overview
NameGranulin precursor
Smed IDSMED30019945
Length (bp)673
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Granulin precursor (SMED30019945) t-SNE clustered cells

Violin plots show distribution of expression levels for Granulin precursor (SMED30019945) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Granulin precursor (SMED30019945) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Granulin precursor (SMED30019945) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019945

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30019945SMESG000018767.1 SMESG000018762.1 SMESG000018760.1 dd_Smed_v4_427_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019945SMESG000018766.1 SMESG000018760.1 SMESG000018767.1 SMESG000018762.1 dd_Smed_v6_427_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30019945SMESG000018766.1 SMESG000018760.1 SMESG000018767.1 SMESG000018762.1 dd_Smed_v6_427_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Granulin precursor vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 90.5077 bits (223), Expect = 1.747e-20
Identity = 59/191 (30.89%), Postives = 83/191 (43.46%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKN-----VTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            L+    I   G       L  Q+      +++  +CP+ R++C D  TCC+     Y CC   NA CC D  HCCP+ + CD  Q KC+    +  ++   +PA  V D          V  + EV CP+  T C+            + CCP   AVCC D   CCP G TCD +   C +    V  +E
Sbjct:  173 LVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD----------VKCDMEVSCPDGYTCCRLQS-------GAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWME 346          

HSP 2 Score: 87.0409 bits (214), Expect = 2.305e-19
Identity = 61/188 (32.45%), Postives = 85/188 (45.21%), Query Frame = 1
Query:   76 ADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGN 639
            ADG   F     +  N      CP+ + +C D  TCC     S+ CC    A CC D+ HCCP G+ CD    +C+        + K +PA + +           V  +  VMCP+ +++C D  TCC      Y CCP  NA CCSD   CCP+ T CD+   KCL    +  ++     A   G+
Sbjct:  107 ADGRSCFQ---RSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCIT-PTGTHPLAKKLPAQRTNR---------AVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD 281          

HSP 3 Score: 80.1073 bits (196), Expect = 6.482e-17
Identity = 53/176 (30.11%), Postives = 80/176 (45.45%), Query Frame = 1
Query:   97 DVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDA 624
            D+L +   +   D  C +    C D  TCC+ +  ++ CC +  AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V  ++   CP++        TCC      + CCP++  VCC+D+  CCP G  C  +  KCL+      +  L + A
Sbjct:  269 DLLTKLPAHTVGDVKC-DMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSL---PDPQALKRDVPCDNVSSCPSS-------DTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPA 433          

HSP 4 Score: 54.6842 bits (130), Expect = 3.593e-8
Identity = 39/142 (27.46%), Postives = 59/142 (41.55%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            C+   +C  T   +  CC +  AV C D  HCCP G  C A    C +                           +  N    + CP+++ +C D  TCC+    ++ CCP   A CC D+  CCP G  CD+ + +C+  +
Sbjct:   67 CSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQ--------------------------RSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPT 182          
BLAST of Granulin precursor vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 89.7373 bits (221), Expect = 2.099e-20
Identity = 54/162 (33.33%), Postives = 76/162 (46.91%), Query Frame = 1
Query:  124 VTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            +++  +CP+ R++C D  TCC+     Y CC   NA CC D  HCCP+ + CD  Q KC+    +  ++   +PA  V D          V  + EV CP+  T C+            + CCP   AVCC D   CCP G TCD +   C +    V  +E
Sbjct:   16 LSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD----------VKCDMEVSCPDGYTCCRLQS-------GAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWME 160          

HSP 2 Score: 77.0258 bits (188), Expect = 7.297e-16
Identity = 55/173 (31.79%), Postives = 81/173 (46.82%), Query Frame = 1
Query:   91 SFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            + D+L +   +   D  C +    C D  TCC+ +  ++ CC +  AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V  ++   CP++ T C+ T          + CCP   AVCCSD   CCP+G TC +   +C + S  V  +E
Sbjct:   81 TTDLLTKLPAHTVGDVKC-DMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSL---PDPQALKRDVPCDNVSSCPSSDTCCQLTS-------GEWGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQCQRGSEIVAGLE 241          

HSP 3 Score: 65.855 bits (159), Expect = 4.732e-12
Identity = 49/176 (27.84%), Postives = 76/176 (43.18%), Query Frame = 1
Query:  115 QKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGNK 642
            +++V  DN+     + C    TCCQ     + CC    AVCC D  HCCP+G TC A + +C + ++    + K+         P++      +  +    CP  +T C            ++ CC   +AVCC D+  CCP G TC++K + C K   S         +   G K
Sbjct:  175 KRDVPCDNV-----SSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVA-EGQCQRGSEIVAGLEKMPARRASLSHPRD------IGCDQHTSCPVGQTCCPSLG-------GSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVK 331          

HSP 4 Score: 52.373 bits (124), Expect = 2.004e-7
Identity = 29/86 (33.72%), Postives = 42/86 (48.84%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNEN 405
            ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      E+    PA  +   P   + + +  E 
Sbjct:  259 DQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEK------EVVSAQPATFLARSPHVGVKDVECGEG 338          
BLAST of Granulin precursor vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 90.5077 bits (223), Expect = 2.227e-20
Identity = 59/191 (30.89%), Postives = 83/191 (43.46%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKN-----VTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            L+    I   G       L  Q+      +++  +CP+ R++C D  TCC+     Y CC   NA CC D  HCCP+ + CD  Q KC+    +  ++   +PA  V D          V  + EV CP+  T C+            + CCP   AVCC D   CCP G TCD +   C +    V  +E
Sbjct:  173 LVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD----------VKCDMEVSCPDGYTCCRLQS-------GAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWME 346          

HSP 2 Score: 87.0409 bits (214), Expect = 3.457e-19
Identity = 61/188 (32.45%), Postives = 85/188 (45.21%), Query Frame = 1
Query:   76 ADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGN 639
            ADG   F     +  N      CP+ + +C D  TCC     S+ CC    A CC D+ HCCP G+ CD    +C+        + K +PA + +           V  +  VMCP+ +++C D  TCC      Y CCP  NA CCSD   CCP+ T CD+   KCL    +  ++     A   G+
Sbjct:  107 ADGRSCFQ---RSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCIT-PTGTHPLAKKLPAQRTNR---------AVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD 281          

HSP 3 Score: 78.5666 bits (192), Expect = 2.588e-16
Identity = 48/164 (29.27%), Postives = 74/164 (45.12%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE-----NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDA 624
            ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      E+    PA  +   P   + + +  E     +++  C +N                 + CCP++  VCC+D+  CCP G  C  +  KCL+      +  L + A
Sbjct:  445 DQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEK------EVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDN--------------RQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPA 588          

HSP 4 Score: 77.0258 bits (188), Expect = 9.237e-16
Identity = 55/171 (32.16%), Postives = 80/171 (46.78%), Query Frame = 1
Query:   97 DVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            D+L +   +   D  C +    C D  TCC+ +  ++ CC +  AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V  ++   CP++ T C+ T          + CCP   AVCCSD   CCP+G TC +   +C + S  V  +E
Sbjct:  269 DLLTKLPAHTVGDVKC-DMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSL---PDPQALKRDVPCDNVSSCPSSDTCCQLTS-------GEWGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQCQRGSEIVAGLE 427          

HSP 5 Score: 66.6254 bits (161), Expect = 3.698e-12
Identity = 51/179 (28.49%), Postives = 78/179 (43.58%), Query Frame = 1
Query:  115 QKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL--IPALKVD-DEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGNK 642
            +++V  DN+     + C    TCCQ     + CC    AVCC D  HCCP+G TC A+     +C + +  +  L  +PA +     P++      +  +    CP  +T C            ++ CC   +AVCC D+  CCP G TC++K + C K   S         +   G K
Sbjct:  361 KRDVPCDNV-----SSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEG----QCQRGSEIVAGLEKMPARRASLSHPRD------IGCDQHTSCPVGQTCCPSLG-------GSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVK 517          

HSP 6 Score: 53.9138 bits (128), Expect = 5.712e-8
Identity = 41/142 (28.87%), Postives = 61/142 (42.96%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            C+   +C  T   +  CC +  AV C D  HCCP G  C A    C +                      NN + A       + CP+++ +C D  TCC+    ++ CCP   A CC D+  CCP G  CD+ + +C+  +
Sbjct:   67 CSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQ-------------------RSGNNSVGA-------IQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPT 182          
BLAST of Granulin precursor vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 78.5666 bits (192), Expect = 2.167e-16
Identity = 48/164 (29.27%), Postives = 74/164 (45.12%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE-----NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDA 624
            ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      E+    PA  +   P   + + +  E     +++  C +N                 + CCP++  VCC+D+  CCP G  C  +  KCL+      +  L + A
Sbjct:  288 DQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEK------EVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDN--------------RQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPA 431          

HSP 2 Score: 77.7962 bits (190), Expect = 3.676e-16
Identity = 59/178 (33.15%), Postives = 80/178 (44.94%), Query Frame = 1
Query:   76 ADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            ADG   F     +  N      CP+ + +C D  TCC     S+ CC    AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V  ++   CP++ T C+ T          + CCP   AVCCSD   CCP+G TC +   +C + S  V  +E
Sbjct:  107 ADGRSCFQ---RSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSL---PDPQALKRDVPCDNVSSCPSSDTCCQLTS-------GEWGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQCQRGSEIVAGLE 270          

HSP 3 Score: 66.2402 bits (160), Expect = 3.533e-12
Identity = 51/179 (28.49%), Postives = 78/179 (43.58%), Query Frame = 1
Query:  115 QKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL--IPALKVD-DEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGNK 642
            +++V  DN+     + C    TCCQ     + CC    AVCC D  HCCP+G TC A+     +C + +  +  L  +PA +     P++      +  +    CP  +T C            ++ CC   +AVCC D+  CCP G TC++K + C K   S         +   G K
Sbjct:  204 KRDVPCDNV-----SSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEG----QCQRGSEIVAGLEKMPARRASLSHPRD------IGCDQHTSCPVGQTCCPSLG-------GSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVK 360          

HSP 4 Score: 56.6102 bits (135), Expect = 7.479e-9
Identity = 45/149 (30.20%), Postives = 62/149 (41.61%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            C+   +C  T   +  CC +  AV C D  HCCP G  C A    C +                      NN + A       + CP+++ +C D  TCC+    ++ CCP   AVCC D   CCP G TCD +   C +    V  +E
Sbjct:   67 CSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQ-------------------RSGNNSVGA-------IQCPDSQFECPDFSTCCVMVDGSWGCCPMPQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWME 189          
BLAST of Granulin precursor vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 49.6766 bits (117), Expect = 4.596e-7
Identity = 36/116 (31.03%), Postives = 55/116 (47.41%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAV 510
            C+   +C  T   +  CC +  A CC D+ HCCP G+ CD    +C+    ++  + K +PA + +           V  +  VMCP+ +++C D  TCC      Y CCP  NA 
Sbjct:   67 CSAGHSCIFTVSGTSSCCPFPEASCCEDRVHCCPHGAFCDLVHTRCITPTGTH-PLAKKLPAQRTNRA---------VALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNAT 172          
BLAST of Granulin precursor vs. Ensembl Celegans
Match: pgrn-1 (ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:Q7JKP2])

HSP 1 Score: 96.6709 bits (239), Expect = 1.618e-23
Identity = 66/174 (37.93%), Postives = 95/174 (54.60%), Query Frame = 1
Query:   34 LGFNLLLIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTC 555
            L  +   IF +KI    ++   V L       T + C +  T+C+D +TCC+   N++ CC   NAVCC D+ HCCP G+TCD +  +C+   + +V M K  PA K  +           N+ +EV+CP+  +KC D  TCC+ +  +Y CCP  NAVCC+D   CCP G TC
Sbjct:   66 LHSSFSFIFSIKIMRLILLFLAVFLCR----VTAHQC-DAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKKKKPARKTVER----------NQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC 224          

HSP 2 Score: 60.4622 bits (145), Expect = 1.273e-10
Identity = 27/58 (46.55%), Postives = 35/58 (60.34%), Query Frame = 1
Query:  115 QKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAK 288
            ++N   + +CP+K +KC D  TCC  +  SY CC   NAVCC D  HCCP G TC  +
Sbjct:  170 ERNQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTCHGQ 227          

HSP 3 Score: 46.9802 bits (110), Expect = 4.124e-6
Identity = 19/37 (51.35%), Postives = 25/37 (67.57%), Query Frame = 1
Query:  475 NNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKS 585
            N + CCP  NAVCC D+  CCP GTTCD +  +C+ +
Sbjct:  116 NTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGA 152          
BLAST of Granulin precursor vs. Ensembl Celegans
Match: pgrn-1 (ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:Q7JKP2])

HSP 1 Score: 96.6709 bits (239), Expect = 1.768e-23
Identity = 65/171 (38.01%), Postives = 94/171 (54.97%), Query Frame = 1
Query:   43 NLLLIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTC 555
            +   IF +KI    ++   V L       T + C +  T+C+D +TCC+   N++ CC   NAVCC D+ HCCP G+TCD +  +C+   + +V M K  PA K  +           N+ +EV+CP+  +KC D  TCC+ +  +Y CCP  NAVCC+D   CCP G TC
Sbjct:   69 SFSFIFSIKIMRLILLFLAVFLCR----VTAHQC-DAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKKKKPARKTVER----------NQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC 224          

HSP 2 Score: 47.3654 bits (111), Expect = 2.714e-6
Identity = 19/37 (51.35%), Postives = 25/37 (67.57%), Query Frame = 1
Query:  475 NNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKS 585
            N + CCP  NAVCC D+  CCP GTTCD +  +C+ +
Sbjct:  116 NTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGA 152          
BLAST of Granulin precursor vs. Ensembl Celegans
Match: T02B11.8 (pep chromosome:WBcel235:V:877530:878667:-1 gene:WBGene00044776.1 transcript:T02B11.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T02B11.8)

HSP 1 Score: 43.8986 bits (102), Expect = 5.415e-6
Identity = 26/82 (31.71%), Postives = 34/82 (41.46%), Query Frame = 1
Query:   43 NLLLIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRT-KCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDA 285
            N  LIF +         F +     K     N+C  KRT +C +   CC   +  Y CC +    CCP   HCCP G +C  
Sbjct:    2 NYFLIFSI---------FVLQFHLSKCELEPNLCDEKRTTQCDEYAVCCPIGNEQYGCCPFTGGTCCPGTNHCCPPGFSCTT 74          
BLAST of Granulin precursor vs. Ensembl Zebrafish
Match: grnb (granulin b [Source:ZFIN;Acc:ZDB-GENE-030131-7393])

HSP 1 Score: 105.531 bits (262), Expect = 9.267e-26
Identity = 63/150 (42.00%), Postives = 87/150 (58.00%), Query Frame = 1
Query:  139 ICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNI-LEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKS 585
            +CP+  ++C D  TCCQ     + CC   NAVCC D+ HCCP+G+TCD     CV     +    +   A +     KN + L A+VN   EV+CP+  +KC +  TCC+ +  +Y CCP   AVCCSD+  CCPEGTTCD+ +  CL +
Sbjct:   94 VCPDGESECPDDTTCCQMPDGGWGCCPMKNAVCCDDRKHCCPQGTTCDLVHSMCVSTTYGSSPFLRKFDARRRKPLEKNAVDLPAEVNNIREVICPDKISKCPEDTTCCLLETGSYGCCPMPKAVCCSDQKHCCPEGTTCDLIHSTCLSA 243          

HSP 2 Score: 92.4337 bits (228), Expect = 2.889e-21
Identity = 63/159 (39.62%), Postives = 82/159 (51.57%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKC 576
            V L  + N   + ICP+K +KC +  TCC  +  SY CC    AVCC D+ HCCPEG+TCD     C+  A    EM   IPA+ V  +PK  ++      N+ V C +         TCC T   ++ CCP   AVCC D   CCPEGT C++    C
Sbjct:  174 VDLPAEVNNIREVICPDKISKCPEDTTCCLLETGSYGCCPMPKAVCCSDQKHCCPEGTTCDLIHSTCLS-ANGVSEMATKIPAVTV-LKPKEEVVPC----NETVACSSG-------TTCCKTPEGSWACCPLPKAVCCEDHIHCCPEGTLCNVAASSC 319          

HSP 3 Score: 86.2705 bits (212), Expect = 3.715e-19
Identity = 65/181 (35.91%), Postives = 89/181 (49.17%), Query Frame = 1
Query:   91 SFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEEN 633
            +F  LL    N  T  ICP+    C D  TCC T    Y CC   +A CC D  HCC +G+ CD +  KCV   K++V    L    KV+ +     L+A V  + E  CP++        TCC      + CCP KNAVCC D+  CCP+GTTCD+ +  C+ +++  +      DA   
Sbjct:    5 AFIALLCVCVNACTALICPDGGM-CEDGNTCCLTPSGGYGCCPLPHAECCSDHLHCCYQGTLCDLEHSKCVN--KTHV----LDWVEKVEAK-----LQAVVCPDGESECPDD-------TTCCQMPDGGWGCCPMKNAVCCDDRKHCCPQGTTCDLVHSMCVSTTYGSSPFLRKFDARRR 166          

HSP 4 Score: 83.1889 bits (204), Expect = 4.769e-18
Identity = 60/190 (31.58%), Postives = 83/190 (43.68%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKNVTTDNICP------NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKS----NVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSF 591
            L  V     D      V +   + V+T  I P      ++ + C    TCC+     + CC    AVCC D  HCCP GS C+     C   + S    +V M K IPA+ V  +        K N ++   CP   T CK T         ++ CCP   AVCC+D+  CCP+G TCD+    C++S  
Sbjct:  311 LCNVAASSCDDPAGLSVSVPWMEKVSTKPIAPPPNKKCDESSSCPGESTCCKLSSGDWGCCPLPEAVCCEDHVHCCPHGSVCNVAAETCETVSDSGLRISVPMVKKIPAVSVPSQ--------KQNCDETSSCPTGTTCCKLTS-------GSWACCPMPQAVCCADQEHCCPQGYTCDLAQSSCVRSGL 485          

HSP 5 Score: 74.3294 bits (181), Expect = 4.796e-15
Identity = 59/196 (30.10%), Postives = 86/196 (43.88%), Query Frame = 1
Query:   37 GFNLLLIFVVKIYADGVMSFDVLLENQKNVTT-DNICP-NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPAL-KVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELP 615
            G    LI    + A+GV      +     +   + + P N+   C+   TCC+T   S+ CC    AVCC D  HCCPEG+ C+     C   A  +V     +P + KV  +P       K +E+    CP   T CK +         ++ CCP   AVCC D   CCP G+ C++  + C   S S   + +P
Sbjct:  230 GTTCDLIHSTCLSANGVSEMATKIPAVTVLKPKEEVVPCNETVACSSGTTCCKTPEGSWACCPLPKAVCCEDHIHCCPEGTLCNVAASSCDDPAGLSVS----VPWMEKVSTKPIAPPPNKKCDESSS--CPGESTCCKLSS-------GDWGCCPLPEAVCCEDHVHCCPHGSVCNVAAETCETVSDSGLRISVP 412          

HSP 6 Score: 73.9442 bits (180), Expect = 7.702e-15
Identity = 57/191 (29.84%), Postives = 83/191 (43.46%), Query Frame = 1
Query:   25 VAILGFNLLLIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            V+  G  + +  V KI A  V S       ++N    + CP          TCC+    S+ CC    AVCC D+ HCCP+G TCD  Q  CV+    ++   +  PAL+     +   +E +   + +  CP + T C   +         + CCP   AVCC D   CCP G TC+ +   C K    +
Sbjct:  402 VSDSGLRISVPMVKKIPAVSVPS------QKQNCDETSSCPTG-------TTCCKLTSGSWACCPMPQAVCCADQEHCCPQGYTCDLAQSSCVRSGLPSMAWFRKEPALR-----ETQRVEDRHMCDAQTSCPRDDTCCFINRI------GKWGCCPLPKAVCCKDGDHCCPSGYTCNEEKTSCTKGLHQI 568          

HSP 7 Score: 58.151 bits (139), Expect = 1.470e-9
Identity = 50/176 (28.41%), Postives = 72/176 (40.91%), Query Frame = 1
Query:  106 LENQKNVTTDNICPNKRTKCTDRQTCCQT-KHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKS----SFSVNNVELPN 618
            L   + V   ++C + +T C    TCC   +   + CC    AVCC D  HCCP G TC+ ++  C K         K     +V       +    V  +    CP+  T C             + CCP   AVCC D   CCP+G  C ++   C K+    S S+  V++P 
Sbjct:  497 LRETQRVEDRHMC-DAQTSCPRDDTCCFINRIGKWGCCPLPKAVCCKDGDHCCPSGYTCNEEKTSCTKGLHQIPWFTKK--TARVWKSSDELLGHEDVKCDSSTSCPSGSTCCILPT-------GQWGCCPLVKAVCCEDHEHCCPQGYICKLELGTCEKASADVSVSLTAVQMPE 662          

HSP 8 Score: 57.3806 bits (137), Expect = 2.989e-9
Identity = 50/180 (27.78%), Postives = 71/180 (39.44%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL---IPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLK 582
            + +  K  A    S D LL   ++V  D+      T C    TCC      + CC    AVCC D  HCCP+G  C  +   C K A ++V +      +P ++ D   +    ++     D                      + + CCP+  AVCC D   CCP G  CD K + C K
Sbjct:  568 IPWFTKKTARVWKSSDELL-GHEDVKCDS-----STSCPSGSTCCILPTGQWGCCPLVKAVCCEDHEHCCPQGYICKLELGTCEK-ASADVSVSLTAVQMPEIQCDTFTRCAHTQSCCRLAD----------------------STWACCPYTQAVCCKDMKHCCPMGYKCDPKVQGCTK 718          
BLAST of Granulin precursor vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 81.2629 bits (199), Expect = 8.008e-19
Identity = 58/171 (33.92%), Postives = 77/171 (45.03%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEP-KNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            V +    + ++D  C N    C D  TCC+TK   + CC    AVCC D  HCCP G  CD     C   +  +V   + +P   +  +   N  + + V  ND V CP+         TCC  K  ++ CCP   AVCC D   CCP G  C++    C   S SV  VE
Sbjct:   15 VAVTQASSASSDVPC-NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-SSGSVPWVEKVPVRPIRKQKVANTKVSSDVACNDTVACPDG-------STCCKDKDGDWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVE 176          
BLAST of Granulin precursor vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 82.4185 bits (202), Expect = 8.447e-18
Identity = 61/186 (32.80%), Postives = 80/186 (43.01%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            + +V K+    +    V +    +V++D  C N    C D  TCC+TK   + CC    AVCC D  HCCP+G  C+    KC     +   + K  P             ++ V  ND   CP+         TCC TK   + CCP   AVCC D   CCP G  CD+    C   S SV  VE
Sbjct:  349 VSWVEKVPVRPIRKQKVAVTQVSSVSSDVPC-NDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDG-------STCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVE 526          

HSP 2 Score: 80.8777 bits (198), Expect = 3.021e-17
Identity = 59/190 (31.05%), Postives = 83/190 (43.68%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE----NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            + ++ K+    +    V +    + ++D  C N    C D  TCC+TK   + CC    AVCC D  HCCP G  CD     C   +  +V   + +P   +  +   N   + V+     ND V CP+         TCC  K  ++ CCP   AVCC D   CCP G  C++    C   S SV  VE
Sbjct:  610 VPWMDKVPVRPIKKQKVAVTQASSASSDVPC-NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-SSGSVPWVEKVPVRPIRKQKVANTKVSPVSSDVACNDTVACPDG-------STCCKDKDGDWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVE 790          

HSP 3 Score: 79.7221 bits (195), Expect = 8.038e-17
Identity = 64/191 (33.51%), Postives = 83/191 (43.46%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAK-----VNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            + +V K+    +    V +     V++D  C N    C D  TCC+ K   + CC    AVCC D  HCCP G  C+     C   + S   M K +P   +  + K  + +A      V  ND   CP+         TCC TK   + CCP   AVCC D   CCP G  CD+    C  SS SV  VE
Sbjct:  522 VPWVEKVPVRPIRKQKVAVTTVSPVSSDIAC-NDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDK-VPVRPIKKQ-KVAVTQASSASSDVPCNDTAACPDG-------STCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDSSGSVPWVE 702          

HSP 4 Score: 78.5666 bits (192), Expect = 2.000e-16
Identity = 63/191 (32.98%), Postives = 77/191 (40.31%), Query Frame = 1
Query:  139 ICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPA-LKVDDE------PKNNILEAK---------------------------VNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            +C N  ++C    TCCQ     + CC    AVCC DK HCCPE + CD K  KCV      + M    PA L+ + E      P+     A+                           V  ND   CP+         TCC TK   + CCP   AVCC D   CCP G  CD+    C   S SV+ VE
Sbjct:  170 LCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDG-------STCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVE 353          

HSP 5 Score: 75.485 bits (184), Expect = 2.355e-15
Identity = 57/162 (35.19%), Postives = 76/162 (46.91%), Query Frame = 1
Query:   94 FDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE-NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKC 576
               L    + V++D  C N    C D  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +    K  +   +V+  + +V C N+   C D  TCC TK  ++ CCP   AVCC D   CCP+G  C+I   KC
Sbjct:  275 MTTLPAEHQGVSSDVAC-NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-PSGSVSWVEKVPVRPIR---KQKVAVTQVSSVSSDVPC-NDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKC 430          

HSP 6 Score: 71.633 bits (174), Expect = 4.822e-14
Identity = 46/136 (33.82%), Postives = 69/136 (50.74%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTC 555
            ++++ C+   TCC    +   CC +  AVCCPD+ HCCPEG  CD ++  CVK  +  VE+ +L       ++P+ +++   V       C +        +TCC+T    + CCP   AVCC D   CCP G  C
Sbjct:  890 DEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQLTHIRS--NKPQPSVVVKDVQCGGGFSCHDG-------ETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKC 1016          

HSP 7 Score: 68.1662 bits (165), Expect = 7.883e-13
Identity = 53/182 (29.12%), Postives = 75/182 (41.21%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            + +V K+    +    V       V++D  C N    C D  TCC+ K   + CC    AVCC D  HCCP G  C+     C   + S   + K+   L+    P       KV  N    CP + T CK+           + CCP   AVCC+D   CCP    C++ +  C+K    +
Sbjct:  698 VPWVEKVPVRPIRKQKVANTKVSPVSSDVAC-NDTVACPDGSTCCKDKDGDWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSG-----KVKCNATHGCPESSTCCKNIA-------GEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVI 866          

HSP 8 Score: 65.4698 bits (158), Expect = 6.082e-12
Identity = 49/165 (29.70%), Postives = 67/165 (40.61%), Query Frame = 1
Query:  142 CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKN--NILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEE 630
            CPN    C   Q+CCQ     + CC + +  CC D  HCCPEG  C  K   C     +     + +   K  D PK+   I     +E+D + CP+        +  C+    +Y CCP    + CSD   CCP    C   +  C+K    V  V   N   E
Sbjct:   19 CPNNEV-CEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTL--AKKPDLPKSFRMIFSMPASESD-ITCPDG--SSCPAEFSCLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVKRKVKVQTVLCGNGTSE 177          

HSP 9 Score: 63.929 bits (154), Expect = 1.743e-11
Identity = 48/152 (31.58%), Postives = 69/152 (45.39%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIP-----ALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            N    C +  TCC+     + CC ++ AVCC D  HCCP    C+      V C K +V    +IP     A +    PK ++   K +E                 TCC+   +   CCP   AVCC D+  CCPEG  CD++ + C+K++
Sbjct:  809 NATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSS---VSCIKGDV----VIPWYNKIAAESTPAPKLDLGVVKCDEQSSC---------SADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTT 944          

HSP 10 Score: 57.7658 bits (138), Expect = 2.164e-9
Identity = 52/156 (33.33%), Postives = 62/156 (39.74%), Query Frame = 1
Query:  163 CTDRQTC-----CQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELP 615
            C D  +C     C     SY CC  A  + C D  HCCP    C      CVK                          + KV     V+C N  ++C    TCC      + CCP   AVCC DK  CCPE T CD+K  KC+ S+    N ELP
Sbjct:  109 CPDGSSCPAEFSCLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVK-------------------------RKVKVQT---VLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSST----NQELP 232          
BLAST of Granulin precursor vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 82.4185 bits (202), Expect = 8.890e-18
Identity = 61/186 (32.80%), Postives = 80/186 (43.01%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            + +V K+    +    V +    +V++D  C N    C D  TCC+TK   + CC    AVCC D  HCCP+G  C+    KC     +   + K  P             ++ V  ND   CP+         TCC TK   + CCP   AVCC D   CCP G  CD+    C   S SV  VE
Sbjct:  349 VSWVEKVPVRPIRKQKVAVTQVSSVSSDVPC-NDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDG-------STCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVE 526          

HSP 2 Score: 78.5666 bits (192), Expect = 1.826e-16
Identity = 63/191 (32.98%), Postives = 77/191 (40.31%), Query Frame = 1
Query:  139 ICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPA-LKVDDE------PKNNILEAK---------------------------VNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            +C N  ++C    TCCQ     + CC    AVCC DK HCCPE + CD K  KCV      + M    PA L+ + E      P+     A+                           V  ND   CP+         TCC TK   + CCP   AVCC D   CCP G  CD+    C   S SV+ VE
Sbjct:  170 LCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDG-------STCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVE 353          

HSP 3 Score: 75.485 bits (184), Expect = 2.551e-15
Identity = 57/162 (35.19%), Postives = 76/162 (46.91%), Query Frame = 1
Query:   94 FDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE-NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKC 576
               L    + V++D  C N    C D  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +    K  +   +V+  + +V C N+   C D  TCC TK  ++ CCP   AVCC D   CCP+G  C+I   KC
Sbjct:  275 MTTLPAEHQGVSSDVAC-NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-PSGSVSWVEKVPVRPIR---KQKVAVTQVSSVSSDVPC-NDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKC 430          

HSP 4 Score: 75.0998 bits (183), Expect = 2.913e-15
Identity = 54/158 (34.18%), Postives = 67/158 (42.41%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE----NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            N    C D  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +  +       + V+     ND V CP+  T CKD           + CCP   AVCC D   CCP G  C++    C   S SV  VE
Sbjct:  465 NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-PSGSVPWVEKVPVRPIRKQKVAVTTVSPVSSDIACNDTVACPDGSTCCKDK-------DGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVE 614          

HSP 5 Score: 71.633 bits (174), Expect = 4.163e-14
Identity = 46/136 (33.82%), Postives = 69/136 (50.74%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTC 555
            ++++ C+   TCC    +   CC +  AVCCPD+ HCCPEG  CD ++  CVK  +  VE+ +L       ++P+ +++   V       C +        +TCC+T    + CCP   AVCC D   CCP G  C
Sbjct:  714 DEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQLTHIRS--NKPQPSVVVKDVQCGGGFSCHDG-------ETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKC 840          

HSP 6 Score: 70.4774 bits (171), Expect = 1.092e-13
Identity = 53/182 (29.12%), Postives = 76/182 (41.76%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            + +V K+    +    V +     V++D  C N    C D  TCC+ K   + CC    AVCC D  HCCP G  C+     C   + S   + K+   L+    P       KV  N    CP + T CK+           + CCP   AVCC+D   CCP    C++ +  C+K    +
Sbjct:  522 VPWVEKVPVRPIRKQKVAVTTVSPVSSDIAC-NDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSG-----KVKCNATHGCPESSTCCKNIA-------GEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVI 690          

HSP 7 Score: 65.855 bits (159), Expect = 4.970e-12
Identity = 48/165 (29.09%), Postives = 68/165 (41.21%), Query Frame = 1
Query:  142 CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKN--NILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEE 630
            CPN    C   Q+CCQ     + CC + +  CC D  HCCPEG  C  K   C     +     + +   K  D PK+   I     +E+D + CP+  +   +     ++   +Y CCP    + CSD   CCP    C   +  C+K    V  V   N   E
Sbjct:   19 CPNNEV-CEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTL--AKKPDLPKSFRMIFSMPASESD-ITCPDGSSCPAEFSCLLMS--TSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVKRKVKVQTVLCGNGTSE 177          

HSP 8 Score: 64.3142 bits (155), Expect = 1.493e-11
Identity = 48/152 (31.58%), Postives = 69/152 (45.39%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIP-----ALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            N    C +  TCC+     + CC ++ AVCC D  HCCP    C+      V C K +V    +IP     A +    PK ++   K +E                 TCC+   +   CCP   AVCC D+  CCPEG  CD++ + C+K++
Sbjct:  633 NATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSS---VSCIKGDV----VIPWYNKIAAESTPAPKLDLGVVKCDEQSSC---------SADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTT 768          

HSP 9 Score: 57.7658 bits (138), Expect = 2.219e-9
Identity = 49/144 (34.03%), Postives = 58/144 (40.28%), Query Frame = 1
Query:  184 CQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELP 615
            C     SY CC  A  + C D  HCCP    C      CVK                          + KV     V+C N  ++C    TCC      + CCP   AVCC DK  CCPE T CD+K  KC+ S+    N ELP
Sbjct:  121 CLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVK-------------------------RKVKVQT---VLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSST----NQELP 232          
BLAST of Granulin precursor vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 82.4185 bits (202), Expect = 9.323e-18
Identity = 61/186 (32.80%), Postives = 80/186 (43.01%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            + +V K+    +    V +    +V++D  C N    C D  TCC+TK   + CC    AVCC D  HCCP+G  C+    KC     +   + K  P             ++ V  ND   CP+         TCC TK   + CCP   AVCC D   CCP G  CD+    C   S SV  VE
Sbjct:  349 VSWVEKVPVRPIRKQKVAVTQVSSVSSDVPC-NDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDG-------STCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVE 526          

HSP 2 Score: 78.5666 bits (192), Expect = 1.933e-16
Identity = 63/191 (32.98%), Postives = 77/191 (40.31%), Query Frame = 1
Query:  139 ICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPA-LKVDDE------PKNNILEAK---------------------------VNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            +C N  ++C    TCCQ     + CC    AVCC DK HCCPE + CD K  KCV      + M    PA L+ + E      P+     A+                           V  ND   CP+         TCC TK   + CCP   AVCC D   CCP G  CD+    C   S SV+ VE
Sbjct:  170 LCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDG-------STCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVE 353          

HSP 3 Score: 75.0998 bits (183), Expect = 2.700e-15
Identity = 57/162 (35.19%), Postives = 76/162 (46.91%), Query Frame = 1
Query:   94 FDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE-NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKC 576
               L    + V++D  C N    C D  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +    K  +   +V+  + +V C N+   C D  TCC TK  ++ CCP   AVCC D   CCP+G  C+I   KC
Sbjct:  275 MTTLPAEHQGVSSDVAC-NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-PSGSVSWVEKVPVRPIR---KQKVAVTQVSSVSSDVPC-NDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKC 430          

HSP 4 Score: 73.9442 bits (180), Expect = 7.164e-15
Identity = 52/158 (32.91%), Postives = 65/158 (41.14%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDE----PKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            N    C D  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +  +       +   + V  ND   CP+  T CK            + CCP   AVCC D   CCP G  C++    C   S SV  VE
Sbjct:  465 NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-PSGSVPWVEKVPVRPIRKQKVAVTTASSASSDVPCNDTAACPDGSTCCKTK-------DGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVE 614          

HSP 5 Score: 72.4034 bits (176), Expect = 2.230e-14
Identity = 53/182 (29.12%), Postives = 77/182 (42.31%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            + +V K+    +    V +    + ++D  C N    C D  TCC+TK   + CC    AVCC D  HCCP G  C+     C   + S   + K+   L+    P       KV  N    CP + T CK+           + CCP   AVCC+D   CCP    C++ +  C+K    +
Sbjct:  522 VPWVEKVPVRPIRKQKVAVTTASSASSDVPC-NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSG-----KVKCNATHGCPESSTCCKNIA-------GEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVI 690          

HSP 6 Score: 71.633 bits (174), Expect = 4.490e-14
Identity = 46/136 (33.82%), Postives = 69/136 (50.74%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTC 555
            ++++ C+   TCC    +   CC +  AVCCPD+ HCCPEG  CD ++  CVK  +  VE+ +L       ++P+ +++   V       C +        +TCC+T    + CCP   AVCC D   CCP G  C
Sbjct:  714 DEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQLTHIRS--NKPQPSVVVKDVQCGGGFSCHDG-------ETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKC 840          

HSP 7 Score: 65.4698 bits (158), Expect = 5.358e-12
Identity = 48/165 (29.09%), Postives = 68/165 (41.21%), Query Frame = 1
Query:  142 CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKN--NILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEE 630
            CPN    C   Q+CCQ     + CC + +  CC D  HCCPEG  C  K   C     +     + +   K  D PK+   I     +E+D + CP+  +   +     ++   +Y CCP    + CSD   CCP    C   +  C+K    V  V   N   E
Sbjct:   19 CPNNEV-CEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTL--AKKPDLPKSFRMIFSMPASESD-ITCPDGSSCPAEFSCLLMS--TSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVKRKVKVQTVLCGNGTSE 177          

HSP 8 Score: 64.3142 bits (155), Expect = 1.625e-11
Identity = 48/152 (31.58%), Postives = 69/152 (45.39%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIP-----ALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            N    C +  TCC+     + CC ++ AVCC D  HCCP    C+      V C K +V    +IP     A +    PK ++   K +E                 TCC+   +   CCP   AVCC D+  CCPEG  CD++ + C+K++
Sbjct:  633 NATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSS---VSCIKGDV----VIPWYNKIAAESTPAPKLDLGVVKCDEQSSC---------SADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTT 768          

HSP 9 Score: 57.7658 bits (138), Expect = 2.240e-9
Identity = 49/144 (34.03%), Postives = 58/144 (40.28%), Query Frame = 1
Query:  184 CQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELP 615
            C     SY CC  A  + C D  HCCP    C      CVK                          + KV     V+C N  ++C    TCC      + CCP   AVCC DK  CCPE T CD+K  KC+ S+    N ELP
Sbjct:  121 CLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVK-------------------------RKVKVQT---VLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSST----NQELP 232          
BLAST of Granulin precursor vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 87.8113 bits (216), Expect = 1.739e-19
Identity = 62/183 (33.88%), Postives = 90/183 (49.18%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQ-TKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNV-ELPNDAEENGNK 642
            +   NQ  V    +CP+ R++C    TCC  +  +S+ CC    AVCC D  HCCP  S CD +Q +C+        M KL   +K + +      E +V   D   CP+  T C+          + Y CC   +AVCCSD   CCP GTTCD+ +KKC+  +     + ++P   EE+ N+
Sbjct:  131 IPASNQSAV----VCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDE-----ERRVPCLDGTFCPDGSTCCEQVD-------HTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQ 297          

HSP 2 Score: 77.7962 bits (190), Expect = 4.859e-16
Identity = 51/147 (34.69%), Postives = 63/147 (42.86%), Query Frame = 1
Query:  157 TKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            T C D  TCC+   ++Y CC   +AVCC D  HCCP G+TCD    KCV    S    G L+P +    E   N +        E  C                    + CCP   AVCC+D   CCPEG TC     +C K   S+
Sbjct:  227 TFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCV----SQTGEGPLLPQMPAIREESANQVPCDATTKKETCC--------------RLVSGKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSKMEHSI 353          

HSP 3 Score: 74.7146 bits (182), Expect = 6.408e-15
Identity = 53/162 (32.72%), Postives = 72/162 (44.44%), Query Frame = 1
Query:  160 KCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNV----ELPNDAEEN 633
             C D QTCC+     + CC  A AVCC D  HCCP G TC   Q       + ++      PALK   +         V  +D   C + +T C+           ++ CCP   AVCCSD + CCP+G TCD +   C+   FS+  +     LP D   +
Sbjct:  450 SCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGSQ---CMIGEHSIPWFSKTPALKQKAK--------DVQCDDMYSCADGQTCCRLAS-------GDWGCCPIAQAVCCSDHWHCCPQGFTCDARG-TCVLGQFSIPWLTKVPALPFDGTHS 592          

HSP 4 Score: 63.5438 bits (153), Expect = 3.599e-11
Identity = 54/166 (32.53%), Postives = 73/166 (43.98%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
             L    ++V  D++       C D QTCC+     + CC  A AVCC D  HCCP G TC   Q  C K  + ++ +    PAL+               E   V C ++   C D +TCC     ++ CCP   AVCC D   CCP G TC     +C+    S+
Sbjct:  361 ALTHEARDVECDDM-----YSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQ--CQK-GEHSIPLFSKTPALR--------------QETKYVKC-DDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCMIGEHSI 501          

HSP 5 Score: 58.9214 bits (141), Expect = 1.513e-9
Identity = 33/87 (37.93%), Postives = 46/87 (52.87%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVD 360
             L +  K+V  D++       C D QTCC+     + CC  A AVCC D +HCCP+G TCDA+   CV   + ++     +PAL  D
Sbjct:  509 ALKQKAKDVQCDDM-----YSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARG-TCVL-GQFSIPWLTKVPALPFD 588          

HSP 6 Score: 51.6026 bits (122), Expect = 4.361e-7
Identity = 32/135 (23.70%), Postives = 52/135 (38.52%), Query Frame = 1
Query:    7 SKM-KNFVAILGFNLLLIFVVKIYADGVMSFDVLLENQ----------KNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNN 378
            SKM K  V +L    ++  V   +   ++ +  L +            + +  D +  + +  C D QTCC+     ++CC Y   VCCPD  HCCP G  C      C +      +     P       P++ 
Sbjct:  623 SKMVKRTVILLATACIVTLVSFSFCPDIIIYYALQKEAIETSPSDTSVQGLRLDYVWCDSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCLNHGTSCSRSGSPRWDGQSGSPHWDGKQSPRDG 757          
BLAST of Granulin precursor vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 87.4261 bits (215), Expect = 2.234e-19
Identity = 62/183 (33.88%), Postives = 90/183 (49.18%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQ-TKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNV-ELPNDAEENGNK 642
            +   NQ  V    +CP+ R++C    TCC  +  +S+ CC    AVCC D  HCCP  S CD +Q +C+        M KL   +K + +      E +V   D   CP+  T C+          + Y CC   +AVCCSD   CCP GTTCD+ +KKC+  +     + ++P   EE+ N+
Sbjct:  111 IPASNQSAV----VCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDE-----ERRVPCLDGTFCPDGSTCCEQVD-------HTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQ 277          

HSP 2 Score: 77.7962 bits (190), Expect = 5.727e-16
Identity = 51/147 (34.69%), Postives = 63/147 (42.86%), Query Frame = 1
Query:  157 TKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            T C D  TCC+   ++Y CC   +AVCC D  HCCP G+TCD    KCV    S    G L+P +    E   N +        E  C                    + CCP   AVCC+D   CCPEG TC     +C K   S+
Sbjct:  207 TFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCV----SQTGEGPLLPQMPAIREESANQVPCDATTKKETCC--------------RLVSGKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSKMEHSI 333          

HSP 3 Score: 74.3294 bits (181), Expect = 7.694e-15
Identity = 53/162 (32.72%), Postives = 72/162 (44.44%), Query Frame = 1
Query:  160 KCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNV----ELPNDAEEN 633
             C D QTCC+     + CC  A AVCC D  HCCP G TC   Q       + ++      PALK   +         V  +D   C + +T C+           ++ CCP   AVCCSD + CCP+G TCD +   C+   FS+  +     LP D   +
Sbjct:  430 SCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGSQ---CMIGEHSIPWFSKTPALKQKAK--------DVQCDDMYSCADGQTCCRLAS-------GDWGCCPIAQAVCCSDHWHCCPQGFTCDARG-TCVLGQFSIPWLTKVPALPFDGTHS 572          

HSP 4 Score: 63.5438 bits (153), Expect = 4.004e-11
Identity = 54/166 (32.53%), Postives = 73/166 (43.98%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
             L    ++V  D++       C D QTCC+     + CC  A AVCC D  HCCP G TC   Q  C K  + ++ +    PAL+               E   V C ++   C D +TCC     ++ CCP   AVCC D   CCP G TC     +C+    S+
Sbjct:  341 ALTHEARDVECDDM-----YSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQ--CQK-GEHSIPLFSKTPALR--------------QETKYVKC-DDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCMIGEHSI 481          

HSP 5 Score: 58.5362 bits (140), Expect = 1.698e-9
Identity = 33/87 (37.93%), Postives = 46/87 (52.87%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVD 360
             L +  K+V  D++       C D QTCC+     + CC  A AVCC D +HCCP+G TCDA+   CV   + ++     +PAL  D
Sbjct:  489 ALKQKAKDVQCDDM-----YSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARG-TCVL-GQFSIPWLTKVPALPFD 568          

HSP 6 Score: 51.6026 bits (122), Expect = 4.296e-7
Identity = 32/135 (23.70%), Postives = 52/135 (38.52%), Query Frame = 1
Query:    7 SKM-KNFVAILGFNLLLIFVVKIYADGVMSFDVLLENQ----------KNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNN 378
            SKM K  V +L    ++  V   +   ++ +  L +            + +  D +  + +  C D QTCC+     ++CC Y   VCCPD  HCCP G  C      C +      +     P       P++ 
Sbjct:  603 SKMVKRTVILLATACIVTLVSFSFCPDIIIYYALQKEAIETSPSDTSVQGLRLDYVWCDSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCLNHGTSCSRSGSPRWDGQSGSPHWDGKQSPRDG 737          
BLAST of Granulin precursor vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 87.0409 bits (214), Expect = 4.062e-19
Identity = 62/185 (33.51%), Postives = 90/185 (48.65%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQ-TKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNIL--EAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNV-ELPNDAEENGNK 642
            +   NQ  V    +CP+ R++C    TCC  +  +S+ CC    AVCC D  HCCP  S CD +Q +C+        M KL   +K +      +   E +V   D   CP+  T C+          + Y CC   +AVCCSD   CCP GTTCD+ +KKC+  +     + ++P   EE+ N+
Sbjct:  111 IPASNQSAV----VCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLGDEERRVPCLDGTFCPDGSTCCEQVD-------HTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQ 284          

HSP 2 Score: 75.8702 bits (185), Expect = 2.092e-15
Identity = 52/147 (35.37%), Postives = 68/147 (46.26%), Query Frame = 1
Query:  157 TKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            T C D  TCC+   ++Y CC   +AVCC D  HCCP G+TCD    KCV    S    G L+P +    E   N    +V  +    CP+  T C  +          + CCP+  AVCC D   CCP G TC      C+ +  S+
Sbjct:  214 TFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCV----SQTGEGPLLPQMPAIREESAN----QVPCDATTSCPDKNTCCHLSS-------EKWGCCPYAQAVCCDDHIHCCPSGFTC--SGGSCVLAEHSI 343          

HSP 3 Score: 63.5438 bits (153), Expect = 3.656e-11
Identity = 50/160 (31.25%), Postives = 66/160 (41.25%), Query Frame = 1
Query:  160 KCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGN 639
             C D QTCC+     + CC  A AVCC D  HCCP G TC   Q       + ++      PALK   +         V  +D   C + +T C+           ++ CCP   AVCC D   CCP G TC     +C K   S+         ++ GN
Sbjct:  514 SCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGSQ---CMIGEHSIPWFSKTPALKQKAK--------DVQCDDMYSCADGQTCCRLAS-------GDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQCQKGEHSIPWYSKTPALKQEGN 653          

HSP 4 Score: 63.1586 bits (152), Expect = 5.079e-11
Identity = 54/166 (32.53%), Postives = 73/166 (43.98%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
             L    ++V  D++       C D QTCC+     + CC  A AVCC D  HCCP G TC   Q  C K  + ++ +    PAL+               E   V C ++   C D +TCC     ++ CCP   AVCC D   CCP G TC     +C+    S+
Sbjct:  425 ALTHEARDVECDDM-----YSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQ--CQK-GEHSIPLFSKTPALR--------------QETKYVKC-DDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCMIGEHSI 565          

HSP 5 Score: 62.7734 bits (151), Expect = 6.922e-11
Identity = 51/161 (31.68%), Postives = 74/161 (45.96%), Query Frame = 1
Query:  118 KNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVM-CPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            + + T  +  +    C +++TCC+     + CC    AVCC D  HCCPEG TC   Q +C K  + ++      PAL           EA+  E D++  CP+ +T C+           ++ CCP   AVCC D   CCP G TC     +C K   S+
Sbjct:  352 QGLKTTRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSK-MEHSIPWFTKTPAL---------THEARDVECDDMYSCPDGQTCCRLAS-------GDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQCQKGEHSI 491          

HSP 6 Score: 51.2174 bits (121), Expect = 4.931e-7
Identity = 32/135 (23.70%), Postives = 52/135 (38.52%), Query Frame = 1
Query:    7 SKM-KNFVAILGFNLLLIFVVKIYADGVMSFDVLLENQ----------KNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNN 378
            SKM K  V +L    ++  V   +   ++ +  L +            + +  D +  + +  C D QTCC+     ++CC Y   VCCPD  HCCP G  C      C +      +     P       P++ 
Sbjct:  808 SKMVKRTVILLATACIVTLVSFSFCPDIIIYYALQKEAIETSPSDTSVQGLRLDYVWCDSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCLNHGTSCSRSGSPRWDGQSGSPHWDGKQSPRDG 942          
BLAST of Granulin precursor vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 86.6557 bits (213), Expect = 5.126e-19
Identity = 62/185 (33.51%), Postives = 90/185 (48.65%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQ-TKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNIL--EAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNV-ELPNDAEENGNK 642
            +   NQ  V    +CP+ R++C    TCC  +  +S+ CC    AVCC D  HCCP  S CD +Q +C+        M KL   +K +      +   E +V   D   CP+  T C+          + Y CC   +AVCCSD   CCP GTTCD+ +KKC+  +     + ++P   EE+ N+
Sbjct:  111 IPASNQSAV----VCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLGDEERRVPCLDGTFCPDGSTCCEQVD-------HTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQ 284          

HSP 2 Score: 75.8702 bits (185), Expect = 2.765e-15
Identity = 52/147 (35.37%), Postives = 68/147 (46.26%), Query Frame = 1
Query:  157 TKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            T C D  TCC+   ++Y CC   +AVCC D  HCCP G+TCD    KCV    S    G L+P +    E   N    +V  +    CP+  T C  +          + CCP+  AVCC D   CCP G TC      C+ +  S+
Sbjct:  214 TFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCV----SQTGEGPLLPQMPAIREESAN----QVPCDATTSCPDKNTCCHLSS-------EKWGCCPYAQAVCCDDHIHCCPSGFTC--SGGSCVLAEHSI 343          

HSP 3 Score: 62.3882 bits (150), Expect = 9.124e-11
Identity = 48/146 (32.88%), Postives = 62/146 (42.47%), Query Frame = 1
Query:  160 KCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
             C D QTCC+     + CC  A AVCC D  HCCP G TC   Q       + ++      PALK   +         V  +D   C + +T C+           ++ CCP   AVCC D   CCP G TC     +C K   S+
Sbjct:  556 SCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGSQ---CMIGEHSIPWFSKTPALKQKAK--------DVQCDDMYSCADGQTCCRLAS-------GDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQCQKGEHSI 681          

HSP 4 Score: 58.9214 bits (141), Expect = 1.220e-9
Identity = 49/165 (29.70%), Postives = 71/165 (43.03%), Query Frame = 1
Query:  118 KNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKS-----NVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            + + T  +  +    C +++TCC+     + CC    AVCC D  HCCPEG TC   Q +C K   S        M   +    +   P  ++    V  +D   CP+ +T C+           ++ CCP   AVCC D   CCP G TC     +C K   S+
Sbjct:  352 QGLKTTRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSKMEHSIPWFTKTPMVFFLSLSLLSILPVVSVAR-DVECDDMYSCPDGQTCCRLAS-------GDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQCQKGEHSI 504          

HSP 5 Score: 58.9214 bits (141), Expect = 1.327e-9
Identity = 61/212 (28.77%), Postives = 90/212 (42.45%), Query Frame = 1
Query:    7 SKMKNFVAILGFNLLLIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK---------VDDE---PKNNILEAKV---NENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            SKM++ +       ++ F+       +    V     ++V  D++       C D QTCC+     + CC  A AVCC D  HCCP G TC   Q  C K  + ++ +    PAL+          DDE   P   +    +   +    V C ++   C D +TCC     ++ CCP   AVCC D   CCP G TC     +C+    S+
Sbjct:  411 SKMEHSIPWFTKTPMVFFLSLSLLSILPVVSV----ARDVECDDM-----YSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQ--CQK-GEHSIPLFSKTPALRQETACARRCGDDEYPFPLCLLFSPFICPFSVAKYVKC-DDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCMIGEHSI 607          

HSP 6 Score: 51.2174 bits (121), Expect = 4.686e-7
Identity = 32/87 (36.78%), Postives = 42/87 (48.28%), Query Frame = 1
Query:  103 LLENQKNVTTDNICP-NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVD 360
            L     NV   NI   +    C D  TCC+     + CC    AVCC D +HCCP+G TCDA+   CV   + ++     +PAL  D
Sbjct:  698 LANTPVNVFAGNIVKCDDSFACKDGYTCCRMVSGVWGCCPIEKAVCCSDHWHCCPQGFTCDARG-TCVL-GQFSIPWLTKVPALPFD 782          

HSP 7 Score: 48.9062 bits (115), Expect = 3.079e-6
Identity = 24/87 (27.59%), Postives = 36/87 (41.38%), Query Frame = 1
Query:  118 KNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNN 378
            + +  D +  + +  C D QTCC+     ++CC Y   VCCPD  HCCP G  C      C +      +     P       P++ 
Sbjct:  829 QGLRLDYVWCDSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCLNHGTSCSRSGSPRWDGQSGSPHWDGKQSPRDG 915          
BLAST of Granulin precursor vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 87.4261 bits (215), Expect = 1.899e-19
Identity = 59/160 (36.88%), Postives = 83/160 (51.88%), Query Frame = 1
Query:  142 CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNV-ELPN 618
            CP  + +C D  TCC     S+ CC    A CC D+ HCCP G++CD    +CV    ++  + K  PA K +           V+    V+CP+ KT+C D  TCC      Y CCP  NA+CCSD   CCP+ T CD+   KCL  +++ + + +LP 
Sbjct:  138 CPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKF-PAQKTNR---------AVSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLPG 287          

HSP 2 Score: 76.2554 bits (186), Expect = 1.299e-15
Identity = 51/153 (33.33%), Postives = 67/153 (43.79%), Query Frame = 1
Query:  139 ICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            +CP+ +T+C D  TCC+     Y CC   NA+CC D  HCCP+ + CD  Q KC+    +   + KL         P   + E K +   EV CP   T C+            + CCP   AVCC D   CCP G  C  +   C      V
Sbjct:  219 VCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKL---------PGYPVKEVKCDM--EVSCPEGYTCCRLNT-------GAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQV 353          

HSP 3 Score: 69.707 bits (169), Expect = 2.324e-13
Identity = 45/158 (28.48%), Postives = 70/158 (44.30%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILE---AKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      ++  + P + +   PK   +E        +++  C ++                 + CCP+   VCC D   CCP G  C  +  KCL+      ++ L
Sbjct:  456 DQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEK------DVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSA--------------GVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFL 593          

HSP 4 Score: 67.0106 bits (162), Expect = 1.608e-12
Identity = 53/182 (29.12%), Postives = 81/182 (44.51%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL--IPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGN 639
            + L + + + +D  C +  T+C    TCC+     + CC    AVCC D  HCCP+G TC A+ +    C K +  +  L  IPA +        +    +  +    CP  +T C   K        ++ CC   +AVCC D+  CCP G TC++K + C K    +    L     + GN
Sbjct:  363 LRLPDPQILKSDTPC-DDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGY----CQKGDTMVAGLEKIPARQT-----TPLQIGDIGCDQHTSCPVGQTCCPSLK-------GSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGN 527          

HSP 5 Score: 59.3066 bits (142), Expect = 6.380e-10
Identity = 50/161 (31.06%), Postives = 68/161 (42.24%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCC-------PDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            +    C +  TCC+    ++ CC +A AVCC       P  F C  E  TC+               M K+I  L++   P   IL++    +D   CP N T CK           ++ CCP   AVCCSD   CCP+G TC +    C K    V  +E
Sbjct:  296 DMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMG-------ILQVPWMKKVIAPLRL---PDPQILKSDTPCDDFTRCPTNNTCCKLNS-------GDWGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQKGDTMVAGLE 438          

HSP 6 Score: 57.3806 bits (137), Expect = 2.794e-9
Identity = 45/164 (27.44%), Postives = 73/164 (44.51%), Query Frame = 1
Query:  103 LLENQKNVTTDNICPNKRTK--CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            LL+    +T+ ++  + +T   C    +C  T   +  CC ++  V C D +HCCP+G  C A    C                 ++ D P              V CP ++ +C D+ TCCI    ++ CCP   A CC D+  CCP G +CD+ + +C+  +
Sbjct:   58 LLDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC----------------FQMSDNPLG-----------AVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPT 194          
BLAST of Granulin precursor vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 69.707 bits (169), Expect = 6.645e-14
Identity = 45/158 (28.48%), Postives = 70/158 (44.30%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILE---AKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      ++  + P + +   PK   +E        +++  C ++                 + CCP+   VCC D   CCP G  C  +  KCL+      ++ L
Sbjct:  101 DQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEK------DVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSA--------------GVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFL 238          
BLAST of Granulin precursor vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 64.3142 bits (155), Expect = 1.075e-11
Identity = 50/163 (30.67%), Postives = 72/163 (44.17%), Query Frame = 1
Query:  157 TKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL--IPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGN 639
            T+C    TCC+     + CC    AVCC D  HCCP+G TC A+ +    C K +  +  L  IPA +        +    +  +    CP  +T C   K        ++ CC   +AVCC D+  CCP G TC++K + C K    +    L     + GN
Sbjct:    3 TRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGY----CQKGDTMVAGLEKIPARQT-----TPLQIGDIGCDQHTSCPVGQTCCPSLK-------GSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGN 149          

HSP 2 Score: 50.8322 bits (120), Expect = 3.342e-7
Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVK 306
            ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K
Sbjct:   78 DQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEK 130          
BLAST of Granulin precursor vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 59.3066 bits (142), Expect = 2.392e-10
Identity = 45/162 (27.78%), Postives = 72/162 (44.44%), Query Frame = 1
Query:  103 LLENQKNVTTDNICPNKRTK--CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLK 582
            LL+    +T+ ++  + +T   C    +C  T   +  CC ++  V C D +HCCP+G  C A    C                 ++ D P              V CP ++ +C D+ TCCI    ++ CCP   A CC D+  CCP G +CD+ + +C+ 
Sbjct:   45 LLDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC----------------FQMSDNPLG-----------AVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVS 179          

HSP 2 Score: 53.9138 bits (128), Expect = 1.784e-8
Identity = 27/73 (36.99%), Postives = 38/73 (52.05%), Query Frame = 1
Query:  142 CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVD 360
            CP  + +C D  TCC     S+ CC    A CC D+ HCCP G++CD    +CV    ++  + K  PA K +
Sbjct:  125 CPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKF-PAQKTN 196          
BLAST of Granulin precursor vs. UniProt/SwissProt
Match: sp|P28799|GRN_HUMAN (Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 1.070e-19
Identity = 59/191 (30.89%), Postives = 83/191 (43.46%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKN-----VTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            L+    I   G       L  Q+      +++  +CP+ R++C D  TCC+     Y CC   NA CC D  HCCP+ + CD  Q KC+    +  ++   +PA  V D          V  + EV CP+  T C+            + CCP   AVCC D   CCP G TCD +   C +    V  +E
Sbjct:  173 LVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD----------VKCDMEVSCPDGYTCCRLQS-------GAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWME 346          

HSP 2 Score: 87.0409 bits (214), Expect = 1.660e-18
Identity = 61/188 (32.45%), Postives = 85/188 (45.21%), Query Frame = 1
Query:   76 ADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGN 639
            ADG   F     +  N      CP+ + +C D  TCC     S+ CC    A CC D+ HCCP G+ CD    +C+        + K +PA + +           V  +  VMCP+ +++C D  TCC      Y CCP  NA CCSD   CCP+ T CD+   KCL    +  ++     A   G+
Sbjct:  107 ADGRSCFQ---RSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCIT-PTGTHPLAKKLPAQRTNR---------AVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD 281          

HSP 3 Score: 78.5666 bits (192), Expect = 1.243e-15
Identity = 48/164 (29.27%), Postives = 74/164 (45.12%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE-----NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDA 624
            ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      E+    PA  +   P   + + +  E     +++  C +N                 + CCP++  VCC+D+  CCP G  C  +  KCL+      +  L + A
Sbjct:  445 DQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEK------EVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDN--------------RQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPA 588          

HSP 4 Score: 77.0258 bits (188), Expect = 4.436e-15
Identity = 55/171 (32.16%), Postives = 80/171 (46.78%), Query Frame = 1
Query:   97 DVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            D+L +   +   D  C +    C D  TCC+ +  ++ CC +  AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V  ++   CP++ T C+ T          + CCP   AVCCSD   CCP+G TC +   +C + S  V  +E
Sbjct:  269 DLLTKLPAHTVGDVKC-DMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSL---PDPQALKRDVPCDNVSSCPSSDTCCQLTS-------GEWGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQCQRGSEIVAGLE 427          

HSP 5 Score: 66.6254 bits (161), Expect = 1.776e-11
Identity = 51/179 (28.49%), Postives = 78/179 (43.58%), Query Frame = 1
Query:  115 QKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL--IPALKVD-DEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGNK 642
            +++V  DN+     + C    TCCQ     + CC    AVCC D  HCCP+G TC A+     +C + +  +  L  +PA +     P++      +  +    CP  +T C            ++ CC   +AVCC D+  CCP G TC++K + C K   S         +   G K
Sbjct:  361 KRDVPCDNV-----SSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEG----QCQRGSEIVAGLEKMPARRASLSHPRD------IGCDQHTSCPVGQTCCPSLG-------GSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVK 517          

HSP 6 Score: 53.9138 bits (128), Expect = 2.743e-7
Identity = 41/142 (28.87%), Postives = 61/142 (42.96%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            C+   +C  T   +  CC +  AV C D  HCCP G  C A    C +                      NN + A       + CP+++ +C D  TCC+    ++ CCP   A CC D+  CCP G  CD+ + +C+  +
Sbjct:   67 CSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQ-------------------RSGNNSVGA-------IQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPT 182          
BLAST of Granulin precursor vs. UniProt/SwissProt
Match: sp|P28797|GRN_CAVPO (Progranulin OS=Cavia porcellus OX=10141 GN=GRN PE=1 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 2.917e-19
Identity = 61/174 (35.06%), Postives = 88/174 (50.57%), Query Frame = 1
Query:  142 CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK-----VDDEP--KNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKS-----------SFSVNNVE 609
            CP    +C D  TCC     S+ CC    A CC D+ HCCP G++CD    +CV    S+    KL PA +      +  P     +L A +  +  V+CP+++++C D  TCC+     Y CCP  NA+CCSD   CCP+ T CD++  +CL             S++V +VE
Sbjct:  126 CPGGEFECPDSSTCCHMLDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGSHPLTTKL-PAQRTNYTGAEGTPVVSPGLLPAALPTS--VICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCLSQNKAKTLLTKLPSWTVWDVE 296          

HSP 2 Score: 88.1965 bits (217), Expect = 7.508e-19
Identity = 55/162 (33.95%), Postives = 75/162 (46.30%), Query Frame = 1
Query:  124 VTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            + T  ICP+ R++C D  TCC      Y CC   NA+CC D  HCCP+ + CD +Q +C+   K+   + KL P+  V D          V  + EV CP  +T C+            + CCP   AVCC D   CCPEG  C  +   C +    V   +
Sbjct:  216 LPTSVICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCLSQNKAKTLLTKL-PSWTVWD----------VECDQEVSCPEGQTCCRLQS-------GKWGCCPFPKAVCCEDHVHCCPEGFRCHTEKDTCEQGLLQVPWAQ 359          

HSP 3 Score: 68.9366 bits (167), Expect = 2.924e-12
Identity = 49/170 (28.82%), Postives = 70/170 (41.18%), Query Frame = 1
Query:  127 TTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE----NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDA 624
            TTD  C ++   C   QTCC      + CC+  +AVCC D  HCCP G TC+ K   C K A    +   L   L V       +++    +    +DE  C  +                 + CCP    VCC D+  CCP G  C+ +  +C+     ++   LP  A
Sbjct:  450 TTDVGC-DQHASCPVGQTCCPKLGGGWACCQLPHAVCCEDGQHCCPAGYTCNVKARSCEKAA----DGAHLAAPLAVGS--TGGVMDVACGDRHFCHDEQTCCRDS-------------RGGWACCPFHQGVCCKDQRHCCPAGFHCESQGTRCVHKKSLLHWDSLPRPA 599          

HSP 4 Score: 55.8398 bits (133), Expect = 6.895e-8
Identity = 38/144 (26.39%), Postives = 58/144 (40.28%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFS 594
            C    +C  T   +  CC ++ A+ C D  HCCP G  C      C++                    P  ++L A      E  CP++ T C            ++ CCP   A CC D+  CCP G +CD+ + +C+ +  S
Sbjct:   67 CPIGHSCVLTAAGTAACCPFSQAMACGDGHHCCPYGFHCSTDGGTCIQ-------------------RPDIHLLGAVQCPGGEFECPDSSTCCHMLD-------GSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGS 184          
BLAST of Granulin precursor vs. UniProt/SwissProt
Match: sp|P28798|GRN_MOUSE (Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 1.368e-18
Identity = 59/160 (36.88%), Postives = 83/160 (51.88%), Query Frame = 1
Query:  142 CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNV-ELPN 618
            CP  + +C D  TCC     S+ CC    A CC D+ HCCP G++CD    +CV    ++  + K  PA K +           V+    V+CP+ KT+C D  TCC      Y CCP  NA+CCSD   CCP+ T CD+   KCL  +++ + + +LP 
Sbjct:  125 CPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKF-PAQKTNR---------AVSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKLPG 274          

HSP 2 Score: 76.2554 bits (186), Expect = 8.931e-15
Identity = 51/153 (33.33%), Postives = 67/153 (43.79%), Query Frame = 1
Query:  139 ICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            +CP+ +T+C D  TCC+     Y CC   NA+CC D  HCCP+ + CD  Q KC+    +   + KL         P   + E K +   EV CP   T C+            + CCP   AVCC D   CCP G  C  +   C      V
Sbjct:  206 VCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKL---------PGYPVKEVKCDM--EVSCPEGYTCCRLNT-------GAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQV 340          

HSP 3 Score: 69.707 bits (169), Expect = 1.645e-12
Identity = 45/158 (28.48%), Postives = 70/158 (44.30%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILE---AKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      ++  + P + +   PK   +E        +++  C ++                 + CCP+   VCC D   CCP G  C  +  KCL+      ++ L
Sbjct:  443 DQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEK------DVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSA--------------GVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFL 580          

HSP 4 Score: 67.0106 bits (162), Expect = 1.182e-11
Identity = 53/182 (29.12%), Postives = 81/182 (44.51%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL--IPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGN 639
            + L + + + +D  C +  T+C    TCC+     + CC    AVCC D  HCCP+G TC A+ +    C K +  +  L  IPA +        +    +  +    CP  +T C   K        ++ CC   +AVCC D+  CCP G TC++K + C K    +    L     + GN
Sbjct:  350 LRLPDPQILKSDTPC-DDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGY----CQKGDTMVAGLEKIPARQT-----TPLQIGDIGCDQHTSCPVGQTCCPSLK-------GSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGN 514          

HSP 5 Score: 59.3066 bits (142), Expect = 4.602e-9
Identity = 50/161 (31.06%), Postives = 68/161 (42.24%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCC-------PDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            +    C +  TCC+    ++ CC +A AVCC       P  F C  E  TC+               M K+I  L++   P   IL++    +D   CP N T CK           ++ CCP   AVCCSD   CCP+G TC +    C K    V  +E
Sbjct:  283 DMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMG-------ILQVPWMKKVIAPLRL---PDPQILKSDTPCDDFTRCPTNNTCCKLNS-------GDWGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQKGDTMVAGLE 425          

HSP 6 Score: 57.3806 bits (137), Expect = 1.960e-8
Identity = 45/164 (27.44%), Postives = 73/164 (44.51%), Query Frame = 1
Query:  103 LLENQKNVTTDNICPNKRTK--CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            LL+    +T+ ++  + +T   C    +C  T   +  CC ++  V C D +HCCP+G  C A    C                 ++ D P              V CP ++ +C D+ TCCI    ++ CCP   A CC D+  CCP G +CD+ + +C+  +
Sbjct:   45 LLDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC----------------FQMSDNPLG-----------AVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPT 181          
BLAST of Granulin precursor vs. UniProt/SwissProt
Match: sp|P23785|GRN_RAT (Progranulin OS=Rattus norvegicus OX=10116 GN=Grn PE=1 SV=3)

HSP 1 Score: 84.7297 bits (208), Expect = 1.083e-17
Identity = 57/160 (35.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  142 CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNV-ELPN 618
            CP  + +C D  TCC     S+ CC    A CC D+ HCCP G++CD    +C+    ++       P LK     + N   A  +    V+CP+ KT+C D  TCC      Y CCP  NA+CCSD   CCP+ T CD+   KC+   ++ + + +LP 
Sbjct:  125 CPGSQFECPDSATCCIMIDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPTGTH-------PLLKKFPAQRTNRAVASFS----VVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISKDYTTDLMTKLPG 273          

HSP 2 Score: 80.4925 bits (197), Expect = 2.759e-16
Identity = 54/168 (32.14%), Postives = 73/168 (43.45%), Query Frame = 1
Query:   94 FDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            F     N+   +   +CP+ +T+C D  TCC+     Y CC   NA+CC D  HCCP+ + CD  Q KC+    +   M KL P   V++          V  + EV CP+  T C+            + CCP   AVCC D   CCP G  C  +   C      V
Sbjct:  190 FPAQRTNRAVASFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISKDYTTDLMTKL-PGYPVNE----------VKCDLEVSCPDGYTCCRLNT-------GAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQV 339          

HSP 3 Score: 73.559 bits (179), Expect = 8.047e-14
Identity = 50/161 (31.06%), Postives = 73/161 (45.34%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEE 630
            ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      + G + P++ +    K   +E          C +N       ++CC      + CCP+   VCC D   CCP G  C  K  KCL+      ++ L + A  
Sbjct:  442 DQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEK------DAGSVQPSMDLTFGSKVGNVECGAGH----FCHDN-------QSCCKDSQGGWACCPYVKGVCCRDGRHCCPIGFHCSAKGTKCLRKKTPRWDILLRDPAPR 585          

HSP 4 Score: 61.6178 bits (148), Expect = 7.541e-10
Identity = 51/186 (27.42%), Postives = 86/186 (46.24%), Query Frame = 1
Query:   46 LLLIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILE-AKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVN 600
            L + ++ K+ A   +    +L+N  +V  D+      + C    TCC+     + CC    AVCC D  HCCP+G  C  + +    C K +    +++  L+     +  +L+   +  +    CP         +TCC +   ++ CC   +AVCC D+  CCP G TC++K + C K + SV 
Sbjct:  337 LQVPWMKKVTASLSLPDPQILKN--DVPCDDF-----SSCPSNNTCCRLSSGDWGCCPMPEAVCCLDHQHCCPQGFKCMDEGY----CQKGD----RMVAGLEKMPVRQTTLLQHGDIGCDQHTSCPVG-------QTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDAGSVQ 500          

HSP 5 Score: 56.9954 bits (136), Expect = 3.243e-8
Identity = 48/165 (29.09%), Postives = 72/165 (43.64%), Query Frame = 1
Query:  103 LLENQKNVTT---DNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            LL+    +T+   D  C   R  C D  +C  T   +  CC ++  V C D  HCCP G  C A    C                     +  +++L A       V CP ++ +C D+ TCCI    ++ CCP   A CC D+  CCP G +CD+ + +C+  +
Sbjct:   45 LLDTWPIITSRRLDGSC-QIRDHCPDGYSCLLTVSGTSSCCPFSEGVSCDDGQHCCPRGFHCSADGKSC--------------------SQISDSLLGA-------VQCPGSQFECPDSATCCIMIDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPT 181          

HSP 6 Score: 53.1434 bits (126), Expect = 6.492e-7
Identity = 47/161 (29.19%), Postives = 66/161 (40.99%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCC-------PDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            +    C D  TCC+    ++ CC +  AVCC       P  F C  E  TC+               M K+  +L +   P   IL+  V  +D   CP+N T C+ +         ++ CCP   AVCC D   CCP+G  C +    C K    V  +E
Sbjct:  282 DLEVSCPDGYTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELG-------VLQVPWMKKVTASLSL---PDPQILKNDVPCDDFSSCPSNNTCCRLSS-------GDWGCCPMPEAVCCLDHQHCCPQGFKC-MDEGYCQKGDRMVAGLE 424          
BLAST of Granulin precursor vs. UniProt/SwissProt
Match: sp|P80059|PMD1_LOCMI (Pars intercerebralis major peptide D1 OS=Locusta migratoria OX=7004 PE=1 SV=1)

HSP 1 Score: 46.9802 bits (110), Expect = 2.624e-6
Identity = 20/48 (41.67%), Postives = 25/48 (52.08%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVK 306
            C   +TCC T      CC Y   VCC D  HCCP G+ CD    +C++
Sbjct:    7 CPGTETCCTTPQGEEGCCPYKEGVCCLDGIHCCPSGTVCDEDHRRCIQ 54          
BLAST of Granulin precursor vs. TrEMBL
Match: A0A2U9CNI5 (Putative granulins-like OS=Scophthalmus maximus OX=52904 GN=SMAX5B_020588 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 5.256e-25
Identity = 68/178 (38.20%), Postives = 93/178 (52.25%), Query Frame = 1
Query:   43 NLLLIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKC 576
             + L ++ ++ A   +   VL EN K +    +C ++++ C D  TCCQ    S+ CC    AVCC DK HCCPEG+ CD  +  CV  +  +  M K +PA +               EN+ V CP+    C D  TCC   + +Y CCP  NAVCCSD   CCPEGT CD+K+  C
Sbjct:   77 TVSLPWMRRLPAQPALPVAVLGENVKKI----VCADQKSTCDDGSTCCQLLDGSWGCCPLVKAVCCEDKLHCCPEGTKCDTAREMCVSASLESFPMLKKLPAGR--------------RENNPVQCPDKTMTCPDQTTCCQMTNGSYGCCPMPNAVCCSDHMHCCPEGTQCDLKHSTC 236          

HSP 2 Score: 85.1149 bits (209), Expect = 2.814e-15
Identity = 53/145 (36.55%), Postives = 65/145 (44.83%), Query Frame = 1
Query:  142 CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKC 576
            CP+K   C D+ TCCQ  + SY CC   NAVCC D  HCCPEG+ CD K   C    +  +   ++  A               V  ND V C +         TCC      + CCP   AVCC D   CCP GT C++    C
Sbjct:  184 CPDKTMTCPDQTTCCQMTNGSYGCCPMPNAVCCSDHMHCCPEGTQCDLKHSTCALAHRDAIMASRITAA-------ATKSRGGSVPCNDSVSCADG-------STCCKMLDGEWVCCPLPQAVCCDDHEHCCPHGTVCNLAASTC 314          

HSP 3 Score: 82.8037 bits (203), Expect = 1.607e-14
Identity = 65/174 (37.36%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  127 TTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLI--PALKVDDEPKNNILEAKVNEN-DEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNV--ELPNDAEEN 633
            +T  +CP+    C DR TCC+     Y CC   +A CC D  HCC EG+ CD    +CV    S   M +L   PAL V          A + EN  +++C + K+ C D  TCC     ++ CCP   AVCC DK  CCPEGT CD   + C+ +S     +  +LP    EN
Sbjct:   17 STALVCPDG-GMCEDRNTCCKNTVGGYGCCPLPHAECCSDHLHCCYEGTLCDLVHEQCVNKTVSLPWMRRLPAQPALPV----------AVLGENVKKIVCADQKSTCDDGSTCCQLLDGSWGCCPLVKAVCCEDKLHCCPEGTKCDTAREMCVSASLESFPMLKKLPAGRREN 179          

HSP 4 Score: 68.5514 bits (166), Expect = 1.247e-9
Identity = 57/179 (31.84%), Postives = 84/179 (46.93%), Query Frame = 1
Query:   94 FDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNIL--EAKVNENDEVMCPN-NXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPND 621
               L E      TD  C +K + C    TCC+     + CC    AVCC D+ HCCP+G TC+ +      C K N++ G +  ++     P+  ++  E+   E+D+V C +    +C   +TCC T   ++ CCP   A CCSD   CCP G +CD     C     ++ N  L  D
Sbjct:  578 LSALTEPGAMTVTDVKCDDK-SSCASGTTCCKLSTGEWGCCPLVKAVCCADQEHCCPQGYTCNMQTG---TCEKKNLDDGLVQASV-----PQTQVVRPESGHPEDDDVPCDSAGSVRCSGQETCCKTSPTDWACCPSPRATCCSDLKHCCPVGYSCDPTAGGC-----TLENARLTWD 742          

HSP 5 Score: 68.1662 bits (165), Expect = 1.491e-9
Identity = 55/194 (28.35%), Postives = 82/194 (42.27%), Query Frame = 1
Query:   82 GVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPA---------LKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENG 636
            G+++     E    + +D  C +++T C    TCC+     + CC    AVCC D  HCCP G  CD  +  C K     +   + IPA          K + +   ++L ++    D  MC  + +  +DT  C + + + + CCP   AVCC D   CCP G TC      C K    V      +   E G
Sbjct:  397 GLLAPLRWTEKVAALRSDVQC-DEQTSCPGGTTCCKRSSGEWSCCPLPQAVCCDDHEHCCPAGYLCDLAEQTCDKPGGVRLPWLRKIPALLQLHQQQRQKNEPDRAGSVLPSR----DRNMCDAHTSCPRDTTCCFMDQSHRWGCCPLPKAVCCDDGNHCCPAGHTCQPHRSSCSKGPQVVPWFSKLSALTEPG 585          

HSP 6 Score: 67.781 bits (164), Expect = 1.835e-9
Identity = 50/156 (32.05%), Postives = 65/156 (41.67%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELP 615
            +K T C    TCC+T    + CC    AVCC D  HCCP  + C+     C      +   G L P    +   K   L + V  +++  CP   T CK +          + CCP   AVCC D   CCP G  CD+  + C K       V LP
Sbjct:  342 DKSTSCPGNSTCCRTTTGDWACCPLPEAVCCDDHIHCCPHATVCNLDFDTC------DDPSGLLAPLRWTE---KVAALRSDVQCDEQTSCPGGTTCCKRSS-------GEWSCCPLPQAVCCDDHEHCCPAGYLCDLAEQTCDKP----GGVRLP 477          

HSP 7 Score: 60.077 bits (144), Expect = 8.716e-7
Identity = 49/159 (30.82%), Postives = 71/159 (44.65%), Query Frame = 1
Query:  136 NICPNKRTKCTDRQTCC-QTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            N+C +  T C    TCC   + + + CC    AVCC D  HCCP G TC   +  C K      ++      L    EP   +    V  +D+  C +  T CK +          + CCP   AVCC+D+  CCP+G TC+++   C K +     V+
Sbjct:  511 NMC-DAHTSCPRDTTCCFMDQSHRWGCCPLPKAVCCDDGNHCCPAGHTCQPHRSSCSK----GPQVVPWFSKLSALTEP-GAMTVTDVKCDDKSSCASGTTCCKLST-------GEWGCCPLVKAVCCADQEHCCPQGYTCNMQTGTCEKKNLDDGLVQ 656          
BLAST of Granulin precursor vs. TrEMBL
Match: A0A5N5Q463 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00004620 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 8.503e-25
Identity = 65/174 (37.36%), Postives = 97/174 (55.75%), Query Frame = 1
Query:  103 LLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVN--ENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKC-LKSSFSVNNVELP 615
            ++  Q  +    +CP++ ++C D  TCCQ    ++ CC   NAVCC DK HCCP G+TCD    +CV     +  + +  PA+ V  +    + E  V   ++++V+CP+  + C D  TCCI  + +Y CCP  NAVCC D   CCPEGTTCD+++  C L +  +    E P
Sbjct:  570 VVAKQTTLPQAVVCPDQESECPDDTTCCQMPDGTWGCCPMPNAVCCEDKRHCCPAGTTCDLPHSRCVSSTLGSTPLLRKFPAIHVGGKRDAVVKEISVKFPDSNDVVCPDKVSTCPDDTTCCILANGSYGCCPLPNAVCCDDYVHCCPEGTTCDLEHSTCVLANELTTMTAEAP 743          

HSP 2 Score: 87.8113 bits (216), Expect = 3.311e-16
Identity = 59/168 (35.12%), Postives = 79/168 (47.02%), Query Frame = 1
Query:  139 ICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGNK 642
            ICP+    C D  TCCQT    Y CC   NA CC D  HCC EG+ CD +   CV      +E  + + A       +  + +A V  + E  CP++ T C+            + CCP  NAVCC DK  CCP GTTCD+ + +C+ S+     +     A   G K
Sbjct:  505 ICPDG-GMCDDGNTCCQTSGGGYGCCPLPNAECCSDHLHCCHEGTLCDMEHGTCVN-KTHTLEWVRRVVA------KQTTLPQAVVCPDQESECPDDTTCCQMPD-------GTWGCCPMPNAVCCEDKRHCCPAGTTCDLPHSRCVSSTLGSTPLLRKFPAIHVGGK 657          

HSP 3 Score: 87.4261 bits (215), Expect = 3.748e-16
Identity = 57/151 (37.75%), Postives = 71/151 (47.02%), Query Frame = 1
Query:  133 DNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE---NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKC 576
            D +CP+K + C D  TCC   + SY CC   NAVCC D  HCCPEG+TCD +   CV   +      +  P L         +L+  V+    ND V C    T CK          + + CCP   AVCC D   CCP GT CD+    C
Sbjct:  674 DVVCPDKVSTCPDDTTCCILANGSYGCCPLPNAVCCDDYVHCCPEGTTCDLEHSTCVLANELTTMTAEAPPIL---------LLKPTVDSVPCNDTVACATGFTCCKKQD-------SEWGCCPLPEAVCCEDHIHCCPHGTVCDLSEGTC 808          

HSP 4 Score: 81.6481 bits (200), Expect = 4.768e-14
Identity = 55/144 (38.19%), Postives = 74/144 (51.39%), Query Frame = 1
Query:  157 TKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            T C    TCC+ +   + CC    AVCC D  HCCP+G TCD +   C+K + ++     L+  L   DE             DEVMC +   +C  ++TCC    N + CCP + AVCC D   CCP+G TCD   K+C K+S
Sbjct: 1071 TSCAAGTTCCRLRTGKWGCCPLVKAVCCEDHEHCCPQGYTCDLQSGTCIKPSTTHTLALTLVHTLSEQDE-------------DEVMC-DATRRCPKSQTCCRIPDNEWACCPFEQAVCCKDMKHCCPKGYTCD-PEKRCTKAS 1199          

HSP 5 Score: 72.0182 bits (175), Expect = 7.068e-11
Identity = 50/159 (31.45%), Postives = 72/159 (45.28%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDD----EPKNNILEAKVNEND-EVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            ++ + C    TCC+ K  ++ CC+   AVCC D  HCCP+G  CD     C   +  ++   +  PAL V      +P  N+     ++ D +  CP   T C   K       + + CCP   AVCC D   CCP G TCD +   C K +  +   E
Sbjct:  894 DETSACPTGTTCCKEKSGTWACCQLPRAVCCEDHEHCCPQGYKCDVAHKSCEHPSLPSMPWVRKQPALSVTHSSYADPSANMESQHGHKCDAQTTCPRGNTCCYMAKL------SKWGCCPLPQAVCCGDGDHCCPSGYTCDKEKPVCTKGNLQIAWFE 1046          

HSP 6 Score: 68.9366 bits (167), Expect = 8.632e-10
Identity = 52/149 (34.90%), Postives = 74/149 (49.66%), Query Frame = 1
Query:  148 NKRTKCTDRQTCC-QTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNEN-DEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            + +T C    TCC   K + + CC    AVCC D  HCCP G TCD ++  C    K N+++         + +P      ++V     +V C +N T C    TCC  +   + CCP   AVCC D   CCP+G TCD+++  C+K S
Sbjct:  984 DAQTTCPRGNTCCYMAKLSKWGCCPLPQAVCCGDGDHCCPSGYTCDKEKPVCT---KGNLQIAWF------EKQPAMIAQGSEVTRGLGDVKC-DNTTSCAAGTTCCRLRTGKWGCCPLVKAVCCEDHEHCCPQGYTCDLQSGTCIKPS 1122          
BLAST of Granulin precursor vs. TrEMBL
Match: A0A3P8XNX3 (Granulin b OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 9.721e-25
Identity = 71/195 (36.41%), Postives = 98/195 (50.26%), Query Frame = 1
Query:   34 LGFNLLLIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCL-KSSFSVNNVELP 615
            L  ++ L +V ++ +    S  ++LE  K V    +CP+   +C D  TCCQ    S+ CC  A AVCC DK HCCPEG+TCD    KCV        M K +P+ K         + +   +    +CP+         TCC      Y CCP+  AVCCSDK  CCPEGTTCD++   CL ++  +   V+ P
Sbjct:   77 LNRSVSLPWVSRVPSK-QPSVPLILEGVKAV----VCPDGEAECPDGTTCCQLPEGSWGCCPLAKAVCCQDKRHCCPEGTTCDLVHSKCVSPTLGTFPMSKKVPSRKKQTAVGGQTVTSPGGKG---VCPDG-------FTCCQQPSGEYGCCPYLEAVCCSDKLHCCPEGTTCDLEESTCLSQNGLTSMAVKFP 256          

HSP 2 Score: 92.4337 bits (228), Expect = 7.802e-18
Identity = 65/186 (34.95%), Postives = 92/186 (49.46%), Query Frame = 1
Query:   40 FNLLLIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
             N +L   V     G +   VL      +T+  ICP+ R  C +  TCCQT    Y CC   NA CC D  HCC EG+ CD    +C+  + S   + + +P+     +P   ++   V     V+CP+ + +C D  TCC     ++ CCP   AVCC DK  CCPEGTTCD+ + KC+  +   
Sbjct:    1 MNTMLTLWV-----GAVCLAVL-----GLTSALICPDGRM-CEEGNTCCQTSSGEYGCCPLPNAECCSDHLHCCYEGTVCDLALARCLNRSVSLPWVSR-VPS----KQPSVPLILEGVK---AVVCPDGEAECPDGTTCCQLPEGSWGCCPLAKAVCCQDKRHCCPEGTTCDLVHSKCVSPTLGT 167          

HSP 3 Score: 76.6406 bits (187), Expect = 1.855e-12
Identity = 57/175 (32.57%), Postives = 77/175 (44.00%), Query Frame = 1
Query:  118 KNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPAL--KVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENG 636
             + + DN C ++ T C    TCC+T    + CC   NAVCC D  HCCP G+ C+ K   C   A S+V     +P L   +     +++  AK   +    CP +      T  C + K   + CCP   AVCCSD   CCP G  CD     C K   +V      +   E G
Sbjct:  344 SHASKDNRC-DESTSCPGEYTCCKTATGKWACCPLPNAVCCDDLIHCCPHGTVCNLKASTCDDPAGSSVPWVPKLPGLHPGLTQASASSVPPAKNMCDPHTSCPKD------TTCCFMNKSGKWGCCPLPKAVCCSDGDHCCPSGYICDDHKGTCTKGLATVPWYPKESALTEEG 511          

HSP 4 Score: 65.855 bits (159), Expect = 8.681e-9
Identity = 44/143 (30.77%), Postives = 57/143 (39.86%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKC 576
            N    C D  TCC+     + CC    AVCC D  HCCP  + C+  +  C   +  +     L  A       K+N  +   +   E  C             C T    + CCP  NAVCC D   CCP GT C++K   C
Sbjct:  274 NGSVACADGTTCCKLVDGQWACCPLPKAVCCDDHLHCCPHDTVCNLAEGTCDDPSSGSALATLLDKAPAFSHASKDNRCDESTSCPGEYTC-------------CKTATGKWACCPLPNAVCCDDLIHCCPHGTVCNLKASTC 403          
BLAST of Granulin precursor vs. TrEMBL
Match: W5LK03 (Granulin b OS=Astyanax mexicanus OX=7994 PE=4 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 2.300e-24
Identity = 65/172 (37.79%), Postives = 98/172 (56.98%), Query Frame = 1
Query:   79 DGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK-VDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSF 591
            D VM   +    Q ++    +CP++ ++C D  TCCQ    S+ CC   NAVCC DK HCCP+G+TCD    KCV     +V + +  PA K  + + + +     + ++++V CP+  + C D  TCC   + +Y CCP   AVCCSD   CCP+GT+CD+ + KC+ S+ 
Sbjct:   79 DWVMRVPI---RQPSLPQAVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNV 247          

HSP 2 Score: 88.1965 bits (217), Expect = 2.204e-16
Identity = 58/152 (38.16%), Postives = 77/152 (50.66%), Query Frame = 1
Query:  139 ICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFS 594
            ICP+    C D  TCCQT    Y CC   NA CC D  HCC EG+ CD +  KCV      ++    +P        + ++ +A V  + E  CP++        TCC     ++ CCP  NAVCC DK  CCP+GTTCD+ + KC+ S   
Sbjct:   19 ICPDGGM-CDDGNTCCQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVN-KTHTLDWVMRVPIR------QPSLPQAVVCPDQESECPDD-------TTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLG 155          

HSP 3 Score: 77.7962 bits (190), Expect = 7.455e-13
Identity = 54/141 (38.30%), Postives = 68/141 (48.23%), Query Frame = 1
Query:  133 DNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTC 555
            D  CP+K + C D  TCC   + SY CC    AVCC D  HCCP+G++CD    KCV           L P ++V       +    V  N+ V C +         TCC TK  ++ CCP   AVCC D   CCP+GT C
Sbjct:  187 DVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNLSPVVRV------KVTVESVPCNESVACESG-------STCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVC 314          

HSP 4 Score: 72.0182 bits (175), Expect = 7.042e-11
Identity = 60/170 (35.29%), Postives = 76/170 (44.71%), Query Frame = 1
Query:  148 NKRTKCTDRQTCC-QTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL-IPALKVDDEPKNNILEAKVNENDEVM-------------CPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            + +T C    TCC   K N + CC    AVCC D  HCCP   TCD  ++ C+K        G L IP  K          EAKV +  EV              CP   T C+ T          + CCPH  AVCC D   CCP G TCD++   CL++S +++ V L
Sbjct:  528 DAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLK--------GHLEIPWFKKQ--------EAKVTQGSEVAHGVADVQCDSTARCPTGSTCCRLTT-------GQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTS-TLHTVAL 673          

HSP 5 Score: 70.4774 bits (171), Expect = 2.407e-10
Identity = 53/165 (32.12%), Postives = 76/165 (46.06%), Query Frame = 1
Query:  124 VTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE--NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            VT +++  N+   C    TCC+TK   + CC    AVCC D  HCCP+G+ C   +  CV    ++ ++  L+    V+ +P  N +    NE  +    CP   T CK            + CCP   AVCC D   CCP  T C++    C  S+FS    +L
Sbjct:  263 VTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVC--ARSTCV----ASADLLTLV--RWVEKKPTINRVPQPANEKCDPTTTCPKGATCCKMES-------GTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTC-DSAFSGTAGQL 411          

HSP 6 Score: 68.9366 bits (167), Expect = 7.908e-10
Identity = 46/147 (31.29%), Postives = 69/147 (46.94%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            +   +C    TCC+     + CC +  AVCC D  HCCP G TCD +   C++ +  +     L+                  +  ++VMC +  + C +++TCC      + CCP K AVCC D   CCP G  CD K K C +++
Sbjct:  612 DSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTSTLHTVALTLV----------------HTHTKEQVMC-DATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCARAT 741          

HSP 7 Score: 67.0106 bits (162), Expect = 3.713e-9
Identity = 50/161 (31.06%), Postives = 69/161 (42.86%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKN----NILEAKVNE-------NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            ++ + C    TCC+ K  ++ CC    AVCC D  HCCP+G  CD     C      ++   K  PAL+   +  N     I E+ V +       + +  CP +         C + K N + CCP   AVCC D   CCP   TCD     CLK    +
Sbjct:  432 DETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRD------NTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEI 586          
BLAST of Granulin precursor vs. TrEMBL
Match: A0A3P8XNU6 (Granulin b OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 5.426e-24
Identity = 72/189 (38.10%), Postives = 97/189 (51.32%), Query Frame = 1
Query:   64 VKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVM----CPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCL-KSSFSVNNVELP 615
            V+++ + V+    +LE  K V    +CP+   +C D  TCCQ    S+ CC  A AVCC DK HCCPEG+TCD    KCV             P L      K N   +  N    +     CP+  + C +  TCC+ +  +Y CCP  NAVCCSDK  CCPEGTTCD++   CL ++  +   V+ P
Sbjct:   49 VRLWPE-VIQLLGILEGVKAV----VCPDGEAECPDGTTCCQLPEGSWGCCPLAKAVCCQDKRHCCPEGTTCDLVHSKCVS------------PTLGTFPMSKKNTFNSGSNLYSLLFSVLECPDKLSSCPEDSTCCVLEDGSYGCCPMPNAVCCSDKLHCCPEGTTCDLEESTCLSQNGLTSMAVKFP 220          

HSP 2 Score: 68.1662 bits (165), Expect = 1.205e-9
Identity = 60/206 (29.13%), Postives = 84/206 (40.78%), Query Frame = 1
Query:  118 KNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYAN--------------------AVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPAL--KVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFS--VNNVELPNDAEENGNK*YIEYLL 663
             + + DN C ++ T C    TCC+T    + CC   N                    AVCC D  HCCP G+ C+ K   C   A S+V     +P L   +     +++  AK   +    CP + T C   K+        + CCP   AVCCSD   CCP G  CD     C K+ F   V ++ L   A +     ++ Y L
Sbjct:  308 SHASKDNRC-DESTSCPGEYTCCKTATGKWACCPLPNVNAFPHFLCPVGQCRRQTPDAVCCDDLIHCCPHGTVCNLKASTCDDPAGSSVPWVPKLPGLHPGLTQASASSVPPAKNMCDPHTSCPKDTTCCFMNKS------GKWGCCPLPKAVCCSDGDHCCPSGYICDDHKGTCTKAPFWELVEHLWLLQTARD-----FLGYFL 501          

HSP 3 Score: 58.5362 bits (140), Expect = 2.807e-6
Identity = 48/173 (27.75%), Postives = 67/173 (38.73%), Query Frame = 1
Query:  121 NVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGN 639
             +T+  ICP+ R  C +  TCCQT    Y CC                                         +P + V   P+   L   +     V+CP+ + +C D  TCC     ++ CCP   AVCC DK  CCPEGTTCD+ + KC+  +     +   N      N
Sbjct:   12 GLTSALICPDGR-MCEEGNTCCQTSSGEYGCCP----------------------------------------LPNVSVRLWPEVIQLLGILEGVKAVVCPDGEAECPDGTTCCQLPEGSWGCCPLAKAVCCQDKRHCCPEGTTCDLVHSKCVSPTLGTFPMSKKNTFNSGSN 143          

HSP 4 Score: 57.7658 bits (138), Expect = 4.438e-6
Identity = 41/150 (27.33%), Postives = 56/150 (37.33%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCP-------HKNAVCCSDKYQCCPEGTTCDIKNKKC 576
            N    C D  TCC+     + CC    AVCC D  HCCP  + C+  +  C   +  +     L  A       K+N  +   +   E  C    T               ++ CP         +AVCC D   CCP GT C++K   C
Sbjct:  238 NGSVACADGTTCCKLVDGQWACCPLPKAVCCDDHLHCCPHDTVCNLAEGTCDDPSSGSALATLLDKAPAFSHASKDNRCDESTSCPGEYTCCKTATGKWACCPLPNVNAFPHFLCPVGQCRRQTPDAVCCDDLIHCCPHGTVCNLKASTC 387          
BLAST of Granulin precursor vs. Ensembl Cavefish
Match: grnb (granulins-like [Source:NCBI gene;Acc:103046308])

HSP 1 Score: 111.309 bits (277), Expect = 8.712e-28
Identity = 65/172 (37.79%), Postives = 98/172 (56.98%), Query Frame = 1
Query:   79 DGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK-VDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSF 591
            D VM   +    Q ++    +CP++ ++C D  TCCQ    S+ CC   NAVCC DK HCCP+G+TCD    KCV     +V + +  PA K  + + + +     + ++++V CP+  + C D  TCC   + +Y CCP   AVCCSD   CCP+GT+CD+ + KC+ S+ 
Sbjct:   79 DWVMRVPI---RQPSLPQAVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNV 247          

HSP 2 Score: 88.1965 bits (217), Expect = 8.348e-20
Identity = 58/152 (38.16%), Postives = 77/152 (50.66%), Query Frame = 1
Query:  139 ICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFS 594
            ICP+    C D  TCCQT    Y CC   NA CC D  HCC EG+ CD +  KCV      ++    +P        + ++ +A V  + E  CP++        TCC     ++ CCP  NAVCC DK  CCP+GTTCD+ + KC+ S   
Sbjct:   19 ICPDGGM-CDDGNTCCQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVN-KTHTLDWVMRVPIR------QPSLPQAVVCPDQESECPDD-------TTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLG 155          

HSP 3 Score: 77.7962 bits (190), Expect = 2.824e-16
Identity = 54/141 (38.30%), Postives = 68/141 (48.23%), Query Frame = 1
Query:  133 DNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTC 555
            D  CP+K + C D  TCC   + SY CC    AVCC D  HCCP+G++CD    KCV           L P ++V       +    V  N+ V C +         TCC TK  ++ CCP   AVCC D   CCP+GT C
Sbjct:  187 DVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNLSPVVRV------KVTVESVPCNESVACESG-------STCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVC 314          

HSP 4 Score: 72.0182 bits (175), Expect = 2.667e-14
Identity = 60/170 (35.29%), Postives = 76/170 (44.71%), Query Frame = 1
Query:  148 NKRTKCTDRQTCC-QTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL-IPALKVDDEPKNNILEAKVNENDEVM-------------CPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            + +T C    TCC   K N + CC    AVCC D  HCCP   TCD  ++ C+K        G L IP  K          EAKV +  EV              CP   T C+ T          + CCPH  AVCC D   CCP G TCD++   CL++S +++ V L
Sbjct:  528 DAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLK--------GHLEIPWFKKQ--------EAKVTQGSEVAHGVADVQCDSTARCPTGSTCCRLTT-------GQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTS-TLHTVAL 673          

HSP 5 Score: 70.4774 bits (171), Expect = 9.115e-14
Identity = 53/165 (32.12%), Postives = 76/165 (46.06%), Query Frame = 1
Query:  124 VTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE--NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            VT +++  N+   C    TCC+TK   + CC    AVCC D  HCCP+G+ C   +  CV    ++ ++  L+    V+ +P  N +    NE  +    CP   T CK            + CCP   AVCC D   CCP  T C++    C  S+FS    +L
Sbjct:  263 VTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVC--ARSTCV----ASADLLTLV--RWVEKKPTINRVPQPANEKCDPTTTCPKGATCCKMES-------GTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTC-DSAFSGTAGQL 411          

HSP 6 Score: 68.9366 bits (167), Expect = 2.995e-13
Identity = 46/147 (31.29%), Postives = 69/147 (46.94%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            +   +C    TCC+     + CC +  AVCC D  HCCP G TCD +   C++ +  +     L+                  +  ++VMC +  + C +++TCC      + CCP K AVCC D   CCP G  CD K K C +++
Sbjct:  612 DSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTSTLHTVALTLV----------------HTHTKEQVMC-DATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCARAT 741          

HSP 7 Score: 67.0106 bits (162), Expect = 1.406e-12
Identity = 50/161 (31.06%), Postives = 69/161 (42.86%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKN----NILEAKVNE-------NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            ++ + C    TCC+ K  ++ CC    AVCC D  HCCP+G  CD     C      ++   K  PAL+   +  N     I E+ V +       + +  CP +         C + K N + CCP   AVCC D   CCP   TCD     CLK    +
Sbjct:  432 DETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRD------NTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEI 586          

HSP 8 Score: 48.521 bits (114), Expect = 2.101e-6
Identity = 25/69 (36.23%), Postives = 34/69 (49.28%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVK 306
            V L      T + +  +  + CT+ QTCC+     + CC +  AVCC D  HCCP G  CD K   C +
Sbjct:  671 VALTLVHTHTKEQVMCDATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCAR 739          
BLAST of Granulin precursor vs. Ensembl Cavefish
Match: grnb (granulins-like [Source:NCBI gene;Acc:103046308])

HSP 1 Score: 111.309 bits (277), Expect = 8.712e-28
Identity = 65/172 (37.79%), Postives = 98/172 (56.98%), Query Frame = 1
Query:   79 DGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK-VDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSF 591
            D VM   +    Q ++    +CP++ ++C D  TCCQ    S+ CC   NAVCC DK HCCP+G+TCD    KCV     +V + +  PA K  + + + +     + ++++V CP+  + C D  TCC   + +Y CCP   AVCCSD   CCP+GT+CD+ + KC+ S+ 
Sbjct:   79 DWVMRVPI---RQPSLPQAVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNV 247          

HSP 2 Score: 88.1965 bits (217), Expect = 8.348e-20
Identity = 58/152 (38.16%), Postives = 77/152 (50.66%), Query Frame = 1
Query:  139 ICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFS 594
            ICP+    C D  TCCQT    Y CC   NA CC D  HCC EG+ CD +  KCV      ++    +P        + ++ +A V  + E  CP++        TCC     ++ CCP  NAVCC DK  CCP+GTTCD+ + KC+ S   
Sbjct:   19 ICPDGGM-CDDGNTCCQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVN-KTHTLDWVMRVPIR------QPSLPQAVVCPDQESECPDD-------TTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLG 155          

HSP 3 Score: 77.7962 bits (190), Expect = 2.824e-16
Identity = 54/141 (38.30%), Postives = 68/141 (48.23%), Query Frame = 1
Query:  133 DNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTC 555
            D  CP+K + C D  TCC   + SY CC    AVCC D  HCCP+G++CD    KCV           L P ++V       +    V  N+ V C +         TCC TK  ++ CCP   AVCC D   CCP+GT C
Sbjct:  187 DVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNLSPVVRV------KVTVESVPCNESVACESG-------STCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVC 314          

HSP 4 Score: 72.0182 bits (175), Expect = 2.667e-14
Identity = 60/170 (35.29%), Postives = 76/170 (44.71%), Query Frame = 1
Query:  148 NKRTKCTDRQTCC-QTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL-IPALKVDDEPKNNILEAKVNENDEVM-------------CPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            + +T C    TCC   K N + CC    AVCC D  HCCP   TCD  ++ C+K        G L IP  K          EAKV +  EV              CP   T C+ T          + CCPH  AVCC D   CCP G TCD++   CL++S +++ V L
Sbjct:  528 DAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLK--------GHLEIPWFKKQ--------EAKVTQGSEVAHGVADVQCDSTARCPTGSTCCRLTT-------GQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTS-TLHTVAL 673          

HSP 5 Score: 70.4774 bits (171), Expect = 9.115e-14
Identity = 53/165 (32.12%), Postives = 76/165 (46.06%), Query Frame = 1
Query:  124 VTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE--NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            VT +++  N+   C    TCC+TK   + CC    AVCC D  HCCP+G+ C   +  CV    ++ ++  L+    V+ +P  N +    NE  +    CP   T CK            + CCP   AVCC D   CCP  T C++    C  S+FS    +L
Sbjct:  263 VTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVC--ARSTCV----ASADLLTLV--RWVEKKPTINRVPQPANEKCDPTTTCPKGATCCKMES-------GTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTC-DSAFSGTAGQL 411          

HSP 6 Score: 68.9366 bits (167), Expect = 2.995e-13
Identity = 46/147 (31.29%), Postives = 69/147 (46.94%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            +   +C    TCC+     + CC +  AVCC D  HCCP G TCD +   C++ +  +     L+                  +  ++VMC +  + C +++TCC      + CCP K AVCC D   CCP G  CD K K C +++
Sbjct:  612 DSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTSTLHTVALTLV----------------HTHTKEQVMC-DATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCARAT 741          

HSP 7 Score: 67.0106 bits (162), Expect = 1.406e-12
Identity = 50/161 (31.06%), Postives = 69/161 (42.86%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKN----NILEAKVNE-------NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            ++ + C    TCC+ K  ++ CC    AVCC D  HCCP+G  CD     C      ++   K  PAL+   +  N     I E+ V +       + +  CP +         C + K N + CCP   AVCC D   CCP   TCD     CLK    +
Sbjct:  432 DETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRD------NTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEI 586          

HSP 8 Score: 48.521 bits (114), Expect = 2.101e-6
Identity = 25/69 (36.23%), Postives = 34/69 (49.28%), Query Frame = 1
Query:  100 VLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVK 306
            V L      T + +  +  + CT+ QTCC+     + CC +  AVCC D  HCCP G  CD K   C +
Sbjct:  671 VALTLVHTHTKEQVMCDATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCAR 739          
BLAST of Granulin precursor vs. Ensembl Cavefish
Match: ENSAMXT00000030959.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:26782099:26792241:-1 gene:ENSAMXG00000014237.2 transcript:ENSAMXT00000030959.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 3.386e-17
Identity = 60/218 (27.52%), Postives = 98/218 (44.95%), Query Frame = 1
Query:   82 GVMSFDVLLENQKNV-------------TTDNICP----NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKV----------DDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGNK*YIE 654
            G+  +D+ +  QK V              +D+  P    +    C D  TCC+T +  + CC Y    CC D  HCCP G  CD+   +C++ A S +      PA+ +          +++P   ++E   + +  V C ++   C D  TCC T +  + CCP+    CC D   CCP G  CD  + +C++ + S+ +   P  A    NK Y++
Sbjct:   74 GLPWYDIFMPLQKAVEETEEKPSTSVVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALS-IRSSSPQPAMLIQNKQKAVEETEEKPSATLVELSGDSSPMVHC-DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSS-PQPAMLIQNKQYLQ 288          

HSP 2 Score: 79.337 bits (194), Expect = 5.571e-17
Identity = 55/177 (31.07%), Postives = 87/177 (49.15%), Query Frame = 1
Query:   88 MSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK-----VDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNN 603
            M   ++L     V++D  CP+  T C D  TCC T    Y CC   NAVCCP + +CCP+G  CD    +   C K  +    +   L+      +++P  +++E   + +  V C ++   C D  TCC T +  + CCP+    CC D   CCP G  CD  + +C++ + S+ +
Sbjct:    1 MIVVLVLLMAGLVSSDITCPDGHT-CPDNNTCCLTDQG-YACCPAPNAVCCPGQEYCCPQGYKCDPSSPQ--GCVKQGLPWYDIFMPLQKAVEETEEKPSTSVVELSDDSSPMVHC-DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRS 172          

HSP 3 Score: 65.4698 bits (158), Expect = 3.820e-12
Identity = 51/161 (31.68%), Postives = 65/161 (40.37%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCA----KSNVEMGKLI----------PALKVDDEPK--NNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            C D  TCC+T +  + CC Y    CC D  HCCP G  CD+   +C++ A     S+ +   LI          PA  V  EP   N + E  +  N    CP   T C+            + CCP+K   CC D   CC  G  CD     C K    V
Sbjct:  218 CPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSSPQPAMLIQNKQYLQEDQPAPLVPLEPALDNQVQEGVIRCNGRFYCPAEYTCCQAPT-------GEWGCCPYKLGQCCKDGKHCCEFGYNCDSAYSSCKKGYSRV 371          
BLAST of Granulin precursor vs. Ensembl Cavefish
Match: ENSAMXT00000057729.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:26782099:26792241:-1 gene:ENSAMXG00000014237.2 transcript:ENSAMXT00000057729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 3.386e-17
Identity = 60/218 (27.52%), Postives = 98/218 (44.95%), Query Frame = 1
Query:   82 GVMSFDVLLENQKNV-------------TTDNICP----NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKV----------DDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGNK*YIE 654
            G+  +D+ +  QK V              +D+  P    +    C D  TCC+T +  + CC Y    CC D  HCCP G  CD+   +C++ A S +      PA+ +          +++P   ++E   + +  V C ++   C D  TCC T +  + CCP+    CC D   CCP G  CD  + +C++ + S+ +   P  A    NK Y++
Sbjct:   74 GLPWYDIFMPLQKAVEETEEKPSTSVVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALS-IRSSSPQPAMLIQNKQKAVEETEEKPSATLVELSGDSSPMVHC-DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSS-PQPAMLIQNKQYLQ 288          

HSP 2 Score: 79.337 bits (194), Expect = 5.571e-17
Identity = 55/177 (31.07%), Postives = 87/177 (49.15%), Query Frame = 1
Query:   88 MSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK-----VDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNN 603
            M   ++L     V++D  CP+  T C D  TCC T    Y CC   NAVCCP + +CCP+G  CD    +   C K  +    +   L+      +++P  +++E   + +  V C ++   C D  TCC T +  + CCP+    CC D   CCP G  CD  + +C++ + S+ +
Sbjct:    1 MIVVLVLLMAGLVSSDITCPDGHT-CPDNNTCCLTDQG-YACCPAPNAVCCPGQEYCCPQGYKCDPSSPQ--GCVKQGLPWYDIFMPLQKAVEETEEKPSTSVVELSDDSSPMVHC-DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRS 172          

HSP 3 Score: 65.4698 bits (158), Expect = 3.820e-12
Identity = 51/161 (31.68%), Postives = 65/161 (40.37%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCA----KSNVEMGKLI----------PALKVDDEPK--NNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            C D  TCC+T +  + CC Y    CC D  HCCP G  CD+   +C++ A     S+ +   LI          PA  V  EP   N + E  +  N    CP   T C+            + CCP+K   CC D   CC  G  CD     C K    V
Sbjct:  218 CPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSSPQPAMLIQNKQYLQEDQPAPLVPLEPALDNQVQEGVIRCNGRFYCPAEYTCCQAPT-------GEWGCCPYKLGQCCKDGKHCCEFGYNCDSAYSSCKKGYSRV 371          
BLAST of Granulin precursor vs. Ensembl Cavefish
Match: ENSAMXT00000034465.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:26782099:26792241:-1 gene:ENSAMXG00000014237.2 transcript:ENSAMXT00000034465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 4.719e-17
Identity = 60/218 (27.52%), Postives = 98/218 (44.95%), Query Frame = 1
Query:   82 GVMSFDVLLENQKNV-------------TTDNICP----NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKV----------DDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGNK*YIE 654
            G+  +D+ +  QK V              +D+  P    +    C D  TCC+T +  + CC Y    CC D  HCCP G  CD+   +C++ A S +      PA+ +          +++P   ++E   + +  V C ++   C D  TCC T +  + CCP+    CC D   CCP G  CD  + +C++ + S+ +   P  A    NK Y++
Sbjct:   74 GLPWYDIFMPLQKAVEETEEKPSTSVVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALS-IRSSSPQPAMLIQNKQKAVEETEEKPSATVVELSDDSSPMVHC-DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSS-PQPAMLIQNKQYLQ 288          

HSP 2 Score: 79.337 bits (194), Expect = 5.736e-17
Identity = 55/177 (31.07%), Postives = 87/177 (49.15%), Query Frame = 1
Query:   88 MSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK-----VDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNN 603
            M   ++L     V++D  CP+  T C D  TCC T    Y CC   NAVCCP + +CCP+G  CD    +   C K  +    +   L+      +++P  +++E   + +  V C ++   C D  TCC T +  + CCP+    CC D   CCP G  CD  + +C++ + S+ +
Sbjct:    1 MIVVLVLLMAGLVSSDITCPDGHT-CPDNNTCCLTDQG-YACCPAPNAVCCPGQEYCCPQGYKCDPSSPQ--GCVKQGLPWYDIFMPLQKAVEETEEKPSTSVVELSDDSSPMVHC-DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRS 172          

HSP 3 Score: 65.4698 bits (158), Expect = 4.082e-12
Identity = 51/161 (31.68%), Postives = 65/161 (40.37%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCA----KSNVEMGKLI----------PALKVDDEPK--NNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            C D  TCC+T +  + CC Y    CC D  HCCP G  CD+   +C++ A     S+ +   LI          PA  V  EP   N + E  +  N    CP   T C+            + CCP+K   CC D   CC  G  CD     C K    V
Sbjct:  218 CPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSSPQPAMLIQNKQYLQEDQPAPLVPLEPALDNQVQEGVIRCNGRFYCPAEYTCCQAPT-------GEWGCCPYKLGQCCKDGKHCCEFGYNCDSAYSSCKKGYSRV 371          
BLAST of Granulin precursor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009302.1 (pep scaffold:Pmarinus_7.0:GL483232:1183:11161:1 gene:ENSPMAG00000008413.1 transcript:ENSPMAT00000009302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 1.449e-19
Identity = 53/150 (35.33%), Postives = 76/150 (50.67%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            + ++ C D  TCC+T    + CC    AVCC D  HCCP+G+TC+     C +    ++      PAL+V  EP   I +      D+  CP+         TCC     ++ CCP   AVCC D   CCPEGTTC++  ++C K + S+
Sbjct:  293 DDQSSCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQ-GTLSLPWSTKTPALRVAGEPNVVICD------DQSSCPDG-------NTCCKMPSGDWGCCPLPKAVCCDDHQHCCPEGTTCNLPVERCDKGTLSL 428          

HSP 2 Score: 84.7297 bits (208), Expect = 2.268e-19
Identity = 55/150 (36.67%), Postives = 74/150 (49.33%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            + +  C D  TCC+     + CC    AVCC D  HCCP+G+TC+     C K A S +      PAL+V  EP +      V  +D+V CP+  T CK           ++ CCP   AVCC D   CCPEGTTC++    C +   S+
Sbjct:  527 DDQFSCPDGDTCCKMPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDKGALS-LPWSTKTPALRVAGEPND------VKCDDQVSCPDQTTCCKTGT-------GDWGCCPLVKAVCCDDHEHCCPEGTTCNVPAGSCDQGQLSL 662          

HSP 3 Score: 83.1889 bits (204), Expect = 9.105e-19
Identity = 52/150 (34.67%), Postives = 75/150 (50.00%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            + ++ C D  TCC+     + CC    AVCC D  HCCPEG+TC+    +C K    ++      PAL+V  EP   I +      D+  CP+         TCC     ++ CCP   AVCC D   CCP+GTTC++  + C + + S+
Sbjct:  371 DDQSSCPDGNTCCKMPSGDWGCCPLPKAVCCDDHQHCCPEGTTCNLPVERCDK-GTLSLPWSTKTPALRVAGEPNVVICD------DQFSCPDG-------NTCCKLPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSL 506          

HSP 4 Score: 80.8777 bits (198), Expect = 5.341e-18
Identity = 52/145 (35.86%), Postives = 73/145 (50.34%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            C D  TCC+T    + CC    AVCC D  HCCP+G+TC+     C +    ++      PAL+V  EP   I +      D+  CP+         TCC T   ++ CCP   AVCC D   CCP+GTTC++  + C + + S+
Sbjct:  220 CPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQ-GTLSLPWSTKTPALRVAGEPNVVICD------DQSSCPDG-------NTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSL 350          

HSP 5 Score: 77.0258 bits (188), Expect = 1.095e-16
Identity = 48/152 (31.58%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  142 CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            CP+  T C D  TCC      Y CC   +AVCC D  HCCP+ + CD K  KCV   K ++      P+ +   + + +   +  ++N   + P+                  + CCP   AVCC DK  CCPEGT C++ ++ C  ++ S+
Sbjct:   61 CPDG-TSCGDDATCCPLASGQYGCCSLEDAVCCSDYLHCCPKNTMCDLKLGKCVH-GKLSIPWVSKYPSKQAASDVQCDAFTSCSDQNTCCILPS----------------GQWGCCPLPKAVCCDDKEHCCPEGTICNVTSQTCNHAALSL 194          

HSP 6 Score: 72.0182 bits (175), Expect = 6.075e-15
Identity = 47/148 (31.76%), Postives = 64/148 (43.24%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPA---LKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLK 582
            + +  C D+ TCC+T    + CC    AVCC D  HCCPEG+TC+     C +  + ++      PA   L              V  +    CP+  T C+            + CCP   A CCSD   CCP G TCD+    C+K
Sbjct:  605 DDQVSCPDQTTCCKTGTGDWGCCPLVKAVCCDDHEHCCPEGTTCNVPAGSCDQ-GQLSLPWSSKTPARTRLTALLPASAAARGGSVRCDSAYACPDGTTCCQLP-------QGQWGCCPLPLATCCSDFVHCCPSGYTCDLAQASCIK 744          
BLAST of Granulin precursor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001039.1 (pep scaffold:Pmarinus_7.0:GL484091:11570:24665:-1 gene:ENSPMAG00000000936.1 transcript:ENSPMAT00000001039.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 3.743e-13
Identity = 55/163 (33.74%), Postives = 76/163 (46.63%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNV--------ELPNDAE 627
            C   QTCC+++   + CC    A CC D  HCCP G++ D K  +CV  A        LIP LK     K   L   V +N  V C      C+  +TCC ++   + CC  + A CCSD   CCP  T C +  + C +SS +++ V         LP D+ 
Sbjct:  379 CRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSGASGDLKG-QCVNSA-------ALIPWLK-----KEAALSGPVGDN-LVHC-GGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVPYRLCSRSSEALSGVAGSSTLSHALPYDSR 526          

HSP 2 Score: 58.151 bits (139), Expect = 2.432e-10
Identity = 45/136 (33.09%), Postives = 61/136 (44.85%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNK 570
            C   QTCC+++   + CC    A CC D  HCCP  + C   Q          V    LIP LK     K   L   V +N  V+       C+  +TCC ++   + CC  + A CCSD   CCP G + D+K +
Sbjct:  303 CRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVGQ---------CVNSAALIPWLK-----KEAALSGPVGDN--VVHCGGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSGASGDLKGQ 422          

HSP 3 Score: 54.6842 bits (130), Expect = 4.587e-9
Identity = 42/133 (31.58%), Postives = 53/133 (39.85%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDI 561
            C   QTCC+++   + CC    A CC D  HCCP  + C   Q          V    LIP LK     K   L   V +N  V C   +   +    C       + CC  + A CCSD   CCP  T C +
Sbjct:  151 CRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVGQ---------CVNSAALIPWLK-----KEAALSGPVGDN-VVHCGGGQYCRRWQTCCRSRC-GMWGCCNGRRATCCSDGIHCCPSMTRCLV 267          

HSP 4 Score: 54.299 bits (129), Expect = 4.630e-9
Identity = 44/153 (28.76%), Postives = 68/153 (44.44%), Query Frame = 1
Query:  181 CCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAK-QHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENG 636
            CC+++   + CC    A CC D  HCCP  + C    + +CV  A        LIP LK     K   L   V +N  V C   +   +    C       + CC  + A CCSD   CCP  T C +  + C +SS +++ ++  +  +++G
Sbjct:    1 CCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRGQCVNSAA-------LIPWLK-----KEAALSGPVGDN-LVHCGGGQYCRRWQTCCRSRC-GMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRLCSRSSEALSVLDYLSREQQDG 139          

HSP 5 Score: 47.3654 bits (111), Expect = 1.059e-6
Identity = 33/136 (24.26%), Postives = 52/136 (38.24%), Query Frame = 1
Query:  163 CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE---NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDI 561
            C   QTCC+++   + CC    A CC D  HCCP  + C      C +    + E   ++  L  + +   N++     +     +  C +                  + CC  + A CCSD   CCP  T C +
Sbjct:   74 CRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRLCSR----SSEALSVLDYLSREQQDGYNVVHCGGGQYCRRWQTCCRSR--------------RGMWGCCNGRRATCCSDGIHCCPSMTRCLV 191          
BLAST of Granulin precursor vs. Ensembl Nematostella
Match: EDO27824 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T870])

HSP 1 Score: 62.7734 bits (151), Expect = 3.852e-12
Identity = 49/146 (33.56%), Postives = 65/146 (44.52%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKS 585
            N  + C D +TCC+    SY CC   NAVCC D  HCCP G  CD     C   AK +  M      ++     +  + E K  +                +TCC+     Y CCP  +AVCC+D   CCP G TC+ K+  C + 
Sbjct:   10 NDGSHCYDYETCCELSTGSYGCCPLPNAVCCSDGKHCCPCGYHCDISSSTCDM-AKDSTPMVSYHATVQ-----RAGVGEIKCKDGSHC---------NTGETCCLVGPTKYGCCPLPSAVCCADMQHCCPSGYTCNDKSGHCQRG 140          

HSP 2 Score: 55.8398 bits (133), Expect = 1.221e-9
Identity = 44/147 (29.93%), Postives = 62/147 (42.18%), Query Frame = 1
Query:  157 TKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEV-MCPNNXXXXXXXXXXX----XXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLK 582
            + C   +TCC      Y CC   +AVCC D  HCCP G TC+ K   C +  +  + M +  P++     P+  + +  V  +  +   P                  +      CCP  NA CCSD   CCP+G  CD   K C+K
Sbjct:   90 SHCNTGETCCLVGPTKYGCCPLPSAVCCADMQHCCPSGYTCNDKSGHCQR-GRHVLPMFQKHPSV----HPRPAVAKTPVIIDHTIRFVPRGGRGAGCACEPYHTCCGSSSAQQNCCPLPNASCCSDGLHCCPQGFICD-DQKGCVK 230          
BLAST of Granulin precursor vs. Ensembl Medaka
Match: grnb (granulin precursor [Source:NCBI gene;Acc:101166910])

HSP 1 Score: 102.064 bits (253), Expect = 1.251e-24
Identity = 67/212 (31.60%), Postives = 97/212 (45.75%), Query Frame = 1
Query:   25 VAILGFNLLLIFV-VKIYADGVMSFDVLLENQKNVT--------TDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEEN 633
            V ++G +  L+     + ADG   F   L +    T           ICP++ ++C D  TCCQ    S+ CC +  AVCC D+ HCCPEG+TCD    KC   +     M + +PA +V   P      + V    +  CPN+ T C  T         ++ CCP+  A CCSD   CCP  TTCD++   C      V  +   + + E+
Sbjct:    6 VVLVGLSAALLCPDGAVCADGHKCF---LNSHGGFTCPLPHTRVGAVICPDQESECPDETTCCQLPDGSWGCCPFPKAVCCEDQRHCCPEGTTCDLVHSKCASPSLQAFPMLQKVPAQRVGTLPVFAAAASVVCPGGKSSCPNSFTCCLLTS-------GDFGCCPYPQATCCSDHLHCCPGNTTCDLERGVCKSGEARVEPIRAVSASPED 207          

HSP 2 Score: 93.2041 bits (230), Expect = 1.312e-21
Identity = 63/180 (35.00%), Postives = 83/180 (46.11%), Query Frame = 1
Query:   91 SFDVLLENQKNVTT---DNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEA-KVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPN 618
            S +  +E  + V+    D +CP++R+ C D  TCCQ  + ++ CC   NAVCC D  HCCPEG+TCD     CV  A    E   ++P       PK + +    V  N  V C +         TCC      + CCP   AVCC D   CCP GT C++    C   S S     L N
Sbjct:  190 SGEARVEPIRAVSASPEDVLCPDQRSMCPDGTTCCQLNNGTFGCCPLPNAVCCSDHMHCCPEGTTCDLAHSTCVSAAGGTAEA-VMVPVSGT--PPKTHPVRGLAVPCNASVACADG-------STCCRASRGQWGCCPLPEAVCCEDHLHCCPHGTVCNLVASTCDDPSGSALTPLLSN 359          

HSP 3 Score: 88.9669 bits (219), Expect = 4.843e-20
Identity = 59/185 (31.89%), Postives = 86/185 (46.49%), Query Frame = 1
Query:   58 FVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
             + K+ A  V +  V            +CP  ++ C +  TCC      + CC Y  A CC D  HCCP  +TCD ++  C K  ++ VE     P   V   P            ++V+CP+ ++ C D  TCC   +  + CCP  NAVCCSD   CCPEGTTCD+ +  C+ ++       +
Sbjct:  113 MLQKVPAQRVGTLPVFA-----AAASVVCPGGKSSCPNSFTCCLLTSGDFGCCPYPQATCCSDHLHCCPGNTTCDLERGVC-KSGEARVE-----PIRAVSASP------------EDVLCPDQRSMCPDGTTCCQLNNGTFGCCPLPNAVCCSDHMHCCPEGTTCDLAHSTCVSAAGGTAEAVM 274          

HSP 4 Score: 75.8702 bits (185), Expect = 1.263e-15
Identity = 51/166 (30.72%), Postives = 75/166 (45.18%), Query Frame = 1
Query:  112 NQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKC-LKSSFSVNNV 606
             + +  TD  C NK + C    TCC  +   + CC    AVCC D  HCCP+  TC+ +   C K A   + + +++PA   D +      +   +   E  CP   T C+ +          + CCP   AVCC D   CCP G +CD+K   C L    S +++
Sbjct:  602 TEPSGVTDVKCDNK-SSCASGTTCCPLQTGGWGCCPLVKAVCCADHEHCCPQSYTCNMQTGTCEKKAGQGLPLSRVVPAQPQDTQ------DVPCDGTGEFKCPKQNTCCRISA-------TAWGCCPSPGAVCCMDSKHCCPAGYSCDLKAGGCTLGPRLSWDSL 753          

HSP 5 Score: 66.2402 bits (160), Expect = 2.425e-12
Identity = 47/150 (31.33%), Postives = 66/150 (44.00%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
             K   C  R TCC+     + CC    AVCC D  HCCP+G  C+A    C +    ++   + +PAL+     +   +E K +   +  CP + T C   +T        + CCP   AVCC D   CCP G +C      C + S  V
Sbjct:  452 GKDAVCPGRTTCCKNSSGQWACCPLPQAVCCSDLDHCCPKGYKCNAFDRTCERPGGPSLPWRQKLPALQQRSG-QTGPVENKCDA--QTSCPKDTTCCFMEQTL------KWGCCPLPQAVCCGDGNHCCPRGHSCQPHRSSCSRGSHVV 592          

HSP 6 Score: 62.003 bits (149), Expect = 7.559e-11
Identity = 46/171 (26.90%), Postives = 72/171 (42.11%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV--NNVELPNDAEENGNK*YIE 654
            ++   C    TCC+T+   + CC    AVCC D  HCCP  + C+ +   C         +   +P L         + E K  +  + +CP   T CK++          + CCP   AVCCSD   CCP+G  C+  ++ C +          +LP   + +G    +E
Sbjct:  373 DESASCPGEATCCRTRAGGWACCPLPQAVCCDDHIHCCPNATICNLEAETC----DDPSGLSPPLPWLTKRPRLTAGMEEEKCGK--DAVCPGRTTCCKNSS-------GQWACCPLPQAVCCSDLDHCCPKGYKCNAFDRTCERPGGPSLPWRQKLPALQQRSGQTGPVE 530          

HSP 7 Score: 53.1434 bits (126), Expect = 7.881e-8
Identity = 46/146 (31.51%), Postives = 64/146 (43.84%), Query Frame = 1
Query:  148 NKRTKCTDRQTCCQTKHN-SYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLK 582
            + +T C    TCC  +    + CC    AVCC D  HCCP G +C   +  C +          ++P        K   L       D V C +NK+ C    TCC  +   + CCP   AVCC+D   CCP+  TC+++   C K
Sbjct:  534 DAQTSCPKDTTCCFMEQTLKWGCCPLPQAVCCGDGNHCCPRGHSCQPHRSSCSR-------GSHVVPWFT-----KVGALTEPSGVTD-VKC-DNKSSCASGTTCCPLQTGGWGCCPLVKAVCCADHEHCCPQSYTCNMQTGTCEK 665          
BLAST of Granulin precursor vs. Ensembl Medaka
Match: grna (granulins [Source:NCBI gene;Acc:101162601])

HSP 1 Score: 83.1889 bits (204), Expect = 4.345e-18
Identity = 60/171 (35.09%), Postives = 81/171 (47.37%), Query Frame = 1
Query:   85 VMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            V SF  +    ++V  D       T C D+ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V  +    CP+         TCC TK   + CCP   AVCC D   CCP GTTCD+    CLK+S  V
Sbjct:  676 VPSFSNVSVKMEDVPCDG-----STSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----KVSVKMEDVPCDGSTSCPDQ-------TTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKASGLV 828          

HSP 2 Score: 80.1073 bits (196), Expect = 5.715e-17
Identity = 61/201 (30.35%), Postives = 90/201 (44.78%), Query Frame = 1
Query:    7 SKMKNFVAILGFNLLLIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
             K  + VA+ G N    F     A+ V +F          +  +I  N+   C D+ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V  +    CP+         TCC T+   + CCP   AVCC D   CCP+G TC++  + C     SV  +E
Sbjct:  251 GKEVSAVAVEG-NETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----KVSVKMEDVPCDGSTSCPDQ-------TTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLE 437          

HSP 3 Score: 78.9518 bits (193), Expect = 1.132e-16
Identity = 56/175 (32.00%), Postives = 81/175 (46.29%), Query Frame = 1
Query:   85 VMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            V SF  +    ++V  D       T C D+ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V  +    CP+         TCC T+   + CCP   AVCC D   CCP+G TC++  + C     SV  +E
Sbjct:  518 VPSFSNVSVKMEDVPCDG-----STSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----KVSVKMEDVPCDGSTSCPDQ-------TTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLE 674          

HSP 4 Score: 77.7962 bits (190), Expect = 3.405e-16
Identity = 52/143 (36.36%), Postives = 71/143 (49.65%), Query Frame = 1
Query:  160 KCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            +C +  +CC+     + CC   NAVCC DK HCCPEG TCD     C K     +E   L P    DD+ ++  ++  +N  D+V   N        +TCC T H  + CC    AVCC D   CCP+G  C  K   C+K++
Sbjct:  969 QCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLLTLQLETVPLTPVFLPDDQSQHGPVKPILNRCDDVYSCN------VDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRC-TKGGSCIKNT 1104          

HSP 5 Score: 77.411 bits (189), Expect = 3.926e-16
Identity = 55/175 (31.43%), Postives = 80/175 (45.71%), Query Frame = 1
Query:   85 VMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            V SF  +    ++V  D       T C D+ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+         ++    V  +    CP+         TCC T+   + CCP   AVCC D   CCP+G TC++  + C     SV  +E
Sbjct:  360 VPSFSKVSVKMEDVPCDG-----STSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----NVSVKMEDVPCDGSTSCPDQ-------TTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLE 516          

HSP 6 Score: 77.411 bits (189), Expect = 3.926e-16
Identity = 54/175 (30.86%), Postives = 78/175 (44.57%), Query Frame = 1
Query:   85 VMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            V SF  +    ++V  D       T C D+ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+         ++    V  +    CP+  T CK            + CCP   AVCC D   CCP+G TC++  + C     SV  +E
Sbjct:  597 VPSFSKVSVKMEDVPCDG-----STSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----NVSVKMEDVPCDGSTSCPDQTTCCKTQ-------EGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLE 753          

HSP 7 Score: 77.411 bits (189), Expect = 4.657e-16
Identity = 59/190 (31.05%), Postives = 83/190 (43.68%), Query Frame = 1
Query:  139 ICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEM-----------------GKLIPALKVDDEPKNNILE----------------AKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            +C +  ++C D  TCC+ +   + CC    AVCC DK HCCPE +TCD +Q KC+  +   + M                 GK + A+ V+     N  E                A      ++ C N    C D  TCC T+   + CCP   AVCC D   CCP+G TC++  + C     SV  +E
Sbjct:  170 LCKDGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPC-NETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLE 358          

HSP 8 Score: 76.2554 bits (186), Expect = 1.214e-15
Identity = 59/185 (31.89%), Postives = 83/185 (44.86%), Query Frame = 1
Query:   43 NLLLIFVVKIYADGVMSFDV--LLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE-NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
             L + +V ++ A+  M+     ++ +      DNICP+ +++C    +C +     Y CC  A  V CPD  HCCPEG  C      CVK  K ++               K  + +  V+E  DE  C  N+                + CCP   AVCC DK  CCPE TTCD++  KCL SS
Sbjct:   75 TLSMRWVERVSANLQMATKSFRMIRSYMGEDEDNICPD-QSRCPAEFSCLKA-LTRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSCVK--KESI---------------KTVLCKDGVSECPDETTCCENQ-------------EGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSS 227          

HSP 9 Score: 73.9442 bits (180), Expect = 6.191e-15
Identity = 56/195 (28.72%), Postives = 82/195 (42.05%), Query Frame = 1
Query:   85 VMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNIL------------------------EAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            V SF  +    ++V  D       T C D+ TCC+TK  ++ CC    AVCC D  HCCP G+TCD     C+K A   V M K +PA        + ++                        E K +E   + C ++    + T  C + +   + CCP   AVCC+D   CCP    C  ++  C+K    +
Sbjct:  755 VPSFSKVSVKMEDVPCDG-----STSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLK-ASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVKGEVVI 943          

HSP 10 Score: 72.0182 bits (175), Expect = 2.658e-14
Identity = 45/166 (27.11%), Postives = 74/166 (44.58%), Query Frame = 1
Query:   85 VMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLK 582
            +  + V+      +   ++CPN   KC   QTCCQ+    Y CC +  A CC D  HCCP+   CD     C     S   + ++   L++  +    ++ + + E+++ +CP+      +           Y CCP    V C D   CCPEG  C + ++ C+K
Sbjct:    1 MQKWVVICWVSLALVAADMCPNGG-KCEKGQTCCQSPSKDYDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLSMRWVERVSANLQMATK-SFRMIRSYMGEDEDNICPDQSRCPAEFSCLKAL--TRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSCVK 162          

HSP 11 Score: 56.6102 bits (135), Expect = 4.381e-9
Identity = 60/199 (30.15%), Postives = 80/199 (40.20%), Query Frame = 1
Query:   79 DGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKH-NSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKC----VKCAKSNVEMGKL--IPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLK------SSFSVNNVELPNDAEENG 636
            DG   FD   E  K      I  +  T+C    TCC  K    + CC    AVCC        +G  C    +KC      C K  V +     IPA        + +  + V++  E M            +CC      + CCP  NAVCC DK  CCPEG TCD+ +K C K       +  +  V LP+D  ++G
Sbjct:  865 DGQEDFD---EEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCA-------DGEHCCPADYKCKEEDTSCVKGEVVIPWYTKIPATDSIQADSSFVQCSAVHQCPEHM------------SCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLLTLQLETVPLTPVFLPDDQSQHG 1041          
BLAST of Granulin precursor vs. Ensembl Medaka
Match: grna (granulins [Source:NCBI gene;Acc:101162601])

HSP 1 Score: 83.1889 bits (204), Expect = 4.953e-18
Identity = 58/171 (33.92%), Postives = 79/171 (46.20%), Query Frame = 1
Query:   85 VMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            V SF  +    ++V  D       T C D+ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V  +    CP+  T CK            + CCP   AVCC D   CCP GTTCD+    CLK+S  V
Sbjct:  597 VPSFSNVSVKMEDVPCDG-----STSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----KVSVKMEDVPCDGSTSCPDQTTCCKTK-------DGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKASGLV 749          

HSP 2 Score: 79.7221 bits (195), Expect = 6.638e-17
Identity = 61/201 (30.35%), Postives = 90/201 (44.78%), Query Frame = 1
Query:    7 SKMKNFVAILGFNLLLIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
             K  + VA+ G N    F     A+ V +F          +  +I  N+   C D+ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V  +    CP+         TCC T+   + CCP   AVCC D   CCP+G TC++  + C     SV  +E
Sbjct:  251 GKEVSAVAVEG-NETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----KVSVKMEDVPCDGSTSCPDQ-------TTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLE 437          

HSP 3 Score: 77.7962 bits (190), Expect = 3.271e-16
Identity = 52/143 (36.36%), Postives = 71/143 (49.65%), Query Frame = 1
Query:  160 KCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
            +C +  +CC+     + CC   NAVCC DK HCCPEG TCD     C K     +E   L P    DD+ ++  ++  +N  D+V   N        +TCC T H  + CC    AVCC D   CCP+G  C  K   C+K++
Sbjct:  890 QCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLLTLQLETVPLTPVFLPDDQSQHGPVKPILNRCDDVYSCN------VDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRC-TKGGSCIKNT 1025          

HSP 4 Score: 77.411 bits (189), Expect = 4.560e-16
Identity = 55/175 (31.43%), Postives = 80/175 (45.71%), Query Frame = 1
Query:   85 VMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            V SF  +    ++V  D       T C D+ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+         ++    V  +    CP+         TCC T+   + CCP   AVCC D   CCP+G TC++  + C     SV  +E
Sbjct:  360 VPSFSKVSVKMEDVPCDG-----STSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----NVSVKMEDVPCDGSTSCPDQ-------TTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLE 516          

HSP 5 Score: 77.411 bits (189), Expect = 4.966e-16
Identity = 59/190 (31.05%), Postives = 83/190 (43.68%), Query Frame = 1
Query:  139 ICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEM-----------------GKLIPALKVDDEPKNNILE----------------AKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            +C +  ++C D  TCC+ +   + CC    AVCC DK HCCPE +TCD +Q KC+  +   + M                 GK + A+ V+     N  E                A      ++ C N    C D  TCC T+   + CCP   AVCC D   CCP+G TC++  + C     SV  +E
Sbjct:  170 LCKDGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPC-NETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLE 358          

HSP 6 Score: 77.0258 bits (188), Expect = 6.236e-16
Identity = 55/175 (31.43%), Postives = 80/175 (45.71%), Query Frame = 1
Query:   85 VMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVE 609
            V SF  +    ++V  D       T C D+ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+         ++    V  +    CP+         TCC T+   + CCP   AVCC D   CCP+G TC++  + C     SV  +E
Sbjct:  518 VPSFSNVSVKMEDVPCDG-----STSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----NVSVKMEDVPCDGSTSCPDQ-------TTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLE 674          

HSP 7 Score: 75.8702 bits (185), Expect = 1.319e-15
Identity = 59/185 (31.89%), Postives = 83/185 (44.86%), Query Frame = 1
Query:   43 NLLLIFVVKIYADGVMSFDV--LLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNE-NDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSS 588
             L + +V ++ A+  M+     ++ +      DNICP+ +++C    +C +     Y CC  A  V CPD  HCCPEG  C      CVK  K ++               K  + +  V+E  DE  C  N+                + CCP   AVCC DK  CCPE TTCD++  KCL SS
Sbjct:   75 TLSMRWVERVSANLQMATKSFRMIRSYMGEDEDNICPD-QSRCPAEFSCLKA-LTRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSCVK--KESI---------------KTVLCKDGVSECPDETTCCENQ-------------EGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSS 227          

HSP 8 Score: 73.9442 bits (180), Expect = 6.356e-15
Identity = 56/195 (28.72%), Postives = 82/195 (42.05%), Query Frame = 1
Query:   85 VMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNIL------------------------EAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            V SF  +    ++V  D       T C D+ TCC+TK  ++ CC    AVCC D  HCCP G+TCD     C+K A   V M K +PA        + ++                        E K +E   + C ++    + T  C + +   + CCP   AVCC+D   CCP    C  ++  C+K    +
Sbjct:  676 VPSFSKVSVKMEDVPCDG-----STSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLK-ASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVKGEVVI 864          

HSP 9 Score: 72.0182 bits (175), Expect = 2.943e-14
Identity = 45/166 (27.11%), Postives = 74/166 (44.58%), Query Frame = 1
Query:   85 VMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLK 582
            +  + V+      +   ++CPN   KC   QTCCQ+    Y CC +  A CC D  HCCP+   CD     C     S   + ++   L++  +    ++ + + E+++ +CP+      +           Y CCP    V C D   CCPEG  C + ++ C+K
Sbjct:    1 MQKWVVICWVSLALVAADMCPNGG-KCEKGQTCCQSPSKDYDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLSMRWVERVSANLQMATK-SFRMIRSYMGEDEDNICPDQSRCPAEFSCLKAL--TRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSCVK 162          

HSP 10 Score: 56.6102 bits (135), Expect = 4.376e-9
Identity = 60/199 (30.15%), Postives = 80/199 (40.20%), Query Frame = 1
Query:   79 DGVMSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKH-NSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKC----VKCAKSNVEMGKL--IPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLK------SSFSVNNVELPNDAEENG 636
            DG   FD   E  K      I  +  T+C    TCC  K    + CC    AVCC        +G  C    +KC      C K  V +     IPA        + +  + V++  E M            +CC      + CCP  NAVCC DK  CCPEG TCD+ +K C K       +  +  V LP+D  ++G
Sbjct:  786 DGQEDFD---EEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCA-------DGEHCCPADYKCKEEDTSCVKGEVVIPWYTKIPATDSIQADSSFVQCSAVHQCPEHM------------SCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLLTLQLETVPLTPVFLPDDQSQHG 962          
BLAST of Granulin precursor vs. Ensembl Medaka
Match: ENSORLT00000005071.2 (granulins [Source:NCBI gene;Acc:101168633])

HSP 1 Score: 71.633 bits (174), Expect = 1.613e-14
Identity = 54/169 (31.95%), Postives = 72/169 (42.60%), Query Frame = 1
Query:  142 CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLI-------PALKVDDEPKNNILEAKVNENDEV------------MCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSF 591
            CP+ +  C D  TCC T H  + CC    AVCC DK HCCP G  C+     C K  +  V +  L        PAL +      N++E   N+N               MCP+         TCC      ++CCP+    CC D + CCP G  CD+    C++  F
Sbjct:   26 CPDGKL-CPDLSTCCLTGHG-FSCCPLPEAVCCSDKAHCCPSGYRCNLATMMCEKTDQPWVSLPMLTKEAAEEPPALDL----STNLVEELKNDNGLAQKSTGVQCDSFYMCPDR-------TTCCRHPKGAWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGF 181          

HSP 2 Score: 65.4698 bits (158), Expect = 2.680e-12
Identity = 58/206 (28.16%), Postives = 85/206 (41.26%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTK--------CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL----IPALKVDDEPKNNI-LEAKV----------NENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVN 600
            L  + K  A+   + D+     + +  DN    K T         C DR TCC+    ++ CC Y    CC D FHCCP G  CD     C++         K     +PA  +    +N+I LE  +          +E+  + C ++K  C    +CC      + CCP+    CC+D   CC  G TCD  +  C K S+ V 
Sbjct:   86 LPMLTKEAAEEPPALDLSTNLVEELKNDNGLAQKSTGVQCDSFYMCPDRTTCCRHPKGAWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGFKYPFYYKQALTSVPAALISHPEENSIQLEKSLTALTEASDAPSEHGVIRC-DSKFFCPAGTSCCKGAEGQWTCCPYPLGKCCADGRHCCQYGYTCDATSATCRKLSYPVG 290          
BLAST of Granulin precursor vs. Ensembl Medaka
Match: ENSORLT00000029765.1 (granulins [Source:NCBI gene;Acc:101168633])

HSP 1 Score: 71.2478 bits (173), Expect = 1.750e-14
Identity = 54/169 (31.95%), Postives = 72/169 (42.60%), Query Frame = 1
Query:  142 CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLI-------PALKVDDEPKNNILEAKVNENDEV------------MCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSF 591
            CP+ +  C D  TCC T H  + CC    AVCC DK HCCP G  C+     C K  +  V +  L        PAL +      N++E   N+N               MCP+         TCC      ++CCP+    CC D + CCP G  CD+    C++  F
Sbjct:   24 CPDGKL-CPDLSTCCLTGHG-FSCCPLPEAVCCSDKAHCCPSGYRCNLATMMCEKTDQPWVSLPMLTKEAAEEPPALDL----STNLVEELKNDNGLAQKSTGVQCDSFYMCPDR-------TTCCRHPKGAWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGF 179          

HSP 2 Score: 61.2326 bits (147), Expect = 7.138e-11
Identity = 56/200 (28.00%), Postives = 82/200 (41.00%), Query Frame = 1
Query:   52 LIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTK--------CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL----IPALKVDDEPKNNI-LEAKV----------NENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLK 582
            L  + K  A+   + D+     + +  DN    K T         C DR TCC+    ++ CC Y    CC D FHCCP G  CD     C++         K     +PA  +    +N+I LE  +          +E+  + C ++K  C    +CC      + CCP+    CC+D   CC  G TCD  +  C K
Sbjct:   84 LPMLTKEAAEEPPALDLSTNLVEELKNDNGLAQKSTGVQCDSFYMCPDRTTCCRHPKGAWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGFKYPFYYKQALTSVPAALISHPEENSIQLEKSLTALTEASDAPSEHGVIRC-DSKFFCPAGTSCCKGAEGQWTCCPYPLGKCCADGRHCCQYGYTCDATSATCRK 282          
BLAST of Granulin precursor vs. Planmine SMEST
Match: SMESG000018766.1 (SMESG000018766.1)

HSP 1 Score: 291.197 bits (744), Expect = 2.063e-99
Identity = 160/185 (86.49%), Postives = 165/185 (89.19%), Query Frame = 1
Query:   88 MSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGNK 642
            M   V+ E    + TD  CPN RTKC D QTCC TKH SYHCCK+ANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEM KLIPALKV+DEPK NILEAKVNE DEVMCPNNKTKCKD KTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFS+NNVELPNDAEENGNK
Sbjct:  116 MEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDIKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSLNNVELPNDAEENGNK 300          

HSP 2 Score: 172.17 bits (435), Expect = 1.212e-52
Identity = 108/204 (52.94%), Postives = 139/204 (68.14%), Query Frame = 1
Query:   13 MKNFVAILGFNLLLIFVVKIY-ADGVMSFDV-LLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNN--ILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            MKN  +I+   ++L  V  +  A G +SF++  L+N+   T  NICPNKRTKCT+RQTCCQTKHNSYHCCKYANAVCCPDKFHCCP G++CD+   KC +    N+E  K    ++   EP     I E  V    +  CPNN+TKC+D++TCC+TKH +Y+CC   NAVCC DK+ CCPEG+TCD K  KC+K + S  NVE+
Sbjct:    1 MKNIFSIVTICVVLTLVSSLAEAGGTLSFNLSWLDNENKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNR----NIEATK--SPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKS--NVEM 196          
BLAST of Granulin precursor vs. Planmine SMEST
Match: SMESG000018766.1 (SMESG000018766.1)

HSP 1 Score: 289.656 bits (740), Expect = 2.856e-99
Identity = 160/185 (86.49%), Postives = 165/185 (89.19%), Query Frame = 1
Query:   88 MSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGNK 642
            M   V+ E    + TD  CPN RTKC D QTCC TKH SYHCCK+ANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEM KLIPALKV+DEPK NILEAKVNE DEVMCPNNKTKCKD KTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFS+NNVELPNDAEENGNK
Sbjct:   82 MEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDIKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSLNNVELPNDAEENGNK 266          

HSP 2 Score: 153.68 bits (387), Expect = 6.762e-46
Identity = 99/172 (57.56%), Postives = 123/172 (71.51%), Query Frame = 1
Query:  103 LLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNN--ILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            +LEN++  T  NICPNKRTKCT+RQTCCQTKHNSYHCCKYANAVCCPDKFHCCP G++CD+   KC +    N+E  K    ++   EP     I E  V    +  CPNN+TKC+D++TCC+TKH +Y+CC   NAVCC DK+ CCPEG+TCD K  KC+K + S  NVE+
Sbjct:    1 MLENKE--TVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNR----NIEATK--SPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKS--NVEM 162          
BLAST of Granulin precursor vs. Planmine SMEST
Match: SMESG000018766.1 (SMESG000018766.1)

HSP 1 Score: 289.271 bits (739), Expect = 7.452e-99
Identity = 160/185 (86.49%), Postives = 165/185 (89.19%), Query Frame = 1
Query:   88 MSFDVLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVELPNDAEENGNK 642
            M   V+ E    + TD  CPN RTKC D QTCC TKH SYHCCK+ANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEM KLIPALKV+DEPK NILEAKVNE DEVMCPNNKTKCKD KTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFS+NNVELPNDAEENGNK
Sbjct:   97 MEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDIKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSLNNVELPNDAEENGNK 281          

HSP 2 Score: 150.984 bits (380), Expect = 1.057e-44
Identity = 96/164 (58.54%), Postives = 117/164 (71.34%), Query Frame = 1
Query:  127 TTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNN--ILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            T  NICPNKRTKCT+RQTCCQTKHNSYHCCKYANAVCCPDKFHCCP G++CD+   KC +    N+E  K    ++   EP     I E  V    +  CPNN+TKC+D++TCC+TKH +Y+CC   NAVCC DK+ CCPEG+TCD K  KC+K + S  NVE+
Sbjct:   22 TVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNR----NIEATK--SPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKS--NVEM 177          
BLAST of Granulin precursor vs. Planmine SMEST
Match: SMESG000018762.1 (SMESG000018762.1)

HSP 1 Score: 280.026 bits (715), Expect = 1.263e-91
Identity = 160/204 (78.43%), Postives = 170/204 (83.33%), Query Frame = 1
Query:   31 ILGFNLLLIFVVKIYADGVMSFD-------------VLLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNN 603
            IL  N LL  +  +  D +++               + LE  KNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKV+DEPK NILEAKVNE DEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGT CD+KNKKCL +SF V +
Sbjct:   45 ILQCNSLLAPLYALAPDSLIALPDYRGVKTPDKLELISLEYLKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVES 248          

HSP 2 Score: 276.559 bits (706), Expect = 2.410e-90
Identity = 153/164 (93.29%), Postives = 157/164 (95.73%), Query Frame = 1
Query:  112 NQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNN 603
            N KNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKV+DEPK NILEAKVNE DEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGT CD+KNKKCL +SF V +
Sbjct:  307 NHKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVES 470          

HSP 3 Score: 92.0485 bits (227), Expect = 2.327e-21
Identity = 65/170 (38.24%), Postives = 92/170 (54.12%), Query Frame = 1
Query:  103 LLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKC-----AKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            +LE + N   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPEG+ CD K  KC+       +++NV+    +P      E  N  L  K+ +  E  C + K  C   K CC+     + CC   + VCC D   CCP  T CD K  +C+ +   +
Sbjct:  396 ILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDT---VPHQLFLAEQSNYELVFKLFKM-EKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHGVCCPDLKTCCPHQTECDDKTNRCIANRLPL 561          

HSP 4 Score: 61.6178 bits (148), Expect = 7.260e-11
Identity = 45/89 (50.56%), Postives = 60/89 (67.42%), Query Frame = 1
Query:  346 ALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
             +K  D+ +   LE   N   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPEG+TCD K  KC+K + S  NVE+
Sbjct:   71 GVKTPDKLELISLEYLKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKS--NVEM 157          

HSP 5 Score: 55.4546 bits (132), Expect = 7.221e-9
Identity = 52/128 (40.62%), Postives = 65/128 (50.78%), Query Frame = 1
Query:  238 CPDKFHCCPEGSTC---DAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            C D+ H CP    C   DA +  C K    NV    +                          CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPEG+TCD K  KC+K + S  NVE+
Sbjct:  280 CADQKHTCPGKKNCCVMDAGKFGCCKFNHKNVTTDNI--------------------------CPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKS--NVEM 379          
BLAST of Granulin precursor vs. Planmine SMEST
Match: SMESG000018767.1 (SMESG000018767.1)

HSP 1 Score: 275.789 bits (704), Expect = 1.026e-90
Identity = 153/164 (93.29%), Postives = 157/164 (95.73%), Query Frame = 1
Query:  112 NQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNN 603
            N KNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKV+DEPK NILEAKVNE DEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGT CD+KNKKCL +SF V +
Sbjct:  241 NHKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVES 404          

HSP 2 Score: 274.248 bits (700), Expect = 4.004e-90
Identity = 152/163 (93.25%), Postives = 157/163 (96.32%), Query Frame = 1
Query:  115 QKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNN 603
            +KNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKV+DEPK NILEAKVNE DEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGT CD+KNKKCL +SF V +
Sbjct:   20 KKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVES 182          

HSP 3 Score: 111.694 bits (278), Expect = 2.216e-28
Identity = 86/208 (41.35%), Postives = 118/208 (56.73%), Query Frame = 1
Query:  103 LLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCA--------------------KSNVEM-GKLIPALKVDDEPKNN--------ILEAK---------VNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL 612
            +LE + N   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPEG+ CD K  KC+  +                    +SN E+  KL    K   + K+         +++A           N   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPEG+TCD K  KC+K + S  NVE+
Sbjct:  108 ILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDTVPHQLFLAEQSNYELVFKLFKMEKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKS--NVEM 313          

HSP 4 Score: 91.6633 bits (226), Expect = 2.993e-21
Identity = 65/170 (38.24%), Postives = 92/170 (54.12%), Query Frame = 1
Query:  103 LLENQKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKC-----AKSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSV 597
            +LE + N   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPEG+ CD K  KC+       +++NV+    +P      E  N  L  K+ +  E  C + K  C   K CC+     + CC   + VCC D   CCP  T CD K  +C+ +   +
Sbjct:  330 ILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDT---VPHQLFLAEQSNYELVFKLFKM-EKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHGVCCPDLKTCCPHQTECDDKTNRCIANRLPL 495          
The following BLAST results are available for this feature:
BLAST of Granulin precursor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRN1.747e-2030.89granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN2.099e-2033.33granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN2.227e-2030.89granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN2.167e-1629.27granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN4.596e-731.03granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
back to top
BLAST of Granulin precursor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pgrn-11.618e-2337.93ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
pgrn-11.768e-2338.01ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
T02B11.85.415e-631.71pep chromosome:WBcel235:V:877530:878667:-1 gene:WB... [more]
back to top
BLAST of Granulin precursor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Granulin precursor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb9.267e-2642.00granulin b [Source:ZFIN;Acc:ZDB-GENE-030131-7393][more]
grna8.008e-1933.92granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna8.447e-1832.80granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna8.890e-1832.80granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna9.323e-1832.80granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
back to top
BLAST of Granulin precursor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trappc111.739e-1933.88trafficking protein particle complex 11 [Source:Xe... [more]
trappc112.234e-1933.88trafficking protein particle complex 11 [Source:Xe... [more]
trappc114.062e-1933.51trafficking protein particle complex 11 [Source:Xe... [more]
trappc115.126e-1933.51trafficking protein particle complex 11 [Source:Xe... [more]
back to top
BLAST of Granulin precursor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Grn1.899e-1936.88granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn6.645e-1428.48granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn1.075e-1130.67granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn2.392e-1027.78granulin [Source:MGI Symbol;Acc:MGI:95832][more]
back to top
BLAST of Granulin precursor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P28799|GRN_HUMAN1.070e-1930.89Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV... [more]
sp|P28797|GRN_CAVPO2.917e-1935.06Progranulin OS=Cavia porcellus OX=10141 GN=GRN PE=... [more]
sp|P28798|GRN_MOUSE1.368e-1836.88Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 S... [more]
sp|P23785|GRN_RAT1.083e-1735.63Progranulin OS=Rattus norvegicus OX=10116 GN=Grn P... [more]
sp|P80059|PMD1_LOCMI2.624e-641.67Pars intercerebralis major peptide D1 OS=Locusta m... [more]
back to top
BLAST of Granulin precursor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2U9CNI55.256e-2538.20Putative granulins-like OS=Scophthalmus maximus OX... [more]
A0A5N5Q4638.503e-2537.36Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A3P8XNX39.721e-2536.41Granulin b OS=Esox lucius OX=8010 PE=4 SV=1[more]
W5LK032.300e-2437.79Granulin b OS=Astyanax mexicanus OX=7994 PE=4 SV=2[more]
A0A3P8XNU65.426e-2438.10Granulin b OS=Esox lucius OX=8010 PE=4 SV=1[more]
back to top
BLAST of Granulin precursor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb8.712e-2837.79granulins-like [Source:NCBI gene;Acc:103046308][more]
grnb8.712e-2837.79granulins-like [Source:NCBI gene;Acc:103046308][more]
ENSAMXT00000030959.13.386e-1727.52pep primary_assembly:Astyanax_mexicanus-2.0:23:267... [more]
ENSAMXT00000057729.13.386e-1727.52pep primary_assembly:Astyanax_mexicanus-2.0:23:267... [more]
ENSAMXT00000034465.14.719e-1727.52pep primary_assembly:Astyanax_mexicanus-2.0:23:267... [more]
back to top
BLAST of Granulin precursor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009302.11.449e-1935.33pep scaffold:Pmarinus_7.0:GL483232:1183:11161:1 ge... [more]
ENSPMAT00000001039.13.743e-1333.74pep scaffold:Pmarinus_7.0:GL484091:11570:24665:-1 ... [more]
back to top
BLAST of Granulin precursor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Granulin precursor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO278243.852e-1233.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Granulin precursor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb1.251e-2431.60granulin precursor [Source:NCBI gene;Acc:101166910... [more]
grna4.345e-1835.09granulins [Source:NCBI gene;Acc:101162601][more]
grna4.953e-1833.92granulins [Source:NCBI gene;Acc:101162601][more]
ENSORLT00000005071.21.613e-1431.95granulins [Source:NCBI gene;Acc:101168633][more]
ENSORLT00000029765.11.750e-1431.95granulins [Source:NCBI gene;Acc:101168633][more]
back to top
BLAST of Granulin precursor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018766.12.063e-9986.49SMESG000018766.1[more]
SMESG000018766.12.856e-9986.49SMESG000018766.1[more]
SMESG000018766.17.452e-9986.49SMESG000018766.1[more]
SMESG000018762.11.263e-9178.43SMESG000018762.1[more]
SMESG000018767.11.026e-9093.29SMESG000018767.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019945 ID=SMED30019945|Name=Granulin precursor|organism=Schmidtea mediterranea sexual|type=transcript|length=673bp
TAATAATCCAAAATGAAAAATTTTGTAGCAATTCTCGGATTTAATTTATT
ACTAATTTTCGTGGTCAAGATTTACGCAGACGGAGTAATGTCGTTTGATG
TACTTTTGGAAAATCAGAAAAATGTGACAACTGATAATATTTGCCCTAAC
AAACGTACGAAATGTACTGATAGACAAACGTGCTGCCAAACCAAACACAA
TAGCTATCACTGCTGTAAATATGCTAATGCCGTGTGTTGTCCAGATAAAT
TCCATTGTTGTCCAGAGGGTTCGACATGCGATGCGAAACAACATAAATGT
GTCAAATGTGCTAAATCAAATGTTGAAATGGGAAAGTTGATCCCAGCATT
GAAAGTTGATGATGAACCGAAAAATAACATTCTGGAAGCAAAAGTCAATG
AGAATGATGAAGTAATGTGTCCAAACAATAAAACAAAGTGTAAAGACACA
AAAACATGTTGTATTACAAAGCATAATAATTATTATTGTTGTCCACATAA
AAATGCGGTTTGTTGTTCCGATAAATACCAATGCTGTCCTGAAGGTACAA
CTTGTGATATTAAAAATAAAAAATGTCTCAAGTCCTCGTTTTCCGTGAAT
AATGTCGAACTACCAAATGATGCTGAGGAAAATGGAAATAAATAATACAT
TGAATATTTACTTTGAATTATCC
back to top

protein sequence of SMED30019945-orf-1

>SMED30019945-orf-1 ID=SMED30019945-orf-1|Name=SMED30019945-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=211bp
MKNFVAILGFNLLLIFVVKIYADGVMSFDVLLENQKNVTTDNICPNKRTK
CTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCA
KSNVEMGKLIPALKVDDEPKNNILEAKVNENDEVMCPNNKTKCKDTKTCC
ITKHNNYYCCPHKNAVCCSDKYQCCPEGTTCDIKNKKCLKSSFSVNNVEL
PNDAEENGNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: cellular component
TermDefinition
GO:0005765lysosomal membrane
GO:0005770late endosome
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0016020membrane
GO:0070062extracellular exosome
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005739mitochondrion
GO:0005764lysosome
GO:0005768endosome
GO:0005783endoplasmic reticulum
Vocabulary: biological process
TermDefinition
GO:0007041lysosomal transport
GO:0007042lysosomal lumen acidification
GO:0030335positive regulation of cell migration
GO:0043524negative regulation of neuron apoptotic process
GO:0050821protein stabilization
GO:0060266negative regulation of respiratory burst involved in inflammatory response
GO:1902564negative regulation of neutrophil activation
GO:1905247positive regulation of aspartic-type peptidase activity
GO:1905673positive regulation of lysosome organization
GO:0007566embryo implantation
GO:0050679positive regulation of epithelial cell proliferation
GO:0001835blastocyst hatching
Vocabulary: molecular function
TermDefinition
GO:0051087chaperone binding
GO:0003723RNA binding
GO:0005125cytokine activity
Vocabulary: INTERPRO
TermDefinition
IPR000118Granulin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.872
NoneNo IPR availableTMHMMTMhelixcoord: 5..27