Roc domain-containing protein

Overview
NameRoc domain-containing protein
Smed IDSMED30019942
Length (bp)3012
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Roc domain-containing protein (SMED30019942) t-SNE clustered cells

Violin plots show distribution of expression levels for Roc domain-containing protein (SMED30019942) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Roc domain-containing protein (SMED30019942) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Roc domain-containing protein (SMED30019942) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019942

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019942SMESG000038728.1 SmedASXL_016518SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30019942SMESG000038728.1 dd_Smed_v4_11334_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019942SMESG000038728.1 dd_Smed_v4_11334_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019942SMESG000038728.1 dd_Smed_v6_11334_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30019942SMESG000038728.1 dd_Smed_v4_11334_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: SHOC2 (SHOC2 leucine rich repeat scaffold protein [Source:HGNC Symbol;Acc:HGNC:15454])

HSP 1 Score: 84.3445 bits (207), Expect = 4.097e-16
Identity = 108/395 (27.34%), Postives = 201/395 (50.89%), Query Frame = 3
Query:  180 RDARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDL-----PA----VQAVEMEFCKINY--FKSF-QSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIK 1328
            ++  K  E++   ++LS  ++ ++P ++ +  ++T L +  N ++SLPA++  LVNL  L +S N         +T LP S+ NLK L+ L++    L  IP+ ++ + SL  L +  N I  +  DI NL +L  L+ +   +K LP EI     L  L L  N +  IP  LA   +L+ L++   ++    +S + SL++   +    ++   F L     P+    + ++ ME  +IN   F  F ++K L +L++  N    +P       ++  L+L+ N L  I +D+  L +L  L L  N ++K+   L  ++ L+ LDL  NK++ L   + Y  K L+ L + +N +  +P  I +L  L +L +  N ++ LP ++  ++N++
Sbjct:   92 KELNKCREENSMRLDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSEN--------SLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSL---TLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYL-KDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLE 474          

HSP 2 Score: 55.4546 bits (132), Expect = 4.613e-7
Identity = 58/218 (26.61%), Postives = 98/218 (44.95%), Query Frame = 3
Query:  216 SINLSNTALTVVPVTLFKRIEI-THLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWL------------------NAQHCGLKT-----LPQEIVGCEKLETLLLYGNV-IQTIPYLLADIGSLKTLSIN---LRHLGEKIDSNMESLL 785
            S+N+ +  +  +P  +F R ++ + LN+ +N + SLP D     ++  LN++ N         +T +P+ +  L  L+ L +S   L  +P  +  +  L +LD+ +N +  L ++I  L  LQ L                  N  H GL       LP+EI   E LE L L  N  + ++P+ LA    L  +SI    L HL  +I +   S +
Sbjct:  313 SLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATN--------QLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFI 522          
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: LRRC7 (leucine rich repeat containing 7 [Source:HGNC Symbol;Acc:HGNC:18531])

HSP 1 Score: 82.4185 bits (202), Expect = 3.884e-15
Identity = 82/321 (25.55%), Postives = 144/321 (44.86%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQS-----KALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            I  S   ++ +P    + + +T L +++  ++ LPA+   LV L +L +  N         +  LPKSM  L  L+ L++       +P  + +I +L +L +  N +  L   IG L  L +L+     ++T+  +I GCE LE LLL  N++Q +P  +  +  L TL         K+D N  ++L           NTI +L  ++  +   C  N  +S  S      +L  L +  NF  E+P  + +                         N+T + L+ N++E + + + QM+ L+VL+LS N++K L  S 
Sbjct:  125 IEASVNPISKLPDGFTQLLNLTQLYLNDAFLEFLPANFGRLVKLRILELREN--------HLKTLPKSMHKLAQLERLDLGNNEFGELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTL---------KVDDNQLTML----------PNTIGNLSLLEEFD---CSCNELESLPSTIGYLHSLRTLAVDENFLPELPREIGSCK-----------------------NVTVMSLRSNKLEFLPEEIGQMQKLRVLNLSDNRLKNLPFSF 392          
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: LRRC7 (leucine rich repeat containing 7 [Source:HGNC Symbol;Acc:HGNC:18531])

HSP 1 Score: 82.0333 bits (201), Expect = 4.672e-15
Identity = 82/321 (25.55%), Postives = 144/321 (44.86%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQS-----KALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            I  S   ++ +P    + + +T L +++  ++ LPA+   LV L +L +  N         +  LPKSM  L  L+ L++       +P  + +I +L +L +  N +  L   IG L  L +L+     ++T+  +I GCE LE LLL  N++Q +P  +  +  L TL         K+D N  ++L           NTI +L  ++  +   C  N  +S  S      +L  L +  NF  E+P  + +                         N+T + L+ N++E + + + QM+ L+VL+LS N++K L  S 
Sbjct:  158 IEASVNPISKLPDGFTQLLNLTQLYLNDAFLEFLPANFGRLVKLRILELREN--------HLKTLPKSMHKLAQLERLDLGNNEFGELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTL---------KVDDNQLTML----------PNTIGNLSLLEEFD---CSCNELESLPSTIGYLHSLRTLAVDENFLPELPREIGSCK-----------------------NVTVMSLRSNKLEFLPEEIGQMQKLRVLNLSDNRLKNLPFSF 425          
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: LRRIQ4 (leucine rich repeats and IQ motif containing 4 [Source:HGNC Symbol;Acc:HGNC:34298])

HSP 1 Score: 80.8777 bits (198), Expect = 5.145e-15
Identity = 99/428 (23.13%), Postives = 190/428 (44.39%), Query Frame = 3
Query:  210 FKSINLSNTALTVVPVTLFKRIE-ITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESL--LQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSK-----ALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTL---YLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQKTK 1460
             + + L  T L  +PV +FK +  +  L ++ N++K LP +I +   L  + + RN F         + P+ +  L  L+ +++ E  +  IP  I  +T L +  ++ NN+  L + +    QL  L+  H  L ++P+      K+  + L GN ++ +P L+    SL  L +    L  ++  +   L  L+   +  +H+ +    + A++ +E+     N      S+      L  L ++GN F   PE VL+L +L+ L + ++    +      +  L +L   Y++ N +E +  SL  M +L+VLD  HN +K+L  ++                           + L+ L +  N ++ LP +L  + N+K            L +  NP+E PPK V    N + I+ +L++ +
Sbjct:  120 LRELRLYQTDLKEIPVVIFKNLHHLELLGLTGNHLKCLPKEIVNQTKLREIYLKRNQFE--------VFPQELCVLYTLEIIDLDENKIGAIPEEIGHLTGLQKFYMASNNLPVLPASLCQCSQLSVLDLSHNLLHSIPKSFAELRKMTEIGLSGNRLEKVPRLICRWTSLHLLYLGNTGL-HRLRGSFRCLVNLRFLDLSQNHLHHCPLQICALKNLEVLGLDDNKIGQLPSELGSLSKLKILGLTGNEFLSFPEEVLSLASLEKLYIGQDQGFKLTYVPEHIRKLQSLKELYIENNHLEYLPVSLGSMPNLEVLDCRHNLLKQLPDAI------------------------CQAQALKELRLEDNLLTHLPENLDSLVNLKV-----------LTLMDNPMEEPPKEVCAEGN-EAIWKYLKENR 502          
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: ERBIN (erbb2 interacting protein [Source:HGNC Symbol;Acc:HGNC:15842])

HSP 1 Score: 80.1073 bits (196), Expect = 1.078e-14
Identity = 53/166 (31.93%), Postives = 92/166 (55.42%), Query Frame = 3
Query:  240 LTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN 737
            LT +P  +    ++T+L+VS+NNI+ +   IS   NL+ L +S N         +  LP+++ +LK +  L I E  L+++P +I  + S+ +LD S N +  L S IG L  L+   A H  L+ LP EI   + +  L L+ N ++T+P  + D+  LK ++++
Sbjct:  219 LTFIPGFIGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLLLSSN--------SLQQLPETIGSLKNITTLKIDENQLMYLPDSIGGLISVEELDCSFNEVEALPSSIGQLTNLRTFAADHNYLQQLPPEIGSWKNITVLFLHSNKLETLPEEMGDMQKLKVINLS 376          

HSP 2 Score: 75.485 bits (184), Expect = 3.065e-13
Identity = 73/318 (22.96%), Postives = 145/318 (45.60%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKS--FQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            +  S   ++ +P    + + +T L +++  ++ LPA+   L  L++L +  N         + +LPK+M  L  L+ L++       +P  + +++ L +  +  N +  +   IG+L QL +L+     ++ + + I  CE L+ LLL  N +Q +P     IGSLK ++        KID N        Q++  ++ ++I  L +V+ ++  F ++    S   Q   L       N+ Q++P  + +                         N+T L+L  N++E + + +  M+ LKV++LS N++K L  S 
Sbjct:  120 VEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELREN--------QLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFIPGFIGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLLLSSNSLQQLP---ETIGSLKNITT------LKIDEN--------QLM--YLPDSIGGLISVEELDCSFNEVEALPSSIGQLTNLRTFAADHNYLQQLPPEIGSWK-----------------------NITVLFLHSNKLETLPEEMGDMQKLKVINLSDNRLKNLPFSF 387          
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Match: let-413 (pep chromosome:WBcel235:V:7972924:7977774:-1 gene:WBGene00002632.1 transcript:F26D11.11a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-413)

HSP 1 Score: 85.1149 bits (209), Expect = 1.285e-16
Identity = 100/369 (27.10%), Postives = 180/369 (48.78%), Query Frame = 3
Query:  216 SINLSNTALTVVPVTLFKRIEITHLNVSENNIKSL-----------------------PADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDS----NM---------------ESLLQSGQILSDHIS-NTIFDLPA----VQAVEMEFCKINYFKSFQS-----KALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            SI+ S + L  +P  +F+  ++  LN++ NNIK L                       PA+I +L  L  LN++RN         +  LP +M+N K L  LN+S      +P TI E +S+  L +++ ++  L S+IG+L  L+ L A+   L+T+P  IV   KLE L L  N ++ +P  +  + SL+   +++  L    DS     M               E+L +   +   +IS N I +LP+    ++ ++M     N   +  S     ++L EL++  NF  ++P+T+ +L  L  L++  N L +I D +   ++LT L L+ N + ++  ++ + ++L VLD++ NK+  L  ++
Sbjct:   17 SIDRSQSNLQAIPSDIFRFRKLEDLNLTMNNIKELDHRLFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNS--------IAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTV 377          

HSP 2 Score: 56.6102 bits (135), Expect = 8.334e-8
Identity = 54/218 (24.77%), Postives = 98/218 (44.95%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHIS---NTIFDLPAVQAVEME 863
            +++S   +  +P  L +   +T LN+S N I  LP+   +L  L++L   RN  H         L   +   + L  L + +  L  +P TI ++  L  L++  NN+ ++   IGN   L  L+ +   L  LP  I  CE L  L +  N +  +P+ +  +  L+ L ++        ++  +S+L+  +   D       T + LP V A++ E
Sbjct:  225 LDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHN--------LTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTVKVLYKLQALWLS--------ENQTQSILKLSETRDDRKGIKVVTCYLLPQVDAIDGE 426          

HSP 3 Score: 55.0694 bits (131), Expect = 2.425e-7
Identity = 88/348 (25.29%), Postives = 169/348 (48.56%), Query Frame = 3
Query:  276 EITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESL-----LQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSK--ALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELP 1298
            ++  ++ S++N++++P+DI     LE LN++                  M N+K L +              ++ +  L  LD+S N +  L ++IGNL QL  LN     +  LP  +  C+ L TL L  N    +P  + +  S+  LS+N   L   + SN+ SL     L++   L   I  +I +L  ++ +++   ++    +   K  +L E ++  N    +P+++     L  LD+S+N ++ + ++L ++ NLT L +  N+I ++  S  ++K L++L    N +  LT  +    +SL  L +  N + ++P+ I  L +L  L+V  NN+S++P
Sbjct:   14 QVDSIDRSQSNLQAIPSDIFRFRKLEDLNLT------------------MNNIKELDH-------------RLFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSL-TLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKC-QSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIP 328          
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Match: let-413 (pep chromosome:WBcel235:V:7972934:7977774:-1 gene:WBGene00002632.1 transcript:F26D11.11b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-413)

HSP 1 Score: 84.7297 bits (208), Expect = 1.562e-16
Identity = 94/331 (28.40%), Postives = 169/331 (51.06%), Query Frame = 3
Query:  261 LFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDS----NM---------------ESLLQSGQILSDHIS-NTIFDLPA----VQAVEMEFCKINYFKSFQS-----KALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            LF    +  L+VS+N +  LPA+I +L  L  LN++RN         +  LP +M+N K L  LN+S      +P TI E +S+  L +++ ++  L S+IG+L  L+ L A+   L+T+P  IV   KLE L L  N ++ +P  +  + SL+   +++  L    DS     M               E+L +   +   +IS N I +LP+    ++ ++M     N   +  S     ++L EL++  NF  ++P+T+ +L  L  L++  N L +I D +   ++LT L L+ N + ++  ++ + ++L VLD++ NK+  L  ++
Sbjct:   55 LFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNS--------IAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTV 377          

HSP 2 Score: 56.6102 bits (135), Expect = 8.671e-8
Identity = 45/170 (26.47%), Postives = 78/170 (45.88%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTL 728
            +++S   +  +P  L +   +T LN+S N I  LP+   +L  L++L   RN  H         L   +   + L  L + +  L  +P TI ++  L  L++  NN+ ++   IGN   L  L+ +   L  LP  I  CE L  L +  N +  +P+ +  +  L+ L
Sbjct:  225 LDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHN--------LTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTVKVLYKLQAL 386          

HSP 3 Score: 54.6842 bits (130), Expect = 3.042e-7
Identity = 88/348 (25.29%), Postives = 169/348 (48.56%), Query Frame = 3
Query:  276 EITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESL-----LQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSK--ALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELP 1298
            ++  ++ S++N++++P+DI     LE LN++                  M N+K L +              ++ +  L  LD+S N +  L ++IGNL QL  LN     +  LP  +  C+ L TL L  N    +P  + +  S+  LS+N   L   + SN+ SL     L++   L   I  +I +L  ++ +++   ++    +   K  +L E ++  N    +P+++     L  LD+S+N ++ + ++L ++ NLT L +  N+I ++  S  ++K L++L    N +  LT  +    +SL  L +  N + ++P+ I  L +L  L+V  NN+S++P
Sbjct:   14 QVDSIDRSQSNLQAIPSDIFRFRKLEDLNLT------------------MNNIKELDH-------------RLFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSL-TLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKC-QSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIP 328          
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Match: Y42G9A.3 (pep chromosome:WBcel235:III:6146214:6148065:1 gene:WBGene00021533.1 transcript:Y42G9A.3b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y42G9A.3)

HSP 1 Score: 67.3958 bits (163), Expect = 8.387e-12
Identity = 68/242 (28.10%), Postives = 121/242 (50.00%), Query Frame = 3
Query:  201 EDDF-----KSINLSNTALTVV-PVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN---LRHLGEKIDSNMESL----LQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFK 887
            E+D+     K ++L++ +  ++  +T F  + +  L+VS N++ +LP DI  L +L  L I+RN         +  LPK ++ L+ L++L +S   L ++P  I  +  L  L +  N I    S+I  L  L+ L      L+ +P  I   ++LE L L  N+++TIP  L D+  L+TLS++   LR L   I  N+  L    L++  ++   + N     P+++ +     + NY K
Sbjct:   55 EEDYDPQNVKKLDLTHNSFVILRGLTTFNNVSV--LDVSFNSLSALPEDIGTLSSLTTL-IARNNL-------LEHLPKGLQLLENLEHLYLSGNRLEYVPPVILTMRKLKTLHLGGNYIDSCPSNISVLTLLRVLYLGGNRLREIPASIGCLDELENLGLCDNILETIPSTLGDLHYLETLSLHNNRLRTLPTDI-LNLRRLQQLSLRNNPLVHSFVHNMDLAPPSLKELSGRTVRQNYHK 285          
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Match: Y42G9A.3 (pep chromosome:WBcel235:III:6146266:6148065:1 gene:WBGene00021533.1 transcript:Y42G9A.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y42G9A.3)

HSP 1 Score: 67.3958 bits (163), Expect = 8.387e-12
Identity = 68/242 (28.10%), Postives = 121/242 (50.00%), Query Frame = 3
Query:  201 EDDF-----KSINLSNTALTVV-PVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN---LRHLGEKIDSNMESL----LQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFK 887
            E+D+     K ++L++ +  ++  +T F  + +  L+VS N++ +LP DI  L +L  L I+RN         +  LPK ++ L+ L++L +S   L ++P  I  +  L  L +  N I    S+I  L  L+ L      L+ +P  I   ++LE L L  N+++TIP  L D+  L+TLS++   LR L   I  N+  L    L++  ++   + N     P+++ +     + NY K
Sbjct:   55 EEDYDPQNVKKLDLTHNSFVILRGLTTFNNVSV--LDVSFNSLSALPEDIGTLSSLTTL-IARNNL-------LEHLPKGLQLLENLEHLYLSGNRLEYVPPVILTMRKLKTLHLGGNYIDSCPSNISVLTLLRVLYLGGNRLREIPASIGCLDELENLGLCDNILETIPSTLGDLHYLETLSLHNNRLRTLPTDI-LNLRRLQQLSLRNNPLVHSFVHNMDLAPPSLKELSGRTVRQNYHK 285          
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Match: Y42G9A.3 (pep chromosome:WBcel235:III:6146214:6148065:1 gene:WBGene00021533.1 transcript:Y42G9A.3a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y42G9A.3)

HSP 1 Score: 67.0106 bits (162), Expect = 2.353e-11
Identity = 68/242 (28.10%), Postives = 121/242 (50.00%), Query Frame = 3
Query:  201 EDDF-----KSINLSNTALTVV-PVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN---LRHLGEKIDSNMESL----LQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFK 887
            E+D+     K ++L++ +  ++  +T F  + +  L+VS N++ +LP DI  L +L  L I+RN         +  LPK ++ L+ L++L +S   L ++P  I  +  L  L +  N I    S+I  L  L+ L      L+ +P  I   ++LE L L  N+++TIP  L D+  L+TLS++   LR L   I  N+  L    L++  ++   + N     P+++ +     + NY K
Sbjct:   55 EEDYDPQNVKKLDLTHNSFVILRGLTTFNNVSV--LDVSFNSLSALPEDIGTLSSLTTL-IARNNL-------LEHLPKGLQLLENLEHLYLSGNRLEYVPPVILTMRKLKTLHLGGNYIDSCPSNISVLTLLRVLYLGGNRLREIPASIGCLDELENLGLCDNILETIPSTLGDLHYLETLSLHNNRLRTLPTDI-LNLRRLQQLSLRNNPLVHSFVHNMDLAPPSLKELSGRTVRQNYHK 285          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0335521)

HSP 1 Score: 74.7146 bits (182), Expect = 3.905e-13
Identity = 86/359 (23.96%), Postives = 153/359 (42.62%), Query Frame = 3
Query:  249 VPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNI 1325
            +P   F+   +  L +S+N I  LP DI +  NL  L++SRN        D+  +P  +K+L+ L+  + S   +  +P+   ++ +L  L ++  ++  L +D G+L QL+ L  +   LK LP+ I    KL+ L L  N I+ +P  L  +  L  L +                        DH  N +  LP    +     K+ Y           L +S N  +E+P  +  L                        +LT L L  N +E +   + ++  L +L L  N++++L  +L    ++++ L +  N +  +P  I  + KL NL+V  N +  LPL++    N+
Sbjct:   52 LPKNFFRLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRN--------DIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWL------------------------DH--NQLQRLPPELGL---LTKLTY-----------LDVSENRLEELPNEISGL-----------------------VSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNC-ENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANL 338          

HSP 2 Score: 71.2478 bits (173), Expect = 4.536e-12
Identity = 51/178 (28.65%), Postives = 92/178 (51.69%), Query Frame = 3
Query:  225 LSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPK----------------SMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADI 710
            L +  L  +P  L    ++T+L+VSEN ++ LP +IS LV+L  L++++N      PD +  L +                ++ N + ++ L ++E  L  +PA+I ++T L+ L++ +N +  L  +IG    L  L+ +   LK LP E+  C  L  L + GN +  +PY L ++
Sbjct:  205 LDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEAL-PDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL 381          

HSP 3 Score: 71.2478 bits (173), Expect = 5.149e-12
Identity = 77/327 (23.55%), Postives = 144/327 (44.04%), Query Frame = 3
Query:  204 DDFKSI------NLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            DD K +      + S+  +  +P    +   +T L +++ ++ +LPAD   L  LE L +  N         +  LP+++  L  LK L++ +  +  +P  +  +  LH+L +  N +  L  ++G L +L +L+     L+ LP EI G   L  L L  N+++ +P  +A +  L  L ++   L               Q L+D + N                          + + EL ++ NF  E+P ++  +  L  L++ +N L  +  ++ +  NL  L L+ N+++K+   L     L VLD+S N++  L  SL
Sbjct:  100 DDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELREN--------LLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRL---------------QRLNDTLGNC-------------------------ENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSL 378          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308630)

HSP 1 Score: 74.7146 bits (182), Expect = 3.930e-13
Identity = 86/359 (23.96%), Postives = 153/359 (42.62%), Query Frame = 3
Query:  249 VPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNI 1325
            +P   F+   +  L +S+N I  LP DI +  NL  L++SRN        D+  +P  +K+L+ L+  + S   +  +P+   ++ +L  L ++  ++  L +D G+L QL+ L  +   LK LP+ I    KL+ L L  N I+ +P  L  +  L  L +                        DH  N +  LP    +     K+ Y           L +S N  +E+P  +  L                        +LT L L  N +E +   + ++  L +L L  N++++L  +L    ++++ L +  N +  +P  I  + KL NL+V  N +  LPL++    N+
Sbjct:   52 LPKNFFRLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRN--------DIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWL------------------------DH--NQLQRLPPELGL---LTKLTY-----------LDVSENRLEELPNEISGL-----------------------VSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNC-ENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANL 338          

HSP 2 Score: 71.2478 bits (173), Expect = 4.562e-12
Identity = 51/178 (28.65%), Postives = 92/178 (51.69%), Query Frame = 3
Query:  225 LSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPK----------------SMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADI 710
            L +  L  +P  L    ++T+L+VSEN ++ LP +IS LV+L  L++++N      PD +  L +                ++ N + ++ L ++E  L  +PA+I ++T L+ L++ +N +  L  +IG    L  L+ +   LK LP E+  C  L  L + GN +  +PY L ++
Sbjct:  205 LDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEAL-PDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL 381          

HSP 3 Score: 71.2478 bits (173), Expect = 5.179e-12
Identity = 77/327 (23.55%), Postives = 144/327 (44.04%), Query Frame = 3
Query:  204 DDFKSI------NLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            DD K +      + S+  +  +P    +   +T L +++ ++ +LPAD   L  LE L +  N         +  LP+++  L  LK L++ +  +  +P  +  +  LH+L +  N +  L  ++G L +L +L+     L+ LP EI G   L  L L  N+++ +P  +A +  L  L ++   L               Q L+D + N                          + + EL ++ NF  E+P ++  +  L  L++ +N L  +  ++ +  NL  L L+ N+++K+   L     L VLD+S N++  L  SL
Sbjct:  100 DDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELREN--------LLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRL---------------QRLNDTLGNC-------------------------ENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSL 378          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308634)

HSP 1 Score: 74.7146 bits (182), Expect = 3.992e-13
Identity = 86/359 (23.96%), Postives = 153/359 (42.62%), Query Frame = 3
Query:  249 VPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNI 1325
            +P   F+   +  L +S+N I  LP DI +  NL  L++SRN        D+  +P  +K+L+ L+  + S   +  +P+   ++ +L  L ++  ++  L +D G+L QL+ L  +   LK LP+ I    KL+ L L  N I+ +P  L  +  L  L +                        DH  N +  LP    +     K+ Y           L +S N  +E+P  +  L                        +LT L L  N +E +   + ++  L +L L  N++++L  +L    ++++ L +  N +  +P  I  + KL NL+V  N +  LPL++    N+
Sbjct:   52 LPKNFFRLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRN--------DIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWL------------------------DH--NQLQRLPPELGL---LTKLTY-----------LDVSENRLEELPNEISGL-----------------------VSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNC-ENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANL 338          

HSP 2 Score: 71.2478 bits (173), Expect = 4.686e-12
Identity = 51/178 (28.65%), Postives = 92/178 (51.69%), Query Frame = 3
Query:  225 LSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPK----------------SMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADI 710
            L +  L  +P  L    ++T+L+VSEN ++ LP +IS LV+L  L++++N      PD +  L +                ++ N + ++ L ++E  L  +PA+I ++T L+ L++ +N +  L  +IG    L  L+ +   LK LP E+  C  L  L + GN +  +PY L ++
Sbjct:  205 LDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEAL-PDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL 381          

HSP 3 Score: 71.2478 bits (173), Expect = 5.143e-12
Identity = 77/327 (23.55%), Postives = 144/327 (44.04%), Query Frame = 3
Query:  204 DDFKSI------NLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            DD K +      + S+  +  +P    +   +T L +++ ++ +LPAD   L  LE L +  N         +  LP+++  L  LK L++ +  +  +P  +  +  LH+L +  N +  L  ++G L +L +L+     L+ LP EI G   L  L L  N+++ +P  +A +  L  L ++   L               Q L+D + N                          + + EL ++ NF  E+P ++  +  L  L++ +N L  +  ++ +  NL  L L+ N+++K+   L     L VLD+S N++  L  SL
Sbjct:  100 DDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENL--------LKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRL---------------QRLNDTLGNC-------------------------ENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSL 378          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308622)

HSP 1 Score: 74.7146 bits (182), Expect = 4.125e-13
Identity = 86/359 (23.96%), Postives = 153/359 (42.62%), Query Frame = 3
Query:  249 VPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNI 1325
            +P   F+   +  L +S+N I  LP DI +  NL  L++SRN        D+  +P  +K+L+ L+  + S   +  +P+   ++ +L  L ++  ++  L +D G+L QL+ L  +   LK LP+ I    KL+ L L  N I+ +P  L  +  L  L +                        DH  N +  LP    +     K+ Y           L +S N  +E+P  +  L                        +LT L L  N +E +   + ++  L +L L  N++++L  +L    ++++ L +  N +  +P  I  + KL NL+V  N +  LPL++    N+
Sbjct:   52 LPKNFFRLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRN--------DIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWL------------------------DH--NQLQRLPPELGL---LTKLTY-----------LDVSENRLEELPNEISGL-----------------------VSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNC-ENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANL 338          

HSP 2 Score: 71.2478 bits (173), Expect = 4.721e-12
Identity = 51/178 (28.65%), Postives = 92/178 (51.69%), Query Frame = 3
Query:  225 LSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPK----------------SMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADI 710
            L +  L  +P  L    ++T+L+VSEN ++ LP +IS LV+L  L++++N      PD +  L +                ++ N + ++ L ++E  L  +PA+I ++T L+ L++ +N +  L  +IG    L  L+ +   LK LP E+  C  L  L + GN +  +PY L ++
Sbjct:  205 LDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEAL-PDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL 381          

HSP 3 Score: 71.2478 bits (173), Expect = 5.009e-12
Identity = 77/327 (23.55%), Postives = 144/327 (44.04%), Query Frame = 3
Query:  204 DDFKSI------NLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            DD K +      + S+  +  +P    +   +T L +++ ++ +LPAD   L  LE L +  N         +  LP+++  L  LK L++ +  +  +P  +  +  LH+L +  N +  L  ++G L +L +L+     L+ LP EI G   L  L L  N+++ +P  +A +  L  L ++   L               Q L+D + N                          + + EL ++ NF  E+P ++  +  L  L++ +N L  +  ++ +  NL  L L+ N+++K+   L     L VLD+S N++  L  SL
Sbjct:  100 DDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELREN--------LLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRL---------------QRLNDTLGN-------------------------CENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSL 378          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308628)

HSP 1 Score: 74.7146 bits (182), Expect = 4.545e-13
Identity = 86/359 (23.96%), Postives = 153/359 (42.62%), Query Frame = 3
Query:  249 VPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNI 1325
            +P   F+   +  L +S+N I  LP DI +  NL  L++SRN        D+  +P  +K+L+ L+  + S   +  +P+   ++ +L  L ++  ++  L +D G+L QL+ L  +   LK LP+ I    KL+ L L  N I+ +P  L  +  L  L +                        DH  N +  LP    +     K+ Y           L +S N  +E+P  +  L                        +LT L L  N +E +   + ++  L +L L  N++++L  +L    ++++ L +  N +  +P  I  + KL NL+V  N +  LPL++    N+
Sbjct:   52 LPKNFFRLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRN--------DIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWL------------------------DH--NQLQRLPPELGL---LTKLTY-----------LDVSENRLEELPNEISGL-----------------------VSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNC-ENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANL 338          

HSP 2 Score: 71.2478 bits (173), Expect = 5.187e-12
Identity = 51/178 (28.65%), Postives = 92/178 (51.69%), Query Frame = 3
Query:  225 LSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPK----------------SMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADI 710
            L +  L  +P  L    ++T+L+VSEN ++ LP +IS LV+L  L++++N      PD +  L +                ++ N + ++ L ++E  L  +PA+I ++T L+ L++ +N +  L  +IG    L  L+ +   LK LP E+  C  L  L + GN +  +PY L ++
Sbjct:  205 LDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEAL-PDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL 381          

HSP 3 Score: 71.2478 bits (173), Expect = 5.550e-12
Identity = 77/327 (23.55%), Postives = 144/327 (44.04%), Query Frame = 3
Query:  204 DDFKSI------NLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            DD K +      + S+  +  +P    +   +T L +++ ++ +LPAD   L  LE L +  N         +  LP+++  L  LK L++ +  +  +P  +  +  LH+L +  N +  L  ++G L +L +L+     L+ LP EI G   L  L L  N+++ +P  +A +  L  L ++   L               Q L+D + N                          + + EL ++ NF  E+P ++  +  L  L++ +N L  +  ++ +  NL  L L+ N+++K+   L     L VLD+S N++  L  SL
Sbjct:  100 DDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELREN--------LLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRL---------------QRLNDTLGN-------------------------CENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSL 378          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: lrrc7 (leucine rich repeat containing 7 [Source:ZFIN;Acc:ZDB-GENE-130530-876])

HSP 1 Score: 83.9593 bits (206), Expect = 8.112e-16
Identity = 92/367 (25.07%), Postives = 150/367 (40.87%), Query Frame = 3
Query:  249 VPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFH----------CTS------------PDDMT----------------ILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGEL------------------RSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILS-----DHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            +P  LF    +  L++ +N++ +LP  I+ LVNL+ L+IS+NG            C S            P+  T                 LP +   L  L+ L + E +L  +P +I  ++ L +LD+  N   EL                  R  IG L QL++L+     +++L  +I GCE LE LLL  N++Q +P  +  +  L TL ++        D+ + SL  +   LS     D   N +  LP           I Y  S ++ A  E     NF  ++P  + N                         N+T + L+ N++E +   + QM  L+VL+LS N++K L  + 
Sbjct:   61 LPKQLFNCQALKKLSMPDNDLSNLPTTIASLVNLKELDISKNGIQEFPDNIKCCKCLSVVEASVNPIAKLPEGFTQLLNLTQLFLNDAFLEYLPANFGRLSKLRILELRENHLKTMPKSIHRLSQLERLDLGSNEFSELVRKMLSSVSALSMDFGFSRESIGKLRQLRYLDLAKNRIESLDADISGCESLEDLLLSANMLQQLPDSIGKLKKLTTLKVD--------DNQLTSLPNTIGSLSLLEEFDCSCNELESLPPT---------IGYLHSLRTFAADE-----NFLSDLPREIGNCR-----------------------NVTVMSLRSNKLEFLPDEIGQMTKLRVLNLSDNRLKNLPFTF 382          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: erbin (erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GENE-061103-403])

HSP 1 Score: 78.9518 bits (193), Expect = 1.445e-14
Identity = 74/290 (25.52%), Postives = 128/290 (44.14%), Query Frame = 3
Query:  318 LPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKS--FQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNK 1181
            LPA    L  L++L +  N         + +LPKSM  L  L+ L++       +P  + ++T + +L +  N +  +   IG L QL +L+     ++ + ++I GCE L+ LLL  N +  +P     IGSLK LS        K+D N        Q++  ++ +TI  L  +  ++  F +I    S   Q   L       N   ++P  + +L                        N+T L+L  N++E + + +  M+ LKV++LS NK++ L  S    N+
Sbjct:  137 LPASFGRLTKLQILELREN--------QLKMLPKSMHKLTQLERLDLGSNEFTEVPEVLEQLTGIRELWMDGNKLTFVPGMIGALKQLSYLDVSKNNVEMVEEQISGCENLQDLLLSNNALTQLP---GSIGSLKKLST------LKVDDN--------QLM--YLPDTIGGLSHLDELDCSFNEIEALPSSIGQCVNLRTFAADHNLLAQMPPEMGSLK-----------------------NVTVLFLHSNKLENLPEEMGDMQKLKVINLSDNKLRNLPYSFTKLNQ 376          

HSP 2 Score: 77.0258 bits (188), Expect = 5.469e-14
Identity = 54/178 (30.34%), Postives = 94/178 (52.81%), Query Frame = 3
Query:  225 LSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN---LRHL 749
            +    LT VP  +    ++++L+VS+NN++ +   IS   NL+ L +S N         +T LP S+ +LK L  L + +  L+++P TI  ++ L +LD S N I  L S IG    L+   A H  L  +P E+   + +  L L+ N ++ +P  + D+  LK ++++   LR+L
Sbjct:  198 MDGNKLTFVPGMIGALKQLSYLDVSKNNVEMVEEQISGCENLQDLLLSNNA--------LTQLPGSIGSLKKLSTLKVDDNQLMYLPDTIGGLSHLDELDCSFNEIEALPSSIGQCVNLRTFAADHNLLAQMPPEMGSLKNVTVLFLHSNKLENLPEEMGDMQKLKVINLSDNKLRNL 367          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: erbin (erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GENE-061103-403])

HSP 1 Score: 78.9518 bits (193), Expect = 1.445e-14
Identity = 74/290 (25.52%), Postives = 128/290 (44.14%), Query Frame = 3
Query:  318 LPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKS--FQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNK 1181
            LPA    L  L++L +  N         + +LPKSM  L  L+ L++       +P  + ++T + +L +  N +  +   IG L QL +L+     ++ + ++I GCE L+ LLL  N +  +P     IGSLK LS        K+D N        Q++  ++ +TI  L  +  ++  F +I    S   Q   L       N   ++P  + +L                        N+T L+L  N++E + + +  M+ LKV++LS NK++ L  S    N+
Sbjct:  137 LPASFGRLTKLQILELREN--------QLKMLPKSMHKLTQLERLDLGSNEFTEVPEVLEQLTGIRELWMDGNKLTFVPGMIGALKQLSYLDVSKNNVEMVEEQISGCENLQDLLLSNNALTQLP---GSIGSLKKLST------LKVDDN--------QLM--YLPDTIGGLSHLDELDCSFNEIEALPSSIGQCVNLRTFAADHNLLAQMPPEMGSLK-----------------------NVTVLFLHSNKLENLPEEMGDMQKLKVINLSDNKLRNLPYSFTKLNQ 376          

HSP 2 Score: 77.0258 bits (188), Expect = 5.469e-14
Identity = 54/178 (30.34%), Postives = 94/178 (52.81%), Query Frame = 3
Query:  225 LSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN---LRHL 749
            +    LT VP  +    ++++L+VS+NN++ +   IS   NL+ L +S N         +T LP S+ +LK L  L + +  L+++P TI  ++ L +LD S N I  L S IG    L+   A H  L  +P E+   + +  L L+ N ++ +P  + D+  LK ++++   LR+L
Sbjct:  198 MDGNKLTFVPGMIGALKQLSYLDVSKNNVEMVEEQISGCENLQDLLLSNNA--------LTQLPGSIGSLKKLSTLKVDDNQLMYLPDTIGGLSHLDELDCSFNEIEALPSSIGQCVNLRTFAADHNLLAQMPPEMGSLKNVTVLFLHSNKLENLPEEMGDMQKLKVINLSDNKLRNL 367          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: erbin (erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GENE-061103-403])

HSP 1 Score: 78.9518 bits (193), Expect = 1.519e-14
Identity = 74/290 (25.52%), Postives = 128/290 (44.14%), Query Frame = 3
Query:  318 LPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKS--FQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNK 1181
            LPA    L  L++L +  N         + +LPKSM  L  L+ L++       +P  + ++T + +L +  N +  +   IG L QL +L+     ++ + ++I GCE L+ LLL  N +  +P     IGSLK LS        K+D N        Q++  ++ +TI  L  +  ++  F +I    S   Q   L       N   ++P  + +L N+                       T L+L  N++E + + +  M+ LKV++LS NK++ L  S    N+
Sbjct:  153 LPASFGRLTKLQILELREN--------QLKMLPKSMHKLTQLERLDLGSNEFTEVPEVLEQLTGIRELWMDGNKLTFVPGMIGALKQLSYLDVSKNNVEMVEEQISGCENLQDLLLSNNALTQLP---GSIGSLKKLST------LKVDDN--------QLM--YLPDTIGGLSHLDELDCSFNEIEALPSSIGQCVNLRTFAADHNLLAQMPPEMGSLKNV-----------------------TVLFLHSNKLENLPEEMGDMQKLKVINLSDNKLRNLPYSFTKLNQ 392          

HSP 2 Score: 77.0258 bits (188), Expect = 5.592e-14
Identity = 54/178 (30.34%), Postives = 94/178 (52.81%), Query Frame = 3
Query:  225 LSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN---LRHL 749
            +    LT VP  +    ++++L+VS+NN++ +   IS   NL+ L +S N         +T LP S+ +LK L  L + +  L+++P TI  ++ L +LD S N I  L S IG    L+   A H  L  +P E+   + +  L L+ N ++ +P  + D+  LK ++++   LR+L
Sbjct:  214 MDGNKLTFVPGMIGALKQLSYLDVSKNNVEMVEEQISGCENLQDLLLSNNA--------LTQLPGSIGSLKKLSTLKVDDNQLMYLPDTIGGLSHLDELDCSFNEIEALPSSIGQCVNLRTFAADHNLLAQMPPEMGSLKNVTVLFLHSNKLENLPEEMGDMQKLKVINLSDNKLRNL 383          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: lrrc7 (leucine rich repeat containing 7 [Source:ZFIN;Acc:ZDB-GENE-130530-876])

HSP 1 Score: 78.5666 bits (192), Expect = 3.324e-14
Identity = 91/372 (24.46%), Postives = 149/372 (40.05%), Query Frame = 3
Query:  249 VPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFH----------CTS------------PDDMT----------------ILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGEL-----------------------RSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILS-----DHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            +P  LF    +  L++ +N++ +LP  I+ LVNL+ L+IS+NG            C S            P+  T                 LP +   L  L+ L + E +L  +P +I  ++ L +LD+  N   EL                          IG L QL++L+     +++L  +I GCE LE LLL  N++Q +P  +  +  L TL ++        D+ + SL  +   LS     D   N +  LP           I Y  S ++ A  E     NF  ++P  + N                         N+T + L+ N++E +   + QM  L+VL+LS N++K L  + 
Sbjct:   61 LPKQLFNCQALKKLSMPDNDLSNLPTTIASLVNLKELDISKNGIQEFPDNIKCCKCLSVVEASVNPIAKLPEGFTQLLNLTQLFLNDAFLEYLPANFGRLSKLRILELRENHLKTMPKSIHRLSQLERLDLGSNEFSELPEVLEQIHSLKELWLDNNSLQTIPGSIGKLRQLRYLDLAKNRIESLDADISGCESLEDLLLSANMLQQLPDSIGKLKKLTTLKVD--------DNQLTSLPNTIGSLSLLEEFDCSCNELESLPPT---------IGYLHSLRTFAADE-----NFLSDLPREIGNCR-----------------------NVTVMSLRSNKLEFLPDEIGQMTKLRVLNLSDNRLKNLPFTF 387          

HSP 2 Score: 57.7658 bits (138), Expect = 6.935e-8
Identity = 52/189 (27.51%), Postives = 89/189 (47.09%), Query Frame = 3
Query:  210 FKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPD----------------DMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTL 728
             K + L N +L  +P ++ K  ++ +L++++N I+SL ADIS   +LE L +S N      PD                 +T LP ++ +L  L+  + S   L  +P TI  + SL      +N + +L  +IGN   +  ++ +   L+ LP EI    KL  L L  N ++ +P+    +  L  L
Sbjct:  209 LKELWLDNNSLQTIPGSIGKLRQLRYLDLAKNRIESLDADISGCESLEDLLLSANMLQQL-PDSIGKLKKLTTLKVDDNQLTSLPNTIGSLSLLEEFDCSCNELESLPPTIGYLHSLRTFAADENFLSDLPREIGNCRNVTVMSLRSNKLEFLPDEIGQMTKLRVLNLSDNRLKNLPFTFTKLKDLAAL 396          

HSP 3 Score: 56.225 bits (134), Expect = 2.533e-7
Identity = 108/412 (26.21%), Postives = 181/412 (43.93%), Query Frame = 3
Query:  246 VVPVTLFKRIE--ITHLNVSENNIKSLPADI-SDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKT----AHYFNGLHR-IG-------LWVSSNPIEFPPKCVWNTTNIDVI 1436
            +VP   F+  E  I+ L+ S  +++ +P +I S    LE L +  N         +  LPK + N + LK L++ + +L  +P TI  + +L +LDISKN I E   +I     L  + A    +  LP+       L  L L    ++ +P     +  L+ L +   HL + +  ++  L Q  ++  D  SN   +LP V    +E          Q  +L EL +  N  Q IP ++  L  L+                        L L  N+IE +   +   +SL+ L LS N +++L  S+    K L TLK++ N + ++PN I  L  LE  D S N +  LP  +  + +++T     ++ + L R IG       + + SN +EF P  +   T + V+
Sbjct:   11 LVPCRCFRGEEEVISVLDYSHCSLQQVPKEIFSFERTLEELYLDAN--------QIEELPKQLFNCQALKKLSMPDNDLSNLPTTIASLVNLKELDISKNGIQEFPDNIKCCKCLSVVEASVNPIAKLPEGFTQLLNLTQLFLNDAFLEYLPANFGRLSKLRILELRENHL-KTMPKSIHRLSQLERL--DLGSNEFSELPEV----LE----------QIHSLKELWLDNNSLQTIPGSIGKLRQLRY-----------------------LDLAKNRIESLDADISGCESLEDLLLSANMLQQLPDSIGKLKK-LTTLKVDDNQLTSLPNTIGSLSLLEEFDCSCNELESLPPTIGYLHSLRTFAADENFLSDLPREIGNCRNVTVMSLRSNKLEFLPDEIGQMTKLRVL 373          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: LRRD1 (leucine-rich repeats and death domain containing 1 [Source:NCBI gene;Acc:100490254])

HSP 1 Score: 85.8853 bits (211), Expect = 1.747e-16
Identity = 105/388 (27.06%), Postives = 188/388 (48.45%), Query Frame = 3
Query:  225 LSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSI-------------NLRHLGE---------KIDSNMESLLQ------SGQILSDHISNTIFDLPAVQAVEMEFCKINYF--KSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELP 1298
            LSN  +T +P +L    ++  L++  N + SLP +I  L  L  LN++ N         + +LP  +  LK +K L  +   L  +P  + ++T+L  L IS N++  L     +L  L  LN     +  LP+ +    +L  L L GN I+++P  + D+ +L+ LS+             NL  L E          I   +++L Q      +  +L+D I+  +   PA++ +++   ++     K    + L ELHI  N  + +P+ + +LNNL ++  + N LL I  +L     +T L L GN++ ++ ++L  M SL  L+L+ N+I ++  S+  +N+ LE L+++ N +         L  L  LD+S N I+ +P
Sbjct:   69 LSNNFMTHLPTSLCHLSKLEILSLEGNALVSLPPEICSLSQLTALNVNHN--------QIAVLPHEISGLKNIKQLFANNNKLSQLPPCLGDLTTLQVLCISGNSMKTLPDSTASLKNLHVLNLDGNQISALPKAVFRLSQLVKLCLSGNQIKSLPKEIGDLKNLRELSLSSNQLTFLPVQLYNLTSLEELTLDDNKLTAISDKLQNLKQLKVLSIANNLLTD-ITEKVCWCPAIECLKLNGNQMYRLPTKIHNLRNLKELHIERNALEMLPDQLAHLNNLSVIVCANNNLLWIPIELKNCNQITKLDLSGNKLSEVPQALSSMTSLLYLNLNQNEIHEIANSI-IHNRKLEHLELSGNKLTVFSVHFCGLHNLAYLDLSRNEINSVP 446          

HSP 2 Score: 81.6481 bits (200), Expect = 4.169e-15
Identity = 117/434 (26.96%), Postives = 200/434 (46.08%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNG--------FHCTSPDDMTI-------LPKSMKNLKCLKYLNIS-----------------EC------NLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDS-----NMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENL---DVSSNNISELPLDLCLMKN-IKTAHYFNGLHRIGLWVSS 1379
            +NL    ++ +P  +F+  ++  L +S N IKSLP +I DL NL  L++S N         ++ TS +++T+       +   ++NLK LK L+I+                 EC       +  +P  I  + +L +L I +N +  L   + +L+ L  +   +  L  +P E+  C ++  L L GN +  +P  L+ + SL  L++N   + E  +S      +E L  SG  L      T+F         + FC ++         L  L +S N    +P  + NL +L  L L  N       +L  L++L  + L GNQIE +   +  ++ L+ ++LS+N  K     L +   SLETLKI+  + + + +    L KL+NL   ++S NNI  LP  +  MKN ++     N L+ +   +SS
Sbjct:  182 LNLDGNQISALPKAVFRLSQLVKLCLSGNQIKSLPKEIGDLKNLRELSLSSNQLTFLPVQLYNLTSLEELTLDDNKLTAISDKLQNLKQLKVLSIANNLLTDITEKVCWCPAIECLKLNGNQMYRLPTKIHNLRNLKELHIERNALEMLPDQLAHLNNLSVIVCANNNLLWIPIELKNCNQITKLDLSGNKLSEVPQALSSMTSLLYLNLNQNEIHEIANSIIHNRKLEHLELSGNKL------TVFS--------VHFCGLHN--------LAYLDLSRNEINSVPSAISNLESLSELLLHSNKFRRFPIELCALKSLQKIDLSGNQIETVPSGISLLEGLRYVNLSNNSFKVFPREL-FSVSSLETLKISQKDGRKLISLPDELSKLKNLKELEISDNNIKTLPGSIGEMKNLVQLTATSNQLYHLPASISS 592          

HSP 3 Score: 75.8702 bits (185), Expect = 2.180e-13
Identity = 99/395 (25.06%), Postives = 192/395 (48.61%), Query Frame = 3
Query:  207 DFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFH---------------CTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFN 1346
            + K +  +N  L+ +P  L     +  L +S N++K+LP   + L NL VLN+  N                  C S + +  LPK + +LK L+ L++S   L F+P  ++ +TSL +L +  N +  +   + NL QL+ L+  +  L  + +++  C  +E L L GN +  +P  + ++ +LK L I  R+  E +   +  L     I+  +  N +  +P    +E++ C            + +L +SGN   E+P+ + ++ +L  L+L++N +  I + +I    L  L L GN++   +     + +L  LDLS N+I  +  ++    +SL  L ++ N  +  P ++  L+ L+ +D+S N I  +P  + L++ ++  +  N
Sbjct:  132 NIKQLFANNNKLSQLPPCLGDLTTLQVLCISGNSMKTLPDSTASLKNLHVLNLDGNQISALPKAVFRLSQLVKLCLSGNQIKSLPKEIGDLKNLRELSLSSNQLTFLPVQLYNLTSLEELTLDDNKLTAISDKLQNLKQLKVLSIANNLLTDITEKVCWCPAIECLKLNGNQMYRLPTKIHNLRNLKELHIE-RNALEMLPDQLAHLNNLSVIVCAN--NNLLWIP----IELKNC----------NQITKLDLSGNKLSEVPQALSSMTSLLYLNLNQNEIHEIANSIIHNRKLEHLELSGNKLTVFSVHFCGLHNLAYLDLSRNEINSVPSAISNL-ESLSELLLHSNKFRRFPIELCALKSLQKIDLSGNQIETVPSGISLLEGLRYVNLSN 508          

HSP 4 Score: 65.4698 bits (158), Expect = 4.434e-10
Identity = 52/170 (30.59%), Postives = 84/170 (49.41%), Query Frame = 3
Query:  252 PVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFH--------CTSPDDMTI----------LPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLAD 707
            P+ L     +  +++S N I+++P+ IS L  L  +N+S N F          +S + + I          LP  +  LK LK L IS+ N+  +P +I E+ +L QL  + N +  L + I +L  LQ L+ +   L +LP +I G +KL  + L  N +   P LL D
Sbjct:  469 PIELCALKSLQKIDLSGNQIETVPSGISLLEGLRYVNLSNNSFKVFPRELFSVSSLETLKISQKDGRKLISLPDELSKLKNLKELEISDNNIKTLPGSIGEMKNLVQLTATSNQLYHLPASISSLAALQQLSLKGNQLTSLPSDISGLQKLREINLDSNPMLRPPSLLCD 638          

HSP 5 Score: 62.7734 bits (151), Expect = 2.488e-9
Identity = 89/359 (24.79%), Postives = 177/359 (49.30%), Query Frame = 3
Query:  279 ITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNT--------IFDLPAVQAVEMEFCKINYF--KSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNI 1325
            IT +N++   +  +P D+    NL+ L +S N         MT LP S+ +L  L+ L++    LV +P  I  ++ L  L+++ N I  L  +I  L  ++ L A +  L  LP  +     L+ L + GN ++T+P   A + +L  L+++    G +I +  +++ +  Q++   +S          I DL  ++ + +   ++ +   + +   +L EL +  N    I + + NL  L++L ++ NLL +I + +     +  L L GNQ+ ++   +  +++LK L +  N ++ L   L + N +L  +   +NN+  IP ++    ++  LD+S N +SE+P  L  M ++
Sbjct:   41 ITSINLNSKELTEIPPDVFRCTNLQCLLLSNNF--------MTHLPTSLCHLSKLEILSLEGNALVSLPPEICSLSQLTALNVNHNQIAVLPHEISGLKNIKQLFANNNKLSQLPPCLGDLTTLQVLCISGNSMKTLPDSTASLKNLHVLNLD----GNQISALPKAVFRLSQLVKLCLSGNQIKSLPKEIGDLKNLRELSLSSNQLTFLPVQLYNLTSLEELTLDDNKLTAISDKLQNLKQLKVLSIANNLLTDITEKVCWCPAIECLKLNGNQMYRLPTKIHNLRNLKELHIERNALEMLPDQLAHLN-NLSVIVCANNNLLWIPIELKNCNQITKLDLSGNKLSEVPQALSSMTSL 386          

HSP 6 Score: 58.9214 bits (141), Expect = 4.452e-8
Identity = 42/133 (31.58%), Postives = 68/133 (51.13%), Query Frame = 3
Query:  204 DDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIK---SLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLN 593
            +  + +NLSN +  V P  LF    +  L +S+ + +   SLP ++S L NL+ L IS N        ++  LP S+  +K L  L  +   L  +PA+I  + +L QL +  N +  L SDI  L +L+ +N
Sbjct:  499 EGLRYVNLSNNSFKVFPRELFSVSSLETLKISQKDGRKLISLPDELSKLKNLKELEISDN--------NIKTLPGSIGEMKNLVQLTATSNQLYHLPASISSLAALQQLSLKGNQLTSLPSDISGLQKLREIN 623          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: prrc2a (proline rich coiled-coil 2A [Source:Xenbase;Acc:XB-GENE-482976])

HSP 1 Score: 82.4185 bits (202), Expect = 3.265e-15
Identity = 84/343 (24.49%), Postives = 150/343 (43.73%), Query Frame = 3
Query:  249 VPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFH--------C-------TSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSD-----------------IGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKS-----FQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            +P  LF    +  L++ +N++  LPA I++L+NL  L++S+NG          C        S + ++ LP     L  L  L +++  L F+PA    +T L  L++ +N +  L +                  +GNL QL +L+     ++ +   I GCE L+ LLL  N IQ +P     IG+LK L+        K+D N        Q++  ++ ++I  L A++ ++  F +I    S      Q +     H   NF  ++P  +                          ++ T L+L  N++E + + +  M+ LKV++LS N+++ L  S 
Sbjct:   61 LPKQLFNCQSLHKLSLPDNDLTILPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLDFLPANFGRLTKLQILELRENQLKMLPNGLKEFWMDGNKLTYIPGFLGNLKQLTYLDVSKNNIEMVEDGISGCESLQDLLLSSNAIQQLP---ESIGALKKLTT------LKVDEN--------QLM--YLPDSIGGLTAIEDLDCSFNEIEALPSSIGHLIQIRTFAADH---NFLTQLPPEI-----------------------GTWKSATVLFLHSNKLESLPEEMGDMQKLKVINLSDNRLRNLPFSF 358          

HSP 2 Score: 78.5666 bits (192), Expect = 5.426e-14
Identity = 57/178 (32.02%), Postives = 95/178 (53.37%), Query Frame = 3
Query:  225 LSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN---LRHL 749
            +    LT +P  L    ++T+L+VS+NNI+ +   IS   +L+ L +S N            LP+S+  LK L  L + E  L+++P +I  +T++  LD S N I  L S IG+L Q++   A H  L  LP EI   +    L L+ N ++++P  + D+  LK ++++   LR+L
Sbjct:  185 MDGNKLTYIPGFLGNLKQLTYLDVSKNNIEMVEDGISGCESLQDLLLSSNAIQQ--------LPESIGALKKLTTLKVDENQLMYLPDSIGGLTAIEDLDCSFNEIEALPSSIGHLIQIRTFAADHNFLTQLPPEIGTWKSATVLFLHSNKLESLPEEMGDMQKLKVINLSDNRLRNL 354          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: prrc2a (proline rich coiled-coil 2A [Source:Xenbase;Acc:XB-GENE-482976])

HSP 1 Score: 80.1073 bits (196), Expect = 1.827e-14
Identity = 73/321 (22.74%), Postives = 143/321 (44.55%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKS-----FQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            +  S   ++ +P    + + +T L +++  +  LPA+   L  L++L +  N         + +LPK+M  L  L+ L++       +P  + +++ L +  +  N +  +   +GNL QL +L+     ++ +   I GCE L+ LLL  N IQ +P     IG+LK L+        K+D N        Q++  ++ ++I  L A++ ++  F +I    S      Q +     H   NF  ++P  +                          ++ T L+L  N++E + + +  M+ LKV++LS N+++ L  S 
Sbjct:  157 VEASVNPISKLPDGFSQLLNLTQLYLNDAFLDFLPANFGRLTKLQILELREN--------QLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGNKLTYIPGFLGNLKQLTYLDVSKNNIEMVEDGISGCESLQDLLLSSNAIQQLP---ESIGALKKLTT------LKVDEN--------QLM--YLPDSIGGLTAIEDLDCSFNEIEALPSSIGHLIQIRTFAADH---NFLTQLPPEI-----------------------GTWKSATVLFLHSNKLESLPEEMGDMQKLKVINLSDNRLRNLPFSF 424          

HSP 2 Score: 56.225 bits (134), Expect = 3.627e-7
Identity = 90/328 (27.44%), Postives = 139/328 (42.38%), Query Frame = 3
Query:  411 LPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKT-AHYFNGLHR----IGLWVSS 1379
            LPK + N + L  L++ + +L  +PA+I  + +L +LD+SKN I E   +I N   L  + A    +  LP        L  L L    +  +P     +  L+ L +    L + +   M  L Q  ++  D  SN   ++P V    +E          Q   L E  + GN    IP  + NL                         LT L +  N IE +   +   +SL+ L LS N I++L  S+    K L TLK++ N +  +P+ I  L  +E+LD S N I  LP  +  +  I+T A   N L +    IG W S+
Sbjct:   98 LPKQLFNCQSLHKLSLPDNDLTILPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLDFLPANFGRLTKLQILELRENQL-KMLPKTMNRLTQLERL--DLGSNEFTEVPEV----LE----------QLSGLKEFWMDGNKLTYIPGFLGNLK-----------------------QLTYLDVSKNNIEMVEDGISGCESLQDLLLSSNAIQQLPESIGAL-KKLTTLKVDENQLMYLPDSIGGLTAIEDLDCSFNEIEALPSSIGHLIQIRTFAADHNFLTQLPPEIGTWKSA 384          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: prrc2a (proline rich coiled-coil 2A [Source:Xenbase;Acc:XB-GENE-482976])

HSP 1 Score: 79.7221 bits (195), Expect = 2.087e-14
Identity = 73/321 (22.74%), Postives = 143/321 (44.55%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKS-----FQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            +  S   ++ +P    + + +T L +++  +  LPA+   L  L++L +  N         + +LPK+M  L  L+ L++       +P  + +++ L +  +  N +  +   +GNL QL +L+     ++ +   I GCE L+ LLL  N IQ +P     IG+LK L+        K+D N        Q++  ++ ++I  L A++ ++  F +I    S      Q +     H   NF  ++P  +                          ++ T L+L  N++E + + +  M+ LKV++LS N+++ L  S 
Sbjct:  157 VEASVNPISKLPDGFSQLLNLTQLYLNDAFLDFLPANFGRLTKLQILELREN--------QLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGNKLTYIPGFLGNLKQLTYLDVSKNNIEMVEDGISGCESLQDLLLSSNAIQQLP---ESIGALKKLTT------LKVDEN--------QLM--YLPDSIGGLTAIEDLDCSFNEIEALPSSIGHLIQIRTFAADH---NFLTQLPPEI-----------------------GTWKSATVLFLHSNKLESLPEEMGDMQKLKVINLSDNRLRNLPFSF 424          

HSP 2 Score: 55.8398 bits (133), Expect = 3.843e-7
Identity = 90/328 (27.44%), Postives = 139/328 (42.38%), Query Frame = 3
Query:  411 LPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKT-AHYFNGLHR----IGLWVSS 1379
            LPK + N + L  L++ + +L  +PA+I  + +L +LD+SKN I E   +I N   L  + A    +  LP        L  L L    +  +P     +  L+ L +    L + +   M  L Q  ++  D  SN   ++P V    +E          Q   L E  + GN    IP  + NL                         LT L +  N IE +   +   +SL+ L LS N I++L  S+    K L TLK++ N +  +P+ I  L  +E+LD S N I  LP  +  +  I+T A   N L +    IG W S+
Sbjct:   98 LPKQLFNCQSLHKLSLPDNDLTILPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLDFLPANFGRLTKLQILELRENQL-KMLPKTMNRLTQLERL--DLGSNEFTEVPEV----LE----------QLSGLKEFWMDGNKLTYIPGFLGNLK-----------------------QLTYLDVSKNNIEMVEDGISGCESLQDLLLSSNAIQQLPESIGAL-KKLTTLKVDENQLMYLPDSIGGLTAIEDLDCSFNEIEALPSSIGHLIQIRTFAADHNFLTQLPPEIGTWKSA 384          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: prrc2a (proline rich coiled-coil 2A [Source:Xenbase;Acc:XB-GENE-482976])

HSP 1 Score: 79.7221 bits (195), Expect = 2.192e-14
Identity = 73/321 (22.74%), Postives = 143/321 (44.55%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKS-----FQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            +  S   ++ +P    + + +T L +++  +  LPA+   L  L++L +  N         + +LPK+M  L  L+ L++       +P  + +++ L +  +  N +  +   +GNL QL +L+     ++ +   I GCE L+ LLL  N IQ +P     IG+LK L+        K+D N        Q++  ++ ++I  L A++ ++  F +I    S      Q +     H   NF  ++P  +                          ++ T L+L  N++E + + +  M+ LKV++LS N+++ L  S 
Sbjct:  157 VEASVNPISKLPDGFSQLLNLTQLYLNDAFLDFLPANFGRLTKLQILELREN--------QLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGNKLTYIPGFLGNLKQLTYLDVSKNNIEMVEDGISGCESLQDLLLSSNAIQQLP---ESIGALKKLTT------LKVDEN--------QLM--YLPDSIGGLTAIEDLDCSFNEIEALPSSIGHLIQIRTFAADH---NFLTQLPPEI-----------------------GTWKSATVLFLHSNKLESLPEEMGDMQKLKVINLSDNRLRNLPFSF 424          

HSP 2 Score: 55.8398 bits (133), Expect = 4.272e-7
Identity = 90/328 (27.44%), Postives = 139/328 (42.38%), Query Frame = 3
Query:  411 LPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKT-AHYFNGLHR----IGLWVSS 1379
            LPK + N + L  L++ + +L  +PA+I  + +L +LD+SKN I E   +I N   L  + A    +  LP        L  L L    +  +P     +  L+ L +    L + +   M  L Q  ++  D  SN   ++P V    +E          Q   L E  + GN    IP  + NL                         LT L +  N IE +   +   +SL+ L LS N I++L  S+    K L TLK++ N +  +P+ I  L  +E+LD S N I  LP  +  +  I+T A   N L +    IG W S+
Sbjct:   98 LPKQLFNCQSLHKLSLPDNDLTILPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLDFLPANFGRLTKLQILELRENQL-KMLPKTMNRLTQLERL--DLGSNEFTEVPEV----LE----------QLSGLKEFWMDGNKLTYIPGFLGNLK-----------------------QLTYLDVSKNNIEMVEDGISGCESLQDLLLSSNAIQQLPESIGAL-KKLTTLKVDENQLMYLPDSIGGLTAIEDLDCSFNEIEALPSSIGHLIQIRTFAADHNFLTQLPPEIGTWKSA 384          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Lrrc7 (leucine rich repeat containing 7 [Source:MGI Symbol;Acc:MGI:2676665])

HSP 1 Score: 80.4925 bits (197), Expect = 8.822e-15
Identity = 81/321 (25.23%), Postives = 143/321 (44.55%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQS-----KALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            I  S   ++ +P    + + +T L +++  ++ LPA+   LV L +L +  N         +  LPKSM  L  L+ L++       +P  + +I +L +L +  N +  L   IG L  L +L+     ++T+  +I GCE LE LLL  N++Q +P  +  +  L TL         K+D N  ++L           NTI +L  ++  +   C  N  +S         +L  L +  NF  E+P  + +                         N+T + L+ N++E + + + QM+ L+VL+LS N++K L  S 
Sbjct:  125 IEASVNPISKLPDGFTQLLNLTQLYLNDAFLEFLPANFGRLVKLRILELREN--------HLKTLPKSMHKLAQLERLDLGNNEFSELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTL---------KVDDNQLTML----------PNTIGNLSLLEEFD---CSCNELESLPPTIGYLHSLRTLAVDENFLPELPREIGSCK-----------------------NVTVMSLRSNKLEFLPEEIGQMQRLRVLNLSDNRLKNLPFSF 392          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Lrrc7 (leucine rich repeat containing 7 [Source:MGI Symbol;Acc:MGI:2676665])

HSP 1 Score: 80.4925 bits (197), Expect = 8.865e-15
Identity = 81/321 (25.23%), Postives = 143/321 (44.55%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQS-----KALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            I  S   ++ +P    + + +T L +++  ++ LPA+   LV L +L +  N         +  LPKSM  L  L+ L++       +P  + +I +L +L +  N +  L   IG L  L +L+     ++T+  +I GCE LE LLL  N++Q +P  +  +  L TL         K+D N  ++L           NTI +L  ++  +   C  N  +S         +L  L +  NF  E+P  + +                         N+T + L+ N++E + + + QM+ L+VL+LS N++K L  S 
Sbjct:  125 IEASVNPISKLPDGFTQLLNLTQLYLNDAFLEFLPANFGRLVKLRILELREN--------HLKTLPKSMHKLAQLERLDLGNNEFSELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTL---------KVDDNQLTML----------PNTIGNLSLLEEFD---CSCNELESLPPTIGYLHSLRTLAVDENFLPELPREIGSCK-----------------------NVTVMSLRSNKLEFLPEEIGQMQRLRVLNLSDNRLKNLPFSF 392          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Lrrc7 (leucine rich repeat containing 7 [Source:MGI Symbol;Acc:MGI:2676665])

HSP 1 Score: 80.4925 bits (197), Expect = 8.880e-15
Identity = 81/321 (25.23%), Postives = 143/321 (44.55%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQS-----KALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            I  S   ++ +P    + + +T L +++  ++ LPA+   LV L +L +  N         +  LPKSM  L  L+ L++       +P  + +I +L +L +  N +  L   IG L  L +L+     ++T+  +I GCE LE LLL  N++Q +P  +  +  L TL         K+D N  ++L           NTI +L  ++  +   C  N  +S         +L  L +  NF  E+P  + +                         N+T + L+ N++E + + + QM+ L+VL+LS N++K L  S 
Sbjct:  114 IEASVNPISKLPDGFTQLLNLTQLYLNDAFLEFLPANFGRLVKLRILELREN--------HLKTLPKSMHKLAQLERLDLGNNEFSELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTL---------KVDDNQLTML----------PNTIGNLSLLEEFD---CSCNELESLPPTIGYLHSLRTLAVDENFLPELPREIGSCK-----------------------NVTVMSLRSNKLEFLPEEIGQMQRLRVLNLSDNRLKNLPFSF 381          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Lrrc7 (leucine rich repeat containing 7 [Source:MGI Symbol;Acc:MGI:2676665])

HSP 1 Score: 80.4925 bits (197), Expect = 9.267e-15
Identity = 81/321 (25.23%), Postives = 143/321 (44.55%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQS-----KALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            I  S   ++ +P    + + +T L +++  ++ LPA+   LV L +L +  N         +  LPKSM  L  L+ L++       +P  + +I +L +L +  N +  L   IG L  L +L+     ++T+  +I GCE LE LLL  N++Q +P  +  +  L TL         K+D N  ++L           NTI +L  ++  +   C  N  +S         +L  L +  NF  E+P  + +                         N+T + L+ N++E + + + QM+ L+VL+LS N++K L  S 
Sbjct:  158 IEASVNPISKLPDGFTQLLNLTQLYLNDAFLEFLPANFGRLVKLRILELREN--------HLKTLPKSMHKLAQLERLDLGNNEFSELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTL---------KVDDNQLTML----------PNTIGNLSLLEEFD---CSCNELESLPPTIGYLHSLRTLAVDENFLPELPREIGSCK-----------------------NVTVMSLRSNKLEFLPEEIGQMQRLRVLNLSDNRLKNLPFSF 425          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Lrrc7 (leucine rich repeat containing 7 [Source:MGI Symbol;Acc:MGI:2676665])

HSP 1 Score: 80.4925 bits (197), Expect = 9.359e-15
Identity = 81/321 (25.23%), Postives = 143/321 (44.55%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQS-----KALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            I  S   ++ +P    + + +T L +++  ++ LPA+   LV L +L +  N         +  LPKSM  L  L+ L++       +P  + +I +L +L +  N +  L   IG L  L +L+     ++T+  +I GCE LE LLL  N++Q +P  +  +  L TL         K+D N  ++L           NTI +L  ++  +   C  N  +S         +L  L +  NF  E+P  + +                         N+T + L+ N++E + + + QM+ L+VL+LS N++K L  S 
Sbjct:  125 IEASVNPISKLPDGFTQLLNLTQLYLNDAFLEFLPANFGRLVKLRILELREN--------HLKTLPKSMHKLAQLERLDLGNNEFSELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTL---------KVDDNQLTML----------PNTIGNLSLLEEFD---CSCNELESLPPTIGYLHSLRTLAVDENFLPELPREIGSCK-----------------------NVTVMSLRSNKLEFLPEEIGQMQRLRVLNLSDNRLKNLPFSF 392          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|A7SFP1|SHOC2_NEMVE (Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis OX=45351 GN=v1g189306 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.694e-16
Identity = 64/176 (36.36%), Postives = 92/176 (52.27%), Query Frame = 3
Query:  210 FKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNV-IQTIPYLLADIGSLKTLSI 734
               +N+ +  LT +P+     I +  LNV+ N I  LP DI  LVNLEVL +S N         +  LP+ +  L+ L+ L+I E  L  IP  I  + SL +L +  N +G L   IG L  + +L+     L ++PQEI   E LE L L  N  +Q++PY L   GSL+ +SI
Sbjct:  367 LSKLNVKDNQLTSLPLDFGSWISLVELNVATNQISKLPEDIQWLVNLEVLILSNN--------LLKKLPRGIGALRKLRVLDIEENKLESIPTEIEYLRSLERLVLQSNCLGSLPRSIGYLSSVTYLSVGENELVSVPQEIGNMESLEQLYLNDNENLQSLPYELVLCGSLQIMSI 534          

HSP 2 Score: 82.0333 bits (201), Expect = 1.094e-14
Identity = 108/466 (23.18%), Postives = 197/466 (42.27%), Query Frame = 3
Query:  177 NRDARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPK---------------------------------------SMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSI---NLRHLGEKIDSNMESLLQSGQILSDHISNTIFDL-PAVQAVEMEFCKINYF-----------------KSFQSK-------------------ALLELHISGNFFQEIPETV---LNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIK 1328
            +++ +K  E+    ++LS  A+TV+P  L +   +  L +  N I  LP ++  L NLE L +S N    T PD++  L K                                        + NLK L+ L++ E  +  +P  I ++  L  LDIS N+I  L ++IGN   +  L+ QH  + +LP  I     +  L L  N + ++P  LA+   +   +I   N+  L EK+ S++++L       S  +S   F++ PA      +FC++N F                   + SK                   +L+EL+++ N   ++PE +   +NL                            L L  N ++K+ + +  ++ L+VLD+  NK++ +   ++Y  +SLE L +  N + ++P  I YL  +  L V  N +  +P ++  M++++
Sbjct:   77 HKEIQKCREEGATRLDLSKAAVTVLPKELKELTSLRELYLYGNRIAVLPPEVGLLPNLETLALSENNL-TTLPDNLVKLTKLKVLDLRHNKIKEIPDVIYKLTTLTTLYLRFNRISVVESGIGNLKLLERLSLRENKIKILPRVIGQLVHLVTLDISHNHIENLPAEIGNCVHMTSLDLQHNDIPSLPDSIGRLTAMTRLGLRYNQLSSLPDSLANCSGIDEFNIEGNNIAELPEKLLSSLKNL------TSLTLSRNKFEVFPA--GPPKQFCQVNTFIMEHNRMQKIPFGVFNKAKYLSKLNVKDNQLTSLPLDFGSWISLVELNVATNQISKLPEDIQWLVNLE--------------------------VLILSNNLLKKLPRGIGALRKLRVLDIEENKLESIPTEIEYL-RSLERLVLQSNCLGSLPRSIGYLSSVTYLSVGENELVSVPQEIGNMESLE 506          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|O61967|LAP1_CAEEL (Protein lap1 OS=Caenorhabditis elegans OX=6239 GN=let-413 PE=1 SV=3)

HSP 1 Score: 84.7297 bits (208), Expect = 1.986e-15
Identity = 94/331 (28.40%), Postives = 169/331 (51.06%), Query Frame = 3
Query:  261 LFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDS----NM---------------ESLLQSGQILSDHIS-NTIFDLPA----VQAVEMEFCKINYFKSFQS-----KALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            LF    +  L+VS+N +  LPA+I +L  L  LN++RN         +  LP +M+N K L  LN+S      +P TI E +S+  L +++ ++  L S+IG+L  L+ L A+   L+T+P  IV   KLE L L  N ++ +P  +  + SL+   +++  L    DS     M               E+L +   +   +IS N I +LP+    ++ ++M     N   +  S     ++L EL++  NF  ++P+T+ +L  L  L++  N L +I D +   ++LT L L+ N + ++  ++ + ++L VLD++ NK+  L  ++
Sbjct:   55 LFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNS--------IAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTV 377          

HSP 2 Score: 56.6102 bits (135), Expect = 1.103e-6
Identity = 45/170 (26.47%), Postives = 78/170 (45.88%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTL 728
            +++S   +  +P  L +   +T LN+S N I  LP+   +L  L++L   RN  H         L   +   + L  L + +  L  +P TI ++  L  L++  NN+ ++   IGN   L  L+ +   L  LP  I  CE L  L +  N +  +P+ +  +  L+ L
Sbjct:  225 LDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHN--------LTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTVKVLYKLQAL 386          

HSP 3 Score: 54.6842 bits (130), Expect = 3.870e-6
Identity = 88/348 (25.29%), Postives = 169/348 (48.56%), Query Frame = 3
Query:  276 EITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESL-----LQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSK--ALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELP 1298
            ++  ++ S++N++++P+DI     LE LN++                  M N+K L +              ++ +  L  LD+S N +  L ++IGNL QL  LN     +  LP  +  C+ L TL L  N    +P  + +  S+  LS+N   L   + SN+ SL     L++   L   I  +I +L  ++ +++   ++    +   K  +L E ++  N    +P+++     L  LD+S+N ++ + ++L ++ NLT L +  N+I ++  S  ++K L++L    N +  LT  +    +SL  L +  N + ++P+ I  L +L  L+V  NN+S++P
Sbjct:   14 QVDSIDRSQSNLQAIPSDIFRFRKLEDLNLT------------------MNNIKELDH-------------RLFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSL-TLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKC-QSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIP 328          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|P0C895|Y2010_ARATH (LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana OX=3702 GN=At2g30105 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.300e-15
Identity = 60/186 (32.26%), Postives = 100/186 (53.76%), Query Frame = 3
Query:  192 KNNEDDFKS---INLSNTALTVVPVTLFK-RIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN 737
            KN  D +K+   I L+   L  +P  ++     +  L++SEN IK +PA IS   +++ L +  NG       D +I  + + +LK L  L+IS  NL  +P+ +  +TSL QLD++ N +  L +++G L QL+ L A +  + +LP+ I  C  L  + L  N+I  +P     + +LKTL +N
Sbjct:  122 KNRTDRWKATGVIALAQANLKEIPEEVWDCGSGVRVLDISENFIKEVPAKISSFGSMQKLFLQGNGLS-----DESIQWEGIASLKRLMLLSISHNNLTVLPSAMGSLTSLRQLDVTNNKLTSLPNELGLLTQLEILKANNNRITSLPESIGNCSFLMEVDLSANIISELPETFTKLRNLKTLELN 302          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|B0W6M9|SUR8_CULQU (Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus OX=7176 GN=Sur-8 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 3.469e-15
Identity = 113/439 (25.74%), Postives = 203/439 (46.24%), Query Frame = 3
Query:  180 RDARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWE-----------------------ITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLS----------INLR---HLGE-KIDSNMESLLQSGQILS---------------DHISNTIFDLPAVQAVEME---FCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKT 1331
            ++ ++  E++   ++LS +++TV+P ++     +    +  N I SLP +I  L NL+ L ++ N         +T LP S++NLK LK L++    L  IP  I++                       ++SL  L + +N I EL + IG+L  L  L+  H  LK LP+ I  C  L  L L  N +  IP  + ++ +L+ L           ++LR   H+ E  ++ N  S L  G + S                + S        V ++ ME     KI Y    ++K L +L++  N    +P  +   + +  L+   N L  + DD+  L+NL  L L  N +++I  ++  +K L+VLDL  N+++ L   +   +  L+ L +  N ++++P  I +L  L  L V  NN+  LP ++  ++N+++
Sbjct:  139 KEFQRCKEENILRLDLSKSSITVIPPSVKDCTSLIEFYLYGNKISSLPVEIGCLSNLKTLALNEN--------SLTSLPDSLQNLKALKVLDLRHNKLSEIPDVIYKLHTLTTLYLRFNRIKVVGDNLKNLSSLTMLSLRENKIHELPAAIGHLRNLTTLDLSHNHLKHLPEAIGNCVNLTALDLQHNDLLDIPETIGNLANLQRLGLRYNQLTAIPVSLRNCIHMDEFNVEGNSISQLPDGLLASLSNLTTITLSRNAFHSYPSGGPAQFTNVTSINMEHNQIDKIQYGIFSRAKGLTKLNMKENALTSLPLDIGTWSQMVELNFGTNSLAKLPDDIHCLQNLEILILSNNMLKRIPNTIGNLKKLRVLDLEENRLESLPSEIGLLH-DLQKLILQSNALQSLPRTIGHLTNLTYLSVGENNLQYLPEEIGTLENLES 568          

HSP 2 Score: 61.2326 bits (147), Expect = 3.859e-8
Identity = 55/178 (30.90%), Postives = 87/178 (48.88%), Query Frame = 3
Query:  207 DFKSINLSNTALTVVPVTLFKRIE-ITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN 737
            +  SIN+ +  +  +   +F R + +T LN+ EN + SLP DI     +  LN   N         +  LP  +  L+ L+ L +S   L  IP TI  +  L  LD+ +N +  L S+IG L  LQ L  Q   L++LP+ I     L  L +  N +Q +P  +  + +L++L IN
Sbjct:  403 NVTSINMEHNQIDKIQYGIFSRAKGLTKLNMKENALTSLPLDIGTWSQMVELNFGTN--------SLAKLPDDIHCLQNLEILILSNNMLKRIPNTIGNLKKLRVLDLEENRLESLPSEIGLLHDLQKLILQSNALQSLPRTIGHLTNLTYLSVGENNLQYLPEEIGTLENLESLYIN 572          

HSP 3 Score: 57.3806 bits (137), Expect = 5.885e-7
Identity = 41/139 (29.50%), Postives = 75/139 (53.96%), Query Frame = 3
Query:  225 LSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKN-NIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVG 638
            LSN  L  +P T+    ++  L++ EN ++SLP++I  L +L+ L +  N            LP+++ +L  L YL++ E NL ++P  I  + +L  L I+ N ++ +L  ++     L  ++ ++C L  LP E+VG
Sbjct:  479 LSNNMLKRIPNTIGNLKKLRVLDLEENRLESLPSEIGLLHDLQKLILQSNALQS--------LPRTIGHLTNLTYLSVGENNLQYLPEEIGTLENLESLYINDNASLVKLPYELALCQNLAIMSIENCPLSALPPEVVG 609          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96NW7|LRRC7_HUMAN (Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.865e-14
Identity = 82/321 (25.55%), Postives = 144/321 (44.86%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQS-----KALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            I  S   ++ +P    + + +T L +++  ++ LPA+   LV L +L +  N         +  LPKSM  L  L+ L++       +P  + +I +L +L +  N +  L   IG L  L +L+     ++T+  +I GCE LE LLL  N++Q +P  +  +  L TL         K+D N  ++L           NTI +L  ++  +   C  N  +S  S      +L  L +  NF  E+P  + +                         N+T + L+ N++E + + + QM+ L+VL+LS N++K L  S 
Sbjct:  120 IEASVNPISKLPDGFTQLLNLTQLYLNDAFLEFLPANFGRLVKLRILELREN--------HLKTLPKSMHKLAQLERLDLGNNEFGELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTL---------KVDDNQLTML----------PNTIGNLSLLEEFD---CSCNELESLPSTIGYLHSLRTLAVDENFLPELPREIGSCK-----------------------NVTVMSLRSNKLEFLPEEIGQMQKLRVLNLSDNRLKNLPFSF 387          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A1S3IFK1 (malignant fibrous histiocytoma-amplified sequence 1 homolog isoform X2 OS=Lingula unguis OX=7574 GN=LOC106163857 PE=4 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 1.093e-99
Identity = 263/924 (28.46%), Postives = 479/924 (51.84%), Query Frame = 3
Query:  195 NNEDDF-KSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQKTKIKRLQIKSPIRVVLIGDN-SIKDNFLERFLGKRIS-----NDSEYLTINQW-TSENSVPFVLVNVNCHPTYVMHIRHYMEDNAFIWIFIDH--FKTKNLLKESEKWIDLVMEYSTDCVIQIV-----------------------IVNYFENNSEDIFQNFVNFSD----KKLIES-----------LRER------FSNEKVNILPNILLISPGESLNAFKD---DLEYIAIDKDLFQSDEMFNIFTRETKAIENICKSTKCIYVNLNDLISKIREMFPFPTDSIFSCLKCLHKQGKILWFYKNKKLSNKIYPFISLFNKSIRSLIRLDYEEDLDFAKNPLIKAKGLMNGEKFEQVKKSFLKYGEICYPLYKVLTF----EFQELRSVKDFLIDANIAWGVPLS-VDLEEDIFQRPFVVLAQFNKEKFDKSCFLDS-----ILKKESANIDYGFTIRSTSLSDHSNLFLNLKCEVNCWAVRRYDWMNAVYLHHNNGDVLL 2765
            ++ED + + ++LSN  LT V    F   ++  +N+S N ++++P DI  L +L  LNISRNG  C+ P+D   LP  + +LK L+ L I+ECNL +IP  +W +  L +LDIS+N I  L  +IG+L +L++LN Q  G+ TLP EI  C++L+ +LLYGN ++++P  L ++  L  L +N R     +D  ME+L++ GQI S+H+   +F++P   ++++E CKIN        +L+E +IS N+F ++P+ +  + NLQ LD+S N++ ++  D+ +L+++  L +  N  E +  S+  +K L+VL++  N+I+ L   +     +L TLK+  NNI+ +P+ I  L +LE LD++ N ++ LPL+L  +  + +AH ++ L + GLW++ NP+  PP+ VW TT+I  IY +LQ+ KI R Q+   ++++L+G++ S K +     +  +I+      DS  +   ++ T+EN V F++ ++   P Y+     +++  A + I  DH  +   +      KWIDL+   +   V++IV                       +  + E + E + +   + +D    +K IE+           L E+           V ++P I ++S  E      D   ++E +A++++LF      +I   E    ++  +  K +++   D+  +I + F F  + +  CL  L   G ++WF  + +L + I+     F + +R + + + E  LD+ KN +  +KG    + FE+ +K FL++G++   + + L F     + E  ++ DF+   +I + +P   + L +  FQ PF  +  +NK+  D S          +L  +   +DY F +          LF  L   +      R DW +  Y    +  +LL
Sbjct:   93 HHEDKYLRVVDLSNQGLTTVQSAYFNAKDVGEMNLSGNCLRTIPLDIRKLTHLISLNISRNGIKCSHPNDYGGLPAELDSLKFLETLIIAECNLQYIPPAVWRLKKLKKLDISRNKIQILVPEIGHLTKLEYLNLQQTGITTLPLEIAYCQELQQILLYGNAMESLPETLKELPYLCVLKMNHRSFCSVVDDYMENLIRKGQIQSEHVPQVLFEMPCPLSLDLEACKINNLPDECPNSLIEFNISKNYFHDVPKALYRIENLQYLDMSNNMISDLPQDIGQLKSVKVLKINSNVFETVPPSIGDLKHLEVLEMESNRIRCLPSEISNLT-TLHTLKLAKNNIQALPDSICELYRLETLDLTDNGLTSLPLNLYKLSRLTSAHSYHLLFKTGLWLNKNPLVTPPEHVWKTTDIQKIYVYLQQLKIARTQLLR-LKLILMGESQSGKTSLANAMISGKINLTAGKEDSTSIVEQRFLTTENGVNFMVYDLGGDPVYMFTHPMFLDPKALMMILYDHSTYNPDSFQSTIGKWIDLINVRTPGAVVKIVGTHTDLCEDEKVSQAKLQLIQEQVKKHQEEHEESLNKELESITDQIEKQKTIETDINFETPAAEFLEEQQKKIEGLLQNTVKMMP-ISIVSSTEGTKGVADVMAEMERLAVNENLF--PHAHDIVDPEWDDFKSALRLHKTLFLTW-DMAVEIGKSFKFDEEEVLHCLLYLRDTGDVVWFRGSSQLHDVIFHRPKYFVQVLRGIFKHNMEAFLDYEKNKVFSSKGKYEPDIFEEHRKMFLQHGQVSRQMMQCLWFYLKLGYDEFYALMDFIPRLDILYAIPQPDLPLAKHHFQ-PFAAIPWYNKDAEDISTVKGYWTPKLLLDIKELKVDYTFPLYYP-----VGLFERLSVRIQDIITERIDWKSLTYATTEDEQLLL 1004          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A1S3IGL4 (malignant fibrous histiocytoma-amplified sequence 1 homolog isoform X1 OS=Lingula unguis OX=7574 GN=LOC106163857 PE=4 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 1.947e-99
Identity = 263/924 (28.46%), Postives = 479/924 (51.84%), Query Frame = 3
Query:  195 NNEDDF-KSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQKTKIKRLQIKSPIRVVLIGDN-SIKDNFLERFLGKRIS-----NDSEYLTINQW-TSENSVPFVLVNVNCHPTYVMHIRHYMEDNAFIWIFIDH--FKTKNLLKESEKWIDLVMEYSTDCVIQIV-----------------------IVNYFENNSEDIFQNFVNFSD----KKLIES-----------LRER------FSNEKVNILPNILLISPGESLNAFKD---DLEYIAIDKDLFQSDEMFNIFTRETKAIENICKSTKCIYVNLNDLISKIREMFPFPTDSIFSCLKCLHKQGKILWFYKNKKLSNKIYPFISLFNKSIRSLIRLDYEEDLDFAKNPLIKAKGLMNGEKFEQVKKSFLKYGEICYPLYKVLTF----EFQELRSVKDFLIDANIAWGVPLS-VDLEEDIFQRPFVVLAQFNKEKFDKSCFLDS-----ILKKESANIDYGFTIRSTSLSDHSNLFLNLKCEVNCWAVRRYDWMNAVYLHHNNGDVLL 2765
            ++ED + + ++LSN  LT V    F   ++  +N+S N ++++P DI  L +L  LNISRNG  C+ P+D   LP  + +LK L+ L I+ECNL +IP  +W +  L +LDIS+N I  L  +IG+L +L++LN Q  G+ TLP EI  C++L+ +LLYGN ++++P  L ++  L  L +N R     +D  ME+L++ GQI S+H+   +F++P   ++++E CKIN        +L+E +IS N+F ++P+ +  + NLQ LD+S N++ ++  D+ +L+++  L +  N  E +  S+  +K L+VL++  N+I+ L   +     +L TLK+  NNI+ +P+ I  L +LE LD++ N ++ LPL+L  +  + +AH ++ L + GLW++ NP+  PP+ VW TT+I  IY +LQ+ KI R Q+   ++++L+G++ S K +     +  +I+      DS  +   ++ T+EN V F++ ++   P Y+     +++  A + I  DH  +   +      KWIDL+   +   V++IV                       +  + E + E + +   + +D    +K IE+           L E+           V ++P I ++S  E      D   ++E +A++++LF      +I   E    ++  +  K +++   D+  +I + F F  + +  CL  L   G ++WF  + +L + I+     F + +R + + + E  LD+ KN +  +KG    + FE+ +K FL++G++   + + L F     + E  ++ DF+   +I + +P   + L +  FQ PF  +  +NK+  D S          +L  +   +DY F +          LF  L   +      R DW +  Y    +  +LL
Sbjct:  109 HHEDKYLRVVDLSNQGLTTVQSAYFNAKDVGEMNLSGNCLRTIPLDIRKLTHLISLNISRNGIKCSHPNDYGGLPAELDSLKFLETLIIAECNLQYIPPAVWRLKKLKKLDISRNKIQILVPEIGHLTKLEYLNLQQTGITTLPLEIAYCQELQQILLYGNAMESLPETLKELPYLCVLKMNHRSFCSVVDDYMENLIRKGQIQSEHVPQVLFEMPCPLSLDLEACKINNLPDECPNSLIEFNISKNYFHDVPKALYRIENLQYLDMSNNMISDLPQDIGQLKSVKVLKINSNVFETVPPSIGDLKHLEVLEMESNRIRCLPSEISNLT-TLHTLKLAKNNIQALPDSICELYRLETLDLTDNGLTSLPLNLYKLSRLTSAHSYHLLFKTGLWLNKNPLVTPPEHVWKTTDIQKIYVYLQQLKIARTQLLR-LKLILMGESQSGKTSLANAMISGKINLTAGKEDSTSIVEQRFLTTENGVNFMVYDLGGDPVYMFTHPMFLDPKALMMILYDHSTYNPDSFQSTIGKWIDLINVRTPGAVVKIVGTHTDLCEDEKVSQAKLQLIQEQVKKHQEEHEESLNKELESITDQIEKQKTIETDINFETPAAEFLEEQQKKIEGLLQNTVKMMP-ISIVSSTEGTKGVADVMAEMERLAVNENLF--PHAHDIVDPEWDDFKSALRLHKTLFLTW-DMAVEIGKSFKFDEEEVLHCLLYLRDTGDVVWFRGSSQLHDVIFHRPKYFVQVLRGIFKHNMEAFLDYEKNKVFSSKGKYEPDIFEEHRKMFLQHGQVSRQMMQCLWFYLKLGYDEFYALMDFIPRLDILYAIPQPDLPLAKHHFQ-PFAAIPWYNKDAEDISTVKGYWTPKLLLDIKELKVDYTFPLYYP-----VGLFERLSVRIQDIITERIDWKSLTYATTEDEQLLL 1020          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A267GL57 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031151g2 PE=4 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 5.603e-91
Identity = 233/796 (29.27%), Postives = 402/796 (50.50%), Query Frame = 3
Query:  183 DARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQKTKIKRLQIKSPIRVVLIGDNSIKDNFLERFL----GKRISNDSEYLT----INQWTSENSVPFVLVNVNCHPTYVMHIRHYMEDNAFIWIFIDHFKTKNL-LKESEKWIDLVMEYSTDCVIQIVIVN--------------------------YFENNSEDIFQNFVNFSDKKL---IESLRERFSNEKVNILPNILLIS----PGES-LNAFKDDLEYIAIDKDLFQSDEMFNIFTRETKAIENICKSTKCIYVNLNDLIS-----KIREMFPFPTDSIFSCLKCLHKQGKILWFYKNKKLSNKIYPFISLFNKSIRSLIRLDYEEDL-DFAKNPLIKAKGLMNGEKFEQVKKSFLKYGEICYPLYKVLTF 2423
            + R  +E DF     S+  LT+ P +LF +  IT LN+S NNI+ LP +IS+L  L  L++SRNG  C  P D T LPK M+ +  L+ L +SEC+L+ IP  +W I  L +LDIS+N +G + SDI  L++L  LNA   G+KTLP+EIV C+ LE+LLL+GN I ++P  L ++  L TL IN R     +D+  + +LQ  Q+ S+HI + +F +P +  +++E CK+N      +++L+EL+I+ N+F   PE V +L  L +LD+S+N    +   L  L +L  L  + NQ+     SL  +  L+ +DL  N I KL  ++    K    L   +       +     ++L+ LD++ N ++ +P ++  +  +  AH F+GL + GLW+ +NPI+ PP  VWNT +   I++ +++  I+      P ++V +GD       L R L         +D   LT    ++ W SEN  PFVL+    HP Y   +   ++  A   +  D  + + L      +W+ L+  +     +Q++                               E+ +E   Q   +  D+ L   +E LR   SN ++ + P I L+S    P +  L   +DDLE ++ +++     + + + T     +E + K    +Y+  + L+       IR+        +  CL+  H+ G++LW  ++++L N +   +      +  L+ +   + L D+ +N L +A G M+  ++E+ +++ L  G++ +PL + L F
Sbjct:   45 EGRSRDELDF-----SSQGLTMAPSSLFAKTHITVLNLSSNNIRGLPPEISNLTQLRHLDLSRNGLRCAHPRDFTSLPKEMETMAELRELLLSECSLMHIPPAVWSIVGLEKLDISRNKVGAIPSDIMKLERLVHLNATQTGIKTLPEEIVCCDALESLLLFGNPIDSLPDSLRELNRLHTLHINYRVFASGVDAETDGMLQRQQLTSEHIPSVVFHIPQLLEMDLEACKVNALPRSLTRSLVELNIAANYFPAFPEAVCSLRQLTLLDVSRNGFKTLPPALKDLRSLRVLLARHNQL-TFVDSLADLTELERIDLGFNCIAKLPDNIGQLTKLTALLLPGNRLDALPKSLCSLGDQLQTLDLTGNRLTSIPPEMAGLAGLDRAHQFSGLFKRGLWLHNNPIDKPPAKVWNTWDPAKIWAHMERMAIQNAPKLRPCKLVFLGDLGSGKTSLARLLRLGHAAPTKSDGSGLTRGFQLSSWRSENRCPFVLLEAGGHPIYAPLLAKLLDPKALHCVVFDIAEYQQLGFDVVSRWLRLLAAHLPGARVQLIGTKLDTISMTTETSADEILAEVSEVEAALAAESTAEAAVQRLRDSLDEDLARCLEQLRAD-SNPELRLQPRIHLVSAVGPPAQPDLLTLRDDLERLSTNREAMPHLQKY-VPTNWQPFMEQV-KQQDGLYIEWDWLVEFADQRNIRDA------QLIDCLEFYHESGQLLWLRRHRRLRNFVLHRLDKLADFLGRLLPVSLADFLVDYNENALFRACGRMSAAEYEEAREAALSRGQLSWPLVRCLAF 825          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A1I8G548 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 1.463e-90
Identity = 233/794 (29.35%), Postives = 400/794 (50.38%), Query Frame = 3
Query:  189 RKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQKTKIKRLQIKSPIRVVLIGDNSIKDNFLERFL----GKRISNDSEYLT----INQWTSENSVPFVLVNVNCHPTYVMHIRHYMEDNAFIWIFIDHFKTKNL-LKESEKWIDLVMEYSTDCVIQIVIVN--------------------------YFENNSEDIFQNFVNFSDKKL---IESLRERFSNEKVNILPNILLIS----PGES-LNAFKDDLEYIAIDKDLFQSDEMFNIFTRETKAIENICKSTKCIYVNLNDLIS-----KIREMFPFPTDSIFSCLKCLHKQGKILWFYKNKKLSNKIYPFISLFNKSIRSLIRLDYEEDL-DFAKNPLIKAKGLMNGEKFEQVKKSFLKYGEICYPLYKVLTF 2423
            R  +E DF     S+  LT+ P +LF +  IT LN+S NNI+ LP +IS+L  L  L++SRNG  C  P D T LPK M+ +  L+ L +SEC+L+ IP  +W I  L +LDIS+N +G + SDI  L++L  LNA   G+KTLP+EIV C+ LE+LLL+GN I ++P  L ++  L TL IN R     +D+  + +LQ  Q+ S+HI + +F +P +  +++E CK+N      +++L+EL+I+ N+F   PE V +L+ L +LD+S+N    +   L  L +L  L  + NQ+     SL  +  LK +DL  N I KL  ++    K    L   +       +     ++L+ LD++ N ++ +P ++  +  +  AH F+GL + GLW+  NPI+ PP  VWNT +   I++ +++  I+      P ++V +GD       L R L         +D   LT    ++ W SEN  PFVL+    HP Y   +   ++  A   +  D  + + +      +W+ L+  +     +Q++                               E+ +E   Q   +  D+ L   +E LR   SN ++ + P I L+S    P +  L   +DDLE ++ +++     + + + T     +E + K    +Y+  + L+       IR+        +  CL+  H+ G++LW  ++++L N +          +  L+ +   + L D+ +N L +A G M+  ++E+ +++ L  G++ +PL + L F
Sbjct:   47 RSRDELDF-----SSQGLTMAPSSLFAKTHITVLNLSSNNIRGLPPEISNLTQLRHLDLSRNGLRCAHPRDFTSLPKEMETMAELRELLLSECSLMHIPPAVWSIVGLEKLDISRNKVGAIPSDIMKLERLVHLNATQTGIKTLPEEIVCCDALESLLLFGNPIDSLPDSLRELNRLHTLHINYRVFASGVDAETDGMLQRQQLTSEHIPSVVFHIPQLLEMDLEACKVNALPRSLTRSLVELNIAANYFPAFPEAVCSLHQLTLLDVSRNGFKTLPPALKDLRSLRVLLARHNQL-TFVDSLADLTELKRIDLGFNCIAKLPDNIGQLTKLTALLLPGNRLDALPKSLCSLGDQLQTLDLTGNRLTSIPPEMAGLAGLDRAHQFSGLFKRGLWLHKNPIDKPPAKVWNTWDPAKIWAHMERMAIQNAPKLRPCKLVFLGDLGSGKTSLARLLRLGHAAPTKSDGSGLTRGFQLSSWRSENRCPFVLLEAGGHPIYAPLLAKLLDPKALHCVVFDIAEYQQIGFDVVSRWLRLLAAHLPGARVQLIGTKLDTISMATETSANEILAEVSEVEAALAAESTAEAAVQRLRDSLDEDLARCLEQLRAD-SNPELRLQPRIHLVSAVGPPAQPDLLTLRDDLERLSTNREAMPHLQKY-VPTNWQPFMEQV-KQQDGLYIEWDWLVEFADQRNIRDA------QLIDCLEFYHESGQLLWLRRHRRLRNFVLHRPDKLADFLGRLLPVSLADFLVDYNENALFRACGRMSAAEYEEAREAALSRGQLSWPLVRCLAF 825          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A267G7R0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031151g3 PE=4 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 1.477e-90
Identity = 231/795 (29.06%), Postives = 406/795 (51.07%), Query Frame = 3
Query:  183 DARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQKTKIKRLQIKSPIRVVLIGDNSIKDNFLERFL----GKRISNDSEYLT----INQWTSENSVPFVLVNVNCHPTYVMHIRHYMEDNAFIWIFIDHFKTKNL-LKESEKWIDLVMEYSTDCVIQIV------IVNYFENNSEDIF------------QNFVNFSDKKLIESLRERF----------SNEKVNILPNILLIS----PGES-LNAFKDDLEYIAIDKDLFQSDEMFNIFTRETKAIENICKSTKCIYVNLNDLIS-----KIREMFPFPTDSIFSCLKCLHKQGKILWFYKNKKLSNKIYPFISLFNKSIRSLIRLDYEEDL-DFAKNPLIKAKGLMNGEKFEQVKKSFLKYGEICYPLYKVLTF 2423
            + R  +E DF     S+  LT+ P +LF +  IT LN+S NNI+ LP +IS+L  L  L++SRNG  C  P D T LPK M+ +  L+ L +SEC+L+ IP  +W I  L +LDIS+N +G + SDI  L++L  LNA   G+KTLP+EIV C+ LE+LLL+GN I ++P  L ++  L TL IN R     +D+  + +LQ  Q+ S+HI + +F +P +  +++E CK+N      +++L+EL+I+ N+F   PE V +L+ L +LD+S+N    +   L  L +L  L  + NQ+     SL  +  L+ +DL  N I KL  ++    K    L   +       +     ++L+ LD++ N ++ +P ++  +  +  AH F+GL + GLW+ +NPI+ PP  VWNT +   I++ +++  I+      P ++V +GD       L R L         +D   LT    ++ W SEN  PFVL+    HP Y   +   ++  A   +  D  + + +      +W+ L+  +     +Q++      I    E ++++I             ++    + ++L +SL E            SN ++ + P I L+S    P +  L   +DDLE ++ +++     + + + T     +E + K    +Y+  + L+       IR+        +  CL+  H+ G++LW  ++++L N +          +  L+ +   + L D+ +N L +A G M+  ++E+ +++ L  G++ +PL + L F
Sbjct:   45 EGRSRDELDF-----SSQGLTMAPSSLFAKTHITVLNLSSNNIRGLPPEISNLTQLRHLDLSRNGLRCAHPRDFTSLPKEMETMAELRELLLSECSLMHIPPAVWSIVGLEKLDISRNKVGAIPSDIMKLERLVHLNATQTGIKTLPEEIVCCDALESLLLFGNPIDSLPDSLRELNRLHTLHINYRVFASGVDAETDGMLQRQQLTSEHIPSVVFHIPQLLEMDLEACKVNALPRSLTRSLVELNIAANYFPAFPEAVCSLHQLTLLDVSRNGFKTLPPALKDLRSLRVLLARHNQL-TFVDSLADLTELERIDLGFNCIAKLPDNIGQLTKLTALLLPGNRLDALPKSLCSLGDQLQTLDLTGNRLTSIPPEMAGLAGLDRAHQFSGLFKRGLWLHNNPIDKPPAKVWNTWDPAKIWAHMERMAIQNAPKLRPCKLVFLGDLGSGKTSLARLLRLGHAAPTKSDGSGLTRGFQLSSWRSENRCPFVLLEAGGHPIYAPLLAKLLDPKALHCVVFDIAEYQQIGFDVVSRWLRLLAAHLPGARVQLIGTKLDTISMATETSADEILAEVSEVEAALAAESTAEAAVQRLRDSLDEDLARCLEQLRADSNPELRLQPRIHLVSAVGPPAQPDLLTLRDDLERLSTNREAMPHLQKY-VPTNWQPFMEQV-KQQDGLYIEWDWLVEFADQRNIRDA------QLIDCLEFYHESGQLLWLRRHRRLRNFVLHRPDKLADFLGRLLPVSLADFLVDYNENALFRACGRMSAAEYEEAREAALSRGQLSWPLVRCLAF 825          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: LRRC2 (leucine rich repeat containing 2 [Source:NCBI gene;Acc:103036599])

HSP 1 Score: 82.8037 bits (203), Expect = 3.143e-16
Identity = 50/176 (28.41%), Postives = 92/176 (52.27%), Query Frame = 3
Query:  207 DFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSI 734
            D + +++     T++P  + K + +  LNV+ N +  +P ++ +  NLE L ++ NG       D++ LP  + NLK LK+L+++E     IP  +  ++SL  LD+S N + +L  DI  L  LQ +      L  LP  +   +KL+ L++ G+ +  +P  L D   +K + +
Sbjct:  179 DLRVLDIPKNGFTMLPPEIGKLVNLKELNVNYNKLSIIPPELGECENLEKLEMTANG-------DLSELPFELSNLKALKHLDLAENKFATIPICVLRMSSLQWLDMSNNRLTDLPEDIDRLSDLQTMFLHKNKLTYLPMVMANMDKLKMLVVSGDELTNLPSKLCDSPDIKFIKL 347          

HSP 2 Score: 52.373 bits (124), Expect = 1.937e-6
Identity = 34/109 (31.19%), Postives = 57/109 (52.29%), Query Frame = 3
Query:  411 LPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNV-IQTIPYLLADIGSLKTLSI 734
            LP+ ++ +  L+  +I   ++  +P  I E   L  LDI KN    L  +IG L  L+ LN  +  L  +P E+  CE LE L +  N  +  +P+ L+++ +LK L +
Sbjct:  147 LPEDLQIMTFLREWHIRGTSIQKVPTYIEEFVDLRVLDIPKNGFTMLPPEIGKLVNLKELNVNYNKLSIIPPELGECENLEKLEMTANGDLSELPFELSNLKALKHLDL 255          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: LRRC2 (leucine rich repeat containing 2 [Source:NCBI gene;Acc:103036599])

HSP 1 Score: 82.4185 bits (202), Expect = 3.983e-16
Identity = 50/176 (28.41%), Postives = 92/176 (52.27%), Query Frame = 3
Query:  207 DFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSI 734
            D + +++     T++P  + K + +  LNV+ N +  +P ++ +  NLE L ++ NG       D++ LP  + NLK LK+L+++E     IP  +  ++SL  LD+S N + +L  DI  L  LQ +      L  LP  +   +KL+ L++ G+ +  +P  L D   +K + +
Sbjct:  179 DLRVLDIPKNGFTMLPPEIGKLVNLKELNVNYNKLSIIPPELGECENLEKLEMTANG-------DLSELPFELSNLKALKHLDLAENKFATIPICVLRMSSLQWLDMSNNRLTDLPEDIDRLSDLQTMFLHKNKLTYLPMVMANMDKLKMLVVSGDELTNLPSKLCDSPDIKFIKL 347          

HSP 2 Score: 51.9878 bits (123), Expect = 2.326e-6
Identity = 34/109 (31.19%), Postives = 57/109 (52.29%), Query Frame = 3
Query:  411 LPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNV-IQTIPYLLADIGSLKTLSI 734
            LP+ ++ +  L+  +I   ++  +P  I E   L  LDI KN    L  +IG L  L+ LN  +  L  +P E+  CE LE L +  N  +  +P+ L+++ +LK L +
Sbjct:  147 LPEDLQIMTFLREWHIRGTSIQKVPTYIEEFVDLRVLDIPKNGFTMLPPEIGKLVNLKELNVNYNKLSIIPPELGECENLEKLEMTANGDLSELPFELSNLKALKHLDL 255          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: LRRC2 (leucine rich repeat containing 2 [Source:NCBI gene;Acc:103036599])

HSP 1 Score: 82.8037 bits (203), Expect = 4.097e-16
Identity = 50/176 (28.41%), Postives = 92/176 (52.27%), Query Frame = 3
Query:  207 DFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSI 734
            D + +++     T++P  + K + +  LNV+ N +  +P ++ +  NLE L ++ NG       D++ LP  + NLK LK+L+++E     IP  +  ++SL  LD+S N + +L  DI  L  LQ +      L  LP  +   +KL+ L++ G+ +  +P  L D   +K + +
Sbjct:  216 DLRVLDIPKNGFTMLPPEIGKLVNLKELNVNYNKLSIIPPELGECENLEKLEMTANG-------DLSELPFELSNLKALKHLDLAENKFATIPICVLRMSSLQWLDMSNNRLTDLPEDIDRLSDLQTMFLHKNKLTYLPMVMANMDKLKMLVVSGDELTNLPSKLCDSPDIKFIKL 384          

HSP 2 Score: 52.373 bits (124), Expect = 1.811e-6
Identity = 34/109 (31.19%), Postives = 57/109 (52.29%), Query Frame = 3
Query:  411 LPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNV-IQTIPYLLADIGSLKTLSI 734
            LP+ ++ +  L+  +I   ++  +P  I E   L  LDI KN    L  +IG L  L+ LN  +  L  +P E+  CE LE L +  N  +  +P+ L+++ +LK L +
Sbjct:  184 LPEDLQIMTFLREWHIRGTSIQKVPTYIEEFVDLRVLDIPKNGFTMLPPEIGKLVNLKELNVNYNKLSIIPPELGECENLEKLEMTANGDLSELPFELSNLKALKHLDL 292          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: lrrc7 (leucine rich repeat containing 7 [Source:ZFIN;Acc:ZDB-GENE-130530-876])

HSP 1 Score: 83.1889 bits (204), Expect = 1.015e-15
Identity = 87/335 (25.97%), Postives = 147/335 (43.88%), Query Frame = 3
Query:  249 VPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFH----------C-----TSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLD---------ISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILS-----DHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            +P  LF    +  L++ +N++ SLP  I+ LVNL+ L+IS+NG            C      S + +T LP     L  L  L +++  L ++PA    ++ L  L+         +  N++  +   IG L QL++L+     +++L  +I GCE LE LLL  N++Q +P  +  +  L TL ++        D+ + SL  +   LS     D   N +  LP           I Y  S ++ A  E     NF  E+P  + N                         N+T + L+ N++E +   + QM  L+VL+LS N+++ L  + 
Sbjct:   66 LPKQLFNCQALRKLSIPDNDLSSLPTTIASLVNLKELDISKNGIQEFPDNIKCCKCLSVVEASVNPITKLPDGFTQLLNLTQLFLNDAFLEYLPANFGRLSKLQVLEQIHNLKELWLDNNSLQTIPGSIGKLRQLRYLDLAKNRIESLDADISGCESLEDLLLSSNMLQQLPDTIGMLKKLTTLKVD--------DNQLTSLPNTIGSLSLLEEFDCSCNELESLPPT---------IGYLHSLRTFAADE-----NFLTELPREIGNCR-----------------------NVTVMSLRSNKLEFLPDEIGQMTKLRVLNLSDNRLRNLPYTF 355          

HSP 2 Score: 61.2326 bits (147), Expect = 6.264e-9
Identity = 54/190 (28.42%), Postives = 90/190 (47.37%), Query Frame = 3
Query:  207 DFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPD----------------DMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTL 728
            + K + L N +L  +P ++ K  ++ +L++++N I+SL ADIS   +LE L +S N      PD                 +T LP ++ +L  L+  + S   L  +P TI  + SL      +N + EL  +IGN   +  ++ +   L+ LP EI    KL  L L  N ++ +PY    +  L  L
Sbjct:  176 NLKELWLDNNSLQTIPGSIGKLRQLRYLDLAKNRIESLDADISGCESLEDLLLSSNMLQQL-PDTIGMLKKLTTLKVDDNQLTSLPNTIGSLSLLEEFDCSCNELESLPPTIGYLHSLRTFAADENFLTELPREIGNCRNVTVMSLRSNKLEFLPDEIGQMTKLRVLNLSDNRLRNLPYTFTKLKDLAAL 364          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: erbin (erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GENE-061103-403])

HSP 1 Score: 78.5666 bits (192), Expect = 1.753e-14
Identity = 76/323 (23.53%), Postives = 143/323 (44.27%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSF--QSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNK 1181
            +  S   ++ +P    + + +T L +++  ++ LPA    L  L++L +  N         + +LPKSM  L  L+ L++       +P  + ++T + +L +  N +  +   +G L QL +L+     ++ + ++I GCE L+ LLL  N +  +P     IGSLK L+        K+D N        Q++   + ++I  L A+  ++  F +I    +   Q   L       NF  ++P  +                          +N T L+L  N++E + + +  M+ LKV++LS NK+K L  S    N+
Sbjct:  108 VEASVNPISKLPEGFTQLLSLTQLYLNDAFLEFLPASFGRLTKLQILELREN--------QLKMLPKSMHKLTQLERLDLGSNEFTEVPEVLEQLTGIKELWMDGNKLTMVPGMVGMLKQLTYLDVSKNNVELVDEQINGCENLQDLLLSNNALTQLP---GSIGSLKKLT------ALKVDEN--------QLVC--LPDSIGGLSALDELDCSFNEIESLPAAIGQCVNLRTFAADHNFLSQLPPEM-----------------------GCWKNATVLFLHSNKLESLPEEMGDMQKLKVVNLSDNKLKNLPYSFTKLNQ 380          

HSP 2 Score: 76.6406 bits (187), Expect = 7.050e-14
Identity = 57/176 (32.39%), Postives = 97/176 (55.11%), Query Frame = 3
Query:  213 KSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLL-LYGNVIQTIPYLLADIGSLKTLSIN 737
            K + +    LT+VP  +    ++T+L+VS+NN++ +   I+   NL+ L +S N         +T LP S+ +LK L  L + E  LV +P +I  +++L +LD S N I  L + IG    L+   A H  L  LP E+ GC K  T+L L+ N ++++P  + D+  LK ++++
Sbjct:  198 KELWMDGNKLTMVPGMVGMLKQLTYLDVSKNNVELVDEQINGCENLQDLLLSNNA--------LTQLPGSIGSLKKLTALKVDENQLVCLPDSIGGLSALDELDCSFNEIESLPAAIGQCVNLRTFAADHNFLSQLPPEM-GCWKNATVLFLHSNKLESLPEEMGDMQKLKVVNLS 364          
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004940.1 (pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-1 gene:ENSPMAG00000004448.1 transcript:ENSPMAT00000004940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 6.106e-13
Identity = 104/380 (27.37%), Postives = 184/380 (48.42%), Query Frame = 3
Query:  216 SINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSI---NLRHLGEK---IDSNMESLLQSGQILSDHISNTIFDLPAVQAVEME---FCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIK 1328
            ++ L+  +LT +P TL     +  L++  N ++S+P  +  L +L VL +  N         +T + K + NL  L  L++ E  +  +PA I E+ SL  LD++ N +  L  +IGN  Q+  L+ QH  L  LP  I     L  L L  N +  +P  LA+   L+ L++   N+  L E       N+ SL  +      +          V ++ ME     KI +    ++KAL +L++  N    +P  +    ++  L+L+ N L  I DD+ +L +L  L L  N + K+   L  ++ L+ LDL  NK++ L   + Y  K L+ L + +N + ++P  I +L  L +L V  N ++ +P ++  ++N++
Sbjct:   99 TLALNENSLTGLPDTLTGLTSLRMLDLRHNKLRSIPPVVYRLTSLTVLYLRFN--------RITQVEKDIGNLSKLTMLSVRENKIKLLPAEIGELRSLLTLDVAHNQLEHLPEEIGNCVQVTNLDLQHNELLDLPDSIGNLASLNRLGLRYNRLSAVPTTLANCTELEDLNLENNNISTLPEGLLSSLVNLSSLTLARNCFQAYPVGGPSQFTTVYSLNMEHNHIGKIPFGIFSRAKALSKLNMKDNQLTSLPLDIGTWKSMVELNLATNQLTKIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYL-KDLQKLVLTNNQLTSLPRGIGHLCSLTHLMVGENQLTHVPEEIGTLENLE 469          

HSP 2 Score: 51.2174 bits (121), Expect = 9.982e-7
Identity = 95/431 (22.04%), Postives = 189/431 (43.85%), Query Frame = 3
Query:  282 THLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSI---NLRHLGEKIDSNMESL---LQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKA--LLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXT--TLYLQGNQIEKITKSLF-QMKSLKVLDLSHNKIKKLTISLDYYNK----------------------SLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIK----TAHYFNGLHR-IG-------LWVSSNPIEFPPKCVWNTTNIDVIY 1439
            T L++++ +I SLP +I +L  L  L +  N   C        LP  +  L  L  L ++E +L  +P T+  +TSL  LD+  N +  +   +  L  L  L  +   +  + ++I    KL  L +  N I+ +P  + ++ SL TL +    L HL E+I + ++     LQ  ++L   + ++I +L ++  + + + +++   +  +    L +L++  N    +PE +L+                        +  T  +L ++ N I KI   +F + K+L  L++  N++  L + +  +                        SLE L +++N ++ +P+ +  L KL  LD+  N +  LP ++  +K+++    T +    L R IG       L V  N +   P+ +    N++ +Y
Sbjct:   52 TRLDLAKRSIASLPPNIKELTQLTELYLYGNRLPC--------LPTEIGCLVNLVTLALNENSLTGLPDTLTGLTSLRMLDLRHNKLRSIPPVVYRLTSLTVLYLRFNRITQVEKDIGNLSKLTMLSVRENKIKLLPAEIGELRSLLTLDVAHNQLEHLPEEIGNCVQVTNLDLQHNELLD--LPDSIGNLASLNRLGLRYNRLSAVPTTLANCTELEDLNLENNNISTLPEGLLSSLVNLSSLTLARNCFQAYPVGGPSQFTTVYSLNMEHNHIGKIPFGIFSRAKALSKLNMKDNQLTSLPLDIGTWKSMVELNLATNQLTKIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLPRGIGHLCSLTHLMVGENQLTHVPEEIGTLENLEELY 472          
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Match: LRRC2 (leucine rich repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:14676])

HSP 1 Score: 68.9366 bits (167), Expect = 1.629e-12
Identity = 59/190 (31.05%), Postives = 103/190 (54.21%), Query Frame = 3
Query:  195 NNED--DFKSINLSNTALTVVP--VTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECN-LVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHL 749
            +NED  D   + + N+ L V+P  V  F+R++   L++S+N ++ LP +I  L  L+ L +S N            +P+ + + + L+ L++S  N L  +P  +  +  L  LD+S N    +   +  +  LQWL+     L  LPQ+I   E++ET+LL+ N I+ +P  L+D+G L+TL ++  HL
Sbjct:  116 SNEDMVDLNELRVLNSRLHVLPRFVANFQRLQT--LDLSKNCLQELPKEIGLLKGLQQLLLSYNQLRR--------IPEELGDCESLERLDLSSNNSLEELPYQLSSLKKLVLLDLSVNKFSSVPIAVLRMSGLQWLDMSKNRLHELPQDIDRLERVETMLLHHNSIRYLPLALSDMGELRTLVVSADHL 295          
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 68.5514 bits (166), Expect = 5.445e-12
Identity = 48/170 (28.24%), Postives = 89/170 (52.35%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTL 728
            +++S   L  +P  +     +T    S+N+++ LP ++  L +L +L   +N         +T LP+++ + + L  L ++E  LV +PA+I ++T L  L++ KN +  +  +IG    L  L+ +   L  +P EI G  ++  L L GN ++ +P  LA + SLK L
Sbjct:  172 LDISQNRLERLPDAIGGLAALTDFLASQNHLEELPEELGKLKHLSILKADQN--------RLTHLPEAIGDCENLTELILTENQLVTLPASIGKLTKLTNLNLDKNRLNSIPPEIGGCGALNVLSLRDNRLTQVPGEISGASQIHVLDLAGNRLENLPIELAKL-SLKAL 332          

HSP 2 Score: 65.0846 bits (157), Expect = 6.211e-11
Identity = 94/350 (26.86%), Postives = 169/350 (48.29%), Query Frame = 3
Query:  264 FKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLP-AVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLC 1310
            F+   +  L +S+N ++ LP DI++ ++L  L++SRN        D+  +P S+K   CL+ ++ S   L  +P    ++ SL  L ++  ++  L  DIGNL  L  L  +   LKTLP  +    KLE L L  N ++T+P  L  + +++ L ++   L E + S +  L +   +  D   N +  LP A+  +                AL +   S N  +E+PE +  L +L IL   +N L ++ + +   ENLT L L  NQ+  +  S+ ++  L  L+L  N++  +   +     +L  L +  N +  +P +I    ++  LD++ N +  LP++L 
Sbjct:    3 FRLHNLRKLGLSDNELQRLPPDIANFMHLVDLDMSRN--------DIAEIPDSIKLCTCLEVVDFSGNPLTRLPEGFTQLKSLIYLSLNDVSLQGLPDDIGNLSNLVTLELRENLLKTLPTSLHLLVKLEQLDLGNNELETLPGSLGSLPNVRELWLDGNQL-EALPSEIGELRR--LVCLDISQNRLERLPDAIGGL---------------AALTDFLASQNHLEELPEELGKLKHLSILKADQNRLTHLPEAIGDCENLTELILTENQLVTLPASIGKLTKLTNLNLDKNRLNSIPPEIGGCG-ALNVLSLRDNRLTQVPGEISGASQIHVLDLAGNRLENLPIELA 325          

HSP 3 Score: 64.6994 bits (156), Expect = 9.750e-11
Identity = 49/172 (28.49%), Postives = 82/172 (47.67%), Query Frame = 3
Query:  216 SINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLS 731
            ++ L    L  +P +L   +++  L++  N +++LP  +  L N+  L +  N         +  LP  +  L+ L  L+IS+  L  +P  I  + +L     S+N++ EL  ++G L  L  L A    L  LP+ I  CE L  L+L  N + T+P   A IG L  L+
Sbjct:  102 TLELRENLLKTLPTSLHLLVKLEQLDLGNNELETLPGSLGSLPNVRELWLDGN--------QLEALPSEIGELRRLVCLDISQNRLERLPDAIGGLAALTDFLASQNHLEELPEELGKLKHLSILKADQNRLTHLPEAIGDCENLTELILTENQLVTLP---ASIGKLTKLT 262          
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Match: lrch3 (leucine-rich repeats and calponin homology (CH) domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-071004-44])

HSP 1 Score: 64.6994 bits (156), Expect = 2.914e-11
Identity = 47/138 (34.06%), Postives = 73/138 (52.90%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEI 632
            +N+S   LT +P  L K + +  LN S N + SLP ++  L  L  L++S N        ++  LP  + +L CL+ LN+   NLV +P  I ++  L QLD+S N +GE+      L QLQ L   +  +K+ P +I
Sbjct:   49 LNISRNQLTTLPPYLCK-LPLQVLNASNNKLVSLPEELGQLKELSALDVSCN--------EIQALPPQVASLTCLRDLNVRRNNLVILPDEIADLP-LVQLDVSCNRLGEIPVSFRKLKQLQSLVLDNNPMKSPPAQI 176          

HSP 2 Score: 55.8398 bits (133), Expect = 1.954e-8
Identity = 46/138 (33.33%), Postives = 68/138 (49.28%), Query Frame = 3
Query:  222 NLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIV 635
            +LS   L  VP+ +   + +  L +  N I+S+P  I +L +L  LNISRN         +T LP  +  L  L+ LN S   LV +P  + ++  L  LD+S N I  L   + +L  L+ LN +   L  LP EI 
Sbjct:    4 DLSKNRLNEVPLEVCHFVSLESLVLYHNCIRSIPEAIVNLRSLTYLNISRN--------QLTTLPPYLCKLP-LQVLNASNNKLVSLPEELGQLKELSALDVSCNEIQALPPQVASLTCLRDLNVRRNNLVILPDEIA 132          
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Match: lrrc40 (leucine rich repeat containing 40 [Source:NCBI gene;Acc:334130])

HSP 1 Score: 63.5438 bits (153), Expect = 1.798e-10
Identity = 48/156 (30.77%), Postives = 77/156 (49.36%), Query Frame = 3
Query:  279 ITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRH 746
            +T L+V +N +  LP  + +LVNL+ LN+S N            LP+S+  +  L  L++    L  I   I  +  L +LD+S N +  L   +G L ++  LN     L+ LP EI   + L  L    N+++++P  L  + SL+ L   LRH
Sbjct:  109 LTVLDVHDNQLTELPQVLGELVNLQKLNVSHNKLQT--------LPESLWAISSLLSLHVEHNELEGISNNIGNLARLEELDLSSNRLTALPGTLGKLTRVTKLNVAENKLRELPTEIKSMKGLCQLEATHNLLESVPAALGGMASLQQLY--LRH 254          
BLAST of Roc domain-containing protein vs. Ensembl Yeast
Match: CYR1 (Adenylate cyclase; required for cAMP production and cAMP-dependent protein kinase signaling; the cAMP pathway controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000003542])

HSP 1 Score: 56.9954 bits (136), Expect = 1.481e-8
Identity = 90/315 (28.57%), Postives = 144/315 (45.71%), Query Frame = 3
Query:  216 SINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSD-HISNTIFDLPAVQAVEMEFCKINY--FKSFQSKALLELHISGNFFQEIP-ETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIK 1148
            S+ + N   +  P  + K  ++  L +  N I+ +P  I  L NL +LN+      C   +++  LP     LK L+ L++S    +  P  I   T+L Q+D+S N I  L      L +L  +N  H  L  +  ++     L TL L  N I +I          KT + NL++L                 L+D  ISN    LP ++A+E++   I    FK F  K +  L ++      IP E +  L+ L+ L+L++N L  +  ++ KL  L  L +  N++E I   L Q+KSL+ LDL  N I+
Sbjct:  844 SLRMVNIRASKFPSNITKAYKLVSLELQRNFIRKVPNSIMKLSNLTILNL-----QC---NELESLPAGFVELKNLQLLDLSSNKFMHYPEVINYCTNLLQIDLSYNKIQSLPQSTKYLVKLAKMNLSHNKLNFI-GDLSEMTDLRTLNLRYNRISSI----------KTNASNLQNL----------------FLTDNRISNFEDTLPKLRALEIQENPITSISFKDFYPKNMTSLTLNKAQLSSIPGELLTKLSFLEKLELNQNNLTRLPQEISKLTKLVFLSVARNKLEYIPPELSQLKSLRTLDLHSNNIR 1123          
BLAST of Roc domain-containing protein vs. Ensembl Yeast
Match: CCR4 (Component of the CCR4-NOT transcriptional complex; CCR4-NOT is involved in regulation of gene expression; component of the major cytoplasmic deadenylase, which is involved in mRNA poly(A) tail shortening [Source:SGD;Acc:S000000019])

HSP 1 Score: 50.0618 bits (118), Expect = 1.638e-6
Identity = 30/110 (27.27%), Postives = 62/110 (56.36%), Query Frame = 3
Query:  408 ILPKSMK-NLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSI 734
            ++PK  K + +    L++S   +  I A I++   L +L ++ N++ EL ++I NL  L+ L+  H  L +LP E+  C +L+    + N++ T+P+   ++ +L+ L +
Sbjct:  324 VMPKDSKYDDQLWHALDLSNLQIFNISANIFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPAELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGV 433          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO37227 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD7])

HSP 1 Score: 89.3521 bits (220), Expect = 6.365e-20
Identity = 56/164 (34.15%), Postives = 93/164 (56.71%), Query Frame = 3
Query:  240 LTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLS 731
            L V+PV+     ++  + +  N + SLP +IS L +L+ L +  N        ++T LP+ + ++KCL+ LN+S   L  +P TI ++  L  L I+ N +  L  ++G+L QLQ L+  +  L  LP ++  C +LETLL  GN+++ +P  L D+  LK LS
Sbjct:   27 LNVLPVSFLHLKKVQRVYLKYNLLTSLPQEISRLSSLKELYLHSN--------NLTHLPQEIGHIKCLESLNVSHNFLQNLPPTIGQLQHLQYLHIANNQLHSLPREVGHLKQLQVLDIMNNNLHQLPWQLSDCVRLETLLFDGNLVEWLPQQLTDLKGLKELS 182          

HSP 2 Score: 47.3654 bits (111), Expect = 9.516e-6
Identity = 32/111 (28.83%), Postives = 59/111 (53.15%), Query Frame = 3
Query:  402 MTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSI 734
            + +LP S  +LK ++ + +    L  +P  I  ++SL +L +  NN+  L  +IG++  L+ LN  H  L+ LP  I   + L+ L +  N + ++P    ++G LK L +
Sbjct:   27 LNVLPVSFLHLKKVQRVYLKYNLLTSLPQEISRLSSLKELYLHSNNLTHLPQEIGHIKCLESLNVSHNFLQNLPPTIGQLQHLQYLHIANNQLHSLP---REVGHLKQLQV 134          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO46974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNR2])

HSP 1 Score: 86.2705 bits (212), Expect = 1.054e-17
Identity = 89/329 (27.05%), Postives = 158/329 (48.02%), Query Frame = 3
Query:  207 DFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLET 1193
            + + I+ S   +  +P T      +THL +++  +  LP +   L++L +L +  N         + +LPKSM  LK L+ L+I       +P  +  + +L +L +  N I ELR +IG L +L +L+     L+ LP EI   + L  L L  N++  IP  +  +G L+TL +   HLGE + +++  L++  +++     N +  LP           + Y +  +      L+I  NF + IP  + +   + IL L  N L+++ D + ++  L  + L  N++E +  S  ++ SLK L LS N+ K +      YN S  T
Sbjct:   95 NLQEIDASVNPIGKIPETFCHLANLTHLYLNDAFLDFLPGNFGRLISLRILELREN--------HLRVLPKSMSQLKNLERLDIGNNEFTELPMVVGCLLNLTELWMDSNAIKELRPEIGLLRRLMFLDVSKNRLEWLPPEIESLQSLTDLYLSNNLLIEIPEQIGALGKLQTLKLEENHLGE-LPNSIGKLVELEELIL--TCNELVSLPP---------SLGYLRKLRV-----LNIDENFLESIPSELGSCTAMTILSLRDNRLVHLPDSIGRMPKLQVINLASNRLEYLPYSFHKLVSLKALWLSENQSKPMIPLQSDYNTSTNT 398          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO37499 (Leucine-rich repeat protein soc-2 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7SFP1])

HSP 1 Score: 87.0409 bits (214), Expect = 1.514e-17
Identity = 64/176 (36.36%), Postives = 92/176 (52.27%), Query Frame = 3
Query:  210 FKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNV-IQTIPYLLADIGSLKTLSI 734
               +N+ +  LT +P+     I +  LNV+ N I  LP DI  LVNLEVL +S N         +  LP+ +  L+ L+ L+I E  L  IP  I  + SL +L +  N +G L   IG L  + +L+     L ++PQEI   E LE L L  N  +Q++PY L   GSL+ +SI
Sbjct:  367 LSKLNVKDNQLTSLPLDFGSWISLVELNVATNQISKLPEDIQWLVNLEVLILSNN--------LLKKLPRGIGALRKLRVLDIEENKLESIPTEIEYLRSLERLVLQSNCLGSLPRSIGYLSSVTYLSVGENELVSVPQEIGNMESLEQLYLNDNENLQSLPYELVLCGSLQIMSI 534          

HSP 2 Score: 82.0333 bits (201), Expect = 4.483e-16
Identity = 108/466 (23.18%), Postives = 197/466 (42.27%), Query Frame = 3
Query:  177 NRDARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPK---------------------------------------SMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSI---NLRHLGEKIDSNMESLLQSGQILSDHISNTIFDL-PAVQAVEMEFCKINYF-----------------KSFQSK-------------------ALLELHISGNFFQEIPETV---LNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIK 1328
            +++ +K  E+    ++LS  A+TV+P  L +   +  L +  N I  LP ++  L NLE L +S N    T PD++  L K                                        + NLK L+ L++ E  +  +P  I ++  L  LDIS N+I  L ++IGN   +  L+ QH  + +LP  I     +  L L  N + ++P  LA+   +   +I   N+  L EK+ S++++L       S  +S   F++ PA      +FC++N F                   + SK                   +L+EL+++ N   ++PE +   +NL                            L L  N ++K+ + +  ++ L+VLD+  NK++ +   ++Y  +SLE L +  N + ++P  I YL  +  L V  N +  +P ++  M++++
Sbjct:   77 HKEIQKCREEGATRLDLSKAAVTVLPKELKELTSLRELYLYGNRIAVLPPEVGLLPNLETLALSENNL-TTLPDNLVKLTKLKVLDLRHNKIKEIPDVIYKLTTLTTLYLRFNRISVVESGIGNLKLLERLSLRENKIKILPRVIGQLVHLVTLDISHNHIENLPAEIGNCVHMTSLDLQHNDIPSLPDSIGRLTAMTRLGLRYNQLSSLPDSLANCSGIDEFNIEGNNIAELPEKLLSSLKNL------TSLTLSRNKFEVFPA--GPPKQFCQVNTFIMEHNRMQKIPFGVFNKAKYLSKLNVKDNQLTSLPLDFGSWISLVELNVATNQISKLPEDIQWLVNLE--------------------------VLILSNNLLKKLPRGIGALRKLRVLDIEENKLESIPTEIEYL-RSLERLVLQSNCLGSLPRSIGYLSSVTYLSVGENELVSVPQEIGNMESLE 506          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO35138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMB5])

HSP 1 Score: 66.2402 bits (160), Expect = 8.260e-12
Identity = 49/167 (29.34%), Postives = 77/167 (46.11%), Query Frame = 3
Query:  219 INLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSP---------------DDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGN 674
            +NL N  +T +P +L     + +LN+  N +K  P ++S L  L VL+++ N                      + + +LP    +  CL YL++   +LV  P  I ++TSL  L +S N+I EL   I  L  L+ L      ++ LP  I   EKL+ L L  N
Sbjct:   88 LNLQNNQITNLPSSLADMNGLCYLNLEANELKIFPEEVSQLSRLRVLHLNSNNLRALPESFKLLNHLRILYLKDNKLRVLPDWFASFHCLAYLSMENNDLVCFPGEISKLTSLEVLILSGNSIRELPDSIKELVNLKELFLGRNKIRKLPPSITKLEKLQVLYLQEN 254          

HSP 2 Score: 61.2326 bits (147), Expect = 3.875e-10
Identity = 56/213 (26.29%), Postives = 91/213 (42.72%), Query Frame = 3
Query:  207 DFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSP----------------DDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQ--------------WLNAQHC---------GLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTL 728
              + +NLS   +T  P   F    +T L +  + ++ LPA +  LV LEVL+++ N F  T P                + +T LP S+ ++  L YLN+    L   P  + +++ L  L ++ NN+  L      L+ L+              W  + HC          L   P EI     LE L+L GN I+ +P  + ++ +LK L
Sbjct:   15 QLQVLNLSGNHITNFPYRFFMLRFLTELYLRNDFLEFLPAQVCTLVQLEVLDLA-NNFIRTLPYSSGHLTRLRWLNLQNNQITNLPSSLADMNGLCYLNLEANELKIFPEEVSQLSRLRVLHLNSNNLRALPESFKLLNHLRILYLKDNKLRVLPDWFASFHCLAYLSMENNDLVCFPGEISKLTSLEVLILSGNSIRELPDSIKELVNLKEL 226          

HSP 3 Score: 59.3066 bits (142), Expect = 1.373e-9
Identity = 76/292 (26.03%), Postives = 129/292 (44.18%), Query Frame = 3
Query:  309 IKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHIS------NTIFDLP-------AVQAVEMEFCKINYFKSFQSK--ALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHN 1139
            ++  P  I +L  L+VLN+S  G H T+       P     L+ L  L +    L F+PA +  +  L  LD++ N I  L    G+L +L+WLN Q+  +  LP  +     L  L L  N ++  P  ++ +  L+ L +N         +N+ +L +S ++L +H+       N +  LP        +  + ME   +  F    SK  +L  L +SGN  +E+P+++  L                        NL  L+L  N+I K+  S+ +++ L+VL L  N
Sbjct:    3 LQYFPEQILELTQLQVLNLS--GNHITN------FPYRFFMLRFLTELYLRNDFLEFLPAQVCTLVQLEVLDLANNFIRTLPYSSGHLTRLRWLNLQNNQITNLPSSLADMNGLCYLNLEANELKIFPEEVSQLSRLRVLHLN--------SNNLRALPESFKLL-NHLRILYLKDNKLRVLPDWFASFHCLAYLSMENNDLVCFPGEISKLTSLEVLILSGNSIRELPDSIKEL-----------------------VNLKELFLGRNKIRKLPPSITKLEKLQVLYLQEN 254          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO33432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS78])

HSP 1 Score: 67.781 bits (164), Expect = 1.739e-11
Identity = 133/510 (26.08%), Postives = 226/510 (44.31%), Query Frame = 3
Query:  261 LFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN---LRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNT-----TNIDVIYSFLQKTKIKRLQIKSPIRVVLIGDNSIKDNFLERFLGKRISND--SEYLTINQWTSENSVPFVLVNVNCHPTYVMH------IRHYMEDNAFIWIFIDHFKTKNLLKES 1742
             F+   I  L +S+N I  LP ++ +L NL+  +ISRN        D+  +P+++K  K L  L++S   +  +P    ++  L  L ++  ++  L  DIG+L +L  L A+   +K LP  +    KLE L L  N ++ +P ++  + SL    ++   L+ L  +I  N++ L    QI  D   N I  LP     E+ FC           +L +LH+S N  +E+P+T+  L  LQ+L + +N L+ +   +     L  L L  N ++ +  ++ ++  L +L++  N+++ L + L    K L    +  N ++ +P +I     L  LDVS N +  LPL +  +  +K            LW+S N  +  P     T     TN  V+  FL   +               G  S+  N  E++L  RI N   S+  TIN    E+ + F     + HP    H        HY++D        +  K K LL ++
Sbjct:    2 FFRLYNIRRLGLSDNEIARLPPEVGNLANLQEFDISRN--------DICDIPENIKYCKSLVSLDLSGNPISKLPDGFSQLQHLTTLCLNDVSLIRLPPDIGSLTELTVLEARENLIKFLPVSLAFLSKLERLDLGCNELEELPDVVGSLPSLAEFWLDGNLLKTLPTEI-GNLKKL----QIF-DVSENKIEYLPD----EICFC----------GSLTDLHLSQNLLEELPDTIGKLKKLQLLKVDQNRLITLTPAIGGCIALQELILTENLLDVLPSTMGKLHKLSLLNVDRNRLEVLPVELGSCTK-LSVFSLRDNLLQRLPTEIGNCRNLHVLDVSGNRLECLPLTIGTLP-LKA-----------LWLSEN--QSQPVLKLQTEEDEKTNSKVLTCFLLPQQ---------------GMGSLV-NLSEKYLSGRIHNKTRSKGKTINAEWREHMIRF---EGDDHPERQDHRLRRRDTPHYLKDKRIQLKGDEEVKVKELLAKA 449          

HSP 2 Score: 52.7582 bits (125), Expect = 7.481e-7
Identity = 56/191 (29.32%), Postives = 88/191 (46.07%), Query Frame = 3
Query:  225 LSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDD----------------MTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHL 749
            L++ +L  +P  +    E+T L   EN IK LP  ++ L  LE L++  N      PD                 +  LP  + NLK L+  ++SE  + ++P  I    SL  L +S+N + EL   IG L +LQ L      L TL   I GC  L+ L+L  N++  +P  +  +  L  L+++   L
Sbjct:   82 LNDVSLIRLPPDIGSLTELTVLEARENLIKFLPVSLAFLSKLERLDLGCNELE-ELPDVVGSLPSLAEFWLDGNLLKTLPTEIGNLKKLQIFDVSENKIEYLPDEICFCGSLTDLHLSQNLLEELPDTIGKLKKLQLLKVDQNRLITLTPAIGGCIALQELILTENLLDVLPSTMGKLHKLSLLNVDRNRL 271          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:NCBI gene;Acc:101173528])

HSP 1 Score: 82.0333 bits (201), Expect = 2.402e-15
Identity = 115/508 (22.64%), Postives = 207/508 (40.75%), Query Frame = 3
Query:  276 EITHLNVSENNIKSLPADISDLVN-LEVLNISRNGFHCT---------------SPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTL---SINLRHLGEKID--SNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLW-VSSNPIEFPPKCVWNTTNIDVIYSFLQKTKIKRLQIKSPIRVVLIGDNSIKDNFLER-FLGKRI-SNDSEYLTINQWTSE--NSVPFVLVNVNCHPTYVMHIRHYMEDNAFIWIFIDHFKT 1721
            E+  LN+  N+++ LP ++   +N L VL + RN F                  S + +  L + +  L+ LK L +S   +  +PA I  + +L +LDIS N +  L     +L +L+ L+A H  L   P EI+   +LE L L GN    +P  +  + S+K L   S+ +  L E      N+ESL+  G  LS              A+   F  +   K         +++S N  Q  P+ +L +                         L  LYL  N++  + + + Q+  L  L L +N I +L  S+                        + LE LE L +  N+I+ LP +            F  L R+ +W V  NP+  PP  V     I  I  + Q+    +L +K  +++VL+G        L R  +G R     +  + +  W ++    + F++ +++ +P + + ++ +      +++ + + K+
Sbjct:   62 EVEALNLGNNSLQELPEELGSSLNKLRVLELRRNKFTAAPRVLCELGQLVELDMSHNCLRTLSEGLGQLRALKKLCVSHNKIQSLPAQIGALQALEELDISFNLLHGLPRSFSSLTRLRALDADHNQLSQFPVEILALGQLEELDLSGNRFVALPANIWRLTSIKVLWLSSLRMASLPETFCRLQNLESLMLDGNRLS--------------ALPPSFGLLQRLKM--------MNLSSNQLQVFPQALLGV-----------------------CGLEELYLSRNRLSHVPEEISQLGRLVNLWLDNNSITRLPDSI------------------------VDLENLEELVLQGNHIAVLPDN------------FGKLSRVNIWKVKDNPLIQPPYEVC-MKGIPYIALYQQELAQSQLAVKPRLKLVLMGRKDAGKTLLRRSLMGTREDGGGNRGVELVHWEADAHRKLTFMVFDLSGNPNFDL-VKPFFLSPGALYVLVVNLKS 486          

HSP 2 Score: 61.2326 bits (147), Expect = 6.027e-9
Identity = 46/162 (28.40%), Postives = 74/162 (45.68%), Query Frame = 3
Query:  207 DFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIP 692
              + ++LS      +P  +++   I  L +S   + SLP     L NLE L +  N         ++ LP S   L+ LK +N+S   L   P  +  +  L +L +S+N +  +  +I  L +L  L   +  +  LP  IV  E LE L+L GN I  +P
Sbjct:  201 QLEELDLSGNRFVALPANIWRLTSIKVLWLSSLRMASLPETFCRLQNLESLMLDGN--------RLSALPPSFGLLQRLKMMNLSSNQLQVFPQALLGVCGLEELYLSRNRLSHVPEEISQLGRLVNLWLDNNSITRLPDSIVDLENLEELVLQGNHIAVLP 354          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: erbin (erbb2 interacting protein [Source:NCBI gene;Acc:101172095])

HSP 1 Score: 80.1073 bits (196), Expect = 8.078e-15
Identity = 75/285 (26.32%), Postives = 129/285 (45.26%), Query Frame = 3
Query:  318 LPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKS--FQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            LPA    L  L++L +  N         +  LPKSM+ L  L+ L++       +P  +  ++ + +L +  N +  L + +G L  L++L+     L+ + ++I GCE L+ LLL  N +  +P   A IGSLK L+        K+D N        Q++   + +++  L A+  ++  F +I    S   Q  A+       NF  E+P  + N                         NLT L+L  N++E + + +  M+ LKV++LS+NK+K L  S 
Sbjct:  152 LPASFGRLAKLQILELREN--------QLQNLPKSMQKLTQLERLDLGSNEFTEVPEVLEHLSGIKELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNALTQLP---ASIGSLKKLT------ALKVDEN--------QLM--FLPDSVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWK-----------------------NLTVLFLHSNKLESLPEEMGDMQKLKVINLSNNKLKNLPYSF 386          

HSP 2 Score: 78.1814 bits (191), Expect = 3.544e-14
Identity = 53/175 (30.29%), Postives = 94/175 (53.71%), Query Frame = 3
Query:  213 KSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN 737
            K + +    LTV+P  + K   + +L++S+NN++ +   IS   NL+ L +S N         +T LP S+ +LK L  L + E  L+F+P ++  +T++ +LD S N I  L S IG    ++   A H  L  LP E+   + L  L L+ N ++++P  + D+  LK ++++
Sbjct:  209 KELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNA--------LTQLPASIGSLKKLTALKVDENQLMFLPDSVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWKNLTVLFLHSNKLESLPEEMGDMQKLKVINLS 375          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: lrch4 (leucine-rich repeat and calponin homology domain-containing protein 4 [Source:NCBI gene;Acc:101159618])

HSP 1 Score: 76.6406 bits (187), Expect = 9.266e-15
Identity = 71/251 (28.29%), Postives = 117/251 (46.61%), Query Frame = 3
Query:  144 INMDERSLENENRDARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEI---------VGCEK-------------LETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIF 830
            +N+  R L+   R AR  +  D    +LS   L  +P  L   I +  L++  N ++SL +++ +L  L  LN+SRN         ++ LP S+  L  L+ L +S   L  +P++++ +T L QLD+S N +  L +++  L+ L+ LN +   L TLP+EI         V C +             L+ LLL  N +QT P  +   G          H+ + +  NME+  +S   L  H+  T F
Sbjct:   51 LNLSNRKLKEFPRTARNYDLSDITHADLSKNRLCELPEELCHFISLETLSLYHNGMRSLSSNLGNLQALTYLNLSRN--------LLSSLPPSVFQLSLLRVLILSNNKLTSLPSSVFSLTQLRQLDVSCNELQSLPAELCQLECLRDLNLRRNRLTTLPEEISELPLVRLDVSCNRITNVPLCYRHLRHLQVLLLDNNPLQTPPAQVCSKGKY--------HIFKYL--NMEACKRSQSELEKHLRPTGF 283          

HSP 2 Score: 72.0182 bits (175), Expect = 3.709e-13
Identity = 51/167 (30.54%), Postives = 91/167 (54.49%), Query Frame = 3
Query:  216 SINLSNTALTVVPVTL--FKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADI 710
            ++NLSN  L   P T   +   +ITH ++S+N +  LP ++   ++LE L++  NG        M  L  ++ NL+ L YLN+S   L  +P ++++++ L  L +S N +  L S + +L QL+ L+     L++LP E+   E L  L L  N + T+P  ++++
Sbjct:   50 ALNLSNRKLKEFPRTARNYDLSDITHADLSKNRLCELPEELCHFISLETLSLYHNG--------MRSLSSNLGNLQALTYLNLSRNLLSSLPPSVFQLSLLRVLILSNNKLTSLPSSVFSLTQLRQLDVSCNELQSLPAELCQLECLRDLNLRRNRLTTLPEEISEL 208          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: erbin (erbb2 interacting protein [Source:NCBI gene;Acc:101172095])

HSP 1 Score: 79.7221 bits (195), Expect = 1.158e-14
Identity = 75/285 (26.32%), Postives = 129/285 (45.26%), Query Frame = 3
Query:  318 LPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKS--FQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            LPA    L  L++L +  N         +  LPKSM+ L  L+ L++       +P  +  ++ + +L +  N +  L + +G L  L++L+     L+ + ++I GCE L+ LLL  N +  +P   A IGSLK L+        K+D N        Q++   + +++  L A+  ++  F +I    S   Q  A+       NF  E+P  + N                         NLT L+L  N++E + + +  M+ LKV++LS+NK+K L  S 
Sbjct:  152 LPASFGRLAKLQILELREN--------QLQNLPKSMQKLTQLERLDLGSNEFTEVPEVLEHLSGIKELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNALTQLP---ASIGSLKKLT------ALKVDEN--------QLM--FLPDSVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWK-----------------------NLTVLFLHSNKLESLPEEMGDMQKLKVINLSNNKLKNLPYSF 386          

HSP 2 Score: 77.7962 bits (190), Expect = 5.029e-14
Identity = 53/175 (30.29%), Postives = 94/175 (53.71%), Query Frame = 3
Query:  213 KSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN 737
            K + +    LTV+P  + K   + +L++S+NN++ +   IS   NL+ L +S N         +T LP S+ +LK L  L + E  L+F+P ++  +T++ +LD S N I  L S IG    ++   A H  L  LP E+   + L  L L+ N ++++P  + D+  LK ++++
Sbjct:  209 KELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNA--------LTQLPASIGSLKKLTALKVDENQLMFLPDSVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWKNLTVLFLHSNKLESLPEEMGDMQKLKVINLS 375          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: erbin (erbb2 interacting protein [Source:NCBI gene;Acc:101172095])

HSP 1 Score: 79.7221 bits (195), Expect = 1.158e-14
Identity = 75/285 (26.32%), Postives = 129/285 (45.26%), Query Frame = 3
Query:  318 LPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKS--FQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISL 1166
            LPA    L  L++L +  N         +  LPKSM+ L  L+ L++       +P  +  ++ + +L +  N +  L + +G L  L++L+     L+ + ++I GCE L+ LLL  N +  +P   A IGSLK L+        K+D N        Q++   + +++  L A+  ++  F +I    S   Q  A+       NF  E+P  + N                         NLT L+L  N++E + + +  M+ LKV++LS+NK+K L  S 
Sbjct:  152 LPASFGRLAKLQILELREN--------QLQNLPKSMQKLTQLERLDLGSNEFTEVPEVLEHLSGIKELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNALTQLP---ASIGSLKKLT------ALKVDEN--------QLM--FLPDSVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWK-----------------------NLTVLFLHSNKLESLPEEMGDMQKLKVINLSNNKLKNLPYSF 386          

HSP 2 Score: 77.7962 bits (190), Expect = 5.029e-14
Identity = 53/175 (30.29%), Postives = 94/175 (53.71%), Query Frame = 3
Query:  213 KSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSIN 737
            K + +    LTV+P  + K   + +L++S+NN++ +   IS   NL+ L +S N         +T LP S+ +LK L  L + E  L+F+P ++  +T++ +LD S N I  L S IG    ++   A H  L  LP E+   + L  L L+ N ++++P  + D+  LK ++++
Sbjct:  209 KELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNA--------LTQLPASIGSLKKLTALKVDENQLMFLPDSVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWKNLTVLFLHSNKLESLPEEMGDMQKLKVINLS 375          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000038728.1 (SMESG000038728.1)

HSP 1 Score: 1772.29 bits (4589), Expect = 0.000e+0
Identity = 926/942 (98.30%), Postives = 926/942 (98.30%), Query Frame = 3
Query:  150 MDERSLENENRDARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQKTKIKRLQIKSPIRVVLIGDNSIKDNFLERFLGKRISNDSEYLTINQWTSENSVPFVLVNVNCHPTYVMHIRHYMEDNAFIWIFIDHFKTKNLLKESEKWIDLVMEYSTDCVIQIVIVNYFENNSEDIFQNFVNFSDKKLIESLRERFSNEKVNILPNILLISPGESLNAFKDDLEYIAIDKDLFQSDEMFNIFTRETKAIENICKSTKCIYVNLNDLISKIREMFPFPTDSIFSCLKCLHKQGKILWFYKNKKLSNKIYPFISLFNKSIRSLIRLDYEEDLDFAKNPLIKAKGLMNGEKFEQVKKSFLKYGEICYPLYKVLTFEFQELRSVKDFLIDANIAWGVPLSVDLEEDIFQRPFVVLAQFNKEKFDKSCFLDSILKKESANIDYGFTIRSTSLSDHSNLFLNLKCEVNCWAVRRYDWMNAVYLHHNNGDVLLYNELSTDLQMNITAIVRSWSKMNPDPLPCDGDFRKWITDWYHCESDSRKNFHYNFVDHSLKDIEEYVLNL 2975
            MDERSLENENRDARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNNLQILDLSKNLLLNINDDLIKLENLTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKINHNNIKNIPNDIIYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQKTKIKRLQIKSPIRVVLIGDNSIKDNFLERFLGKRISNDSEYLTINQWTSENSVPFVLVNVNCHPTYVMHIRHYMEDNAFIWIFIDHFKTKNLLKESEKWIDLVMEYSTDCVIQIVIVNYFENNSEDIFQNFVNFSDKKLIESLRERFSNEKVNILPNILLISPGESLNAFKDDLEYIAIDKDLFQSDEMFNIFTRETKAIENICKSTKCIYVNLNDLISKIREMFPFPTDSIFSCLKCLHKQGKILWFYKNKKLSNKIYPFISLFNKSIRSLIRLDYEEDLDFAKNPLIKAKGLMNGEKFEQVKKSFLKY                ELRSVKDFLIDANIAWGVPLSVDLEEDIFQRPFVVLAQFNKEKFDKSCFLDSILKKESANIDYGFTIRSTSLSDHSNLFLNLKCEVNCWAVRRYDWMNAVYLHHNNGDVLLYNELSTDLQMNITAIVRSWSKMNPDPLPCDGDFRKWITDWYHCESDSRKNFHYNFVDHSLKDIEEYVLNL
Sbjct:    1 MDERSLENENRDARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNNLQILDLSKNLLLNINDDLIKLENLTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKINHNNIKNIPNDIIYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQKTKIKRLQIKSPIRVVLIGDNSIKDNFLERFLGKRISNDSEYLTINQWTSENSVPFVLVNVNCHPTYVMHIRHYMEDNAFIWIFIDHFKTKNLLKESEKWIDLVMEYSTDCVIQIVIVNYFENNSEDIFQNFVNFSDKKLIESLRERFSNEKVNILPNILLISPGESLNAFKDDLEYIAIDKDLFQSDEMFNIFTRETKAIENICKSTKCIYVNLNDLISKIREMFPFPTDSIFSCLKCLHKQGKILWFYKNKKLSNKIYPFISLFNKSIRSLIRLDYEEDLDFAKNPLIKAKGLMNGEKFEQVKKSFLKY----------------ELRSVKDFLIDANIAWGVPLSVDLEEDIFQRPFVVLAQFNKEKFDKSCFLDSILKKESANIDYGFTIRSTSLSDHSNLFLNLKCEVNCWAVRRYDWMNAVYLHHNNGDVLLYNELSTDLQMNITAIVRSWSKMNPDPLPCDGDFRKWITDWYHCESDSRKNFHYNFVDHSLKDIEEYVLNL 926          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000038728.1 (SMESG000038728.1)

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 434/434 (100.00%), Postives = 434/434 (100.00%), Query Frame = 3
Query:  150 MDERSLENENRDARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQ 1451
            MDERSLENENRDARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNNLQILDLSKNLLLNINDDLIKLENLTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKINHNNIKNIPNDIIYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQ
Sbjct:    1 MDERSLENENRDARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNNLQILDLSKNLLLNINDDLIKLENLTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKINHNNIKNIPNDIIYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQ 434          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000016748.1 (SMESG000016748.1)

HSP 1 Score: 83.1889 bits (204), Expect = 5.828e-16
Identity = 114/460 (24.78%), Postives = 212/460 (46.09%), Query Frame = 3
Query:  213 KSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELR-SDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHL-------------------GEKIDSNMESLLQSGQILSDHISNT-----------IFDLPAVQAVEME----------FCKINYF----KSFQ--------SKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNGLHRIGLWVSSNPIEFPPKCVWNTTNIDV 1433
            +S+++SN  L V+PV +     + + N S N +K+LP  I  L+ L+ +N+S N         +  +P+ + NLK L+   I+   +V IP++I  ITSL  ++ S N +  L  S +G+L  L+    Q    + +P +I  C +++ L L  N ++ IP  L  + +L+ L ++   +                   G  I    +SL+ + + +  +IS              +DL  ++  E E          FC + Y      +F+           L+EL  S NF  ++P  + +L +L+ L+LS N +L       +L  L+ L +  N+I +I  S+  M  L  LDLS N++     ++ +  + L+ L +++N + N        E+L  +D S+N  +E P++LC+  +I+   +     + G  + S P+E   K +W    +++
Sbjct:  101 QSLDVSNNKLEVIPVEIANLGHLEYFNCSHNKLKALPLTIFGLLKLQYMNLSHN--------QIQDIPEEIGNLKSLQTFLINSNEIVLIPSSISTITSLKTIEASNNQMCHLPISWVGSLKTLKLDGNQ---FQFIPSQIYDCCEMKYLSLAKNYLKFIPIELVKLRNLRQLDLSFNSIEYIPCEMGYWTKLVDFNIHGNNITYFPQSLIANHKFVCLNISGCQLKEFPLLLCNCYDLMELRVGENELNELPDKFQLFCNMKYLFMNNNNFELIPLQVCLLSTLVELDFSHNFLWQVPPGIFSLKHLRKLNLSFNNILIFPGCTAELSYLSELNVSHNKISEICDSISWMTFLYYLDLSFNELSTFPSAI-FQLRYLKYLNLSNNLLDNFSKTDKKWEELRTIDFSNNKFTEFPVELCVHDSIRKLVFD---QKEGTKIKSLPVEI--KNLWRLAELNL 543          

HSP 2 Score: 53.5286 bits (127), Expect = 7.113e-7
Identity = 84/354 (23.73%), Postives = 150/354 (42.37%), Query Frame = 3
Query:  249 VPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXXXXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLC 1310
            VP  ++   ++  +N+S+N I    +D+SD    E++ +S+      + + +  +  ++   + L+ L++S   L  IP  I  +  L   + S N +  L   I  L +LQ++N  H  ++ +P+EI   + L+T L+  N I  IP  ++ I SLKT+  +                          +N +  LP           I++  S ++     L + GN FQ IP  + +                          +  L L  N ++ I   L ++++L+ LDLS N I+ +   + Y+ K L    I+ NNI   P  +I   K   L++S   + E PL LC
Sbjct:   44 VPKEIYFHPDVELINLSKNKI----SDLSD----EIIALSKLRHFFVNGNMLRTINVNLFYARGLQSLDVSNNKLEVIPVEIANLGHLEYFNCSHNKLKALPLTIFGLLKLQYMNLSHNQIQDIPEEIGNLKSLQTFLINSNEIVLIPSSISTITSLKTIEAS--------------------------NNQMCHLP-----------ISWVGSLKT-----LKLDGNQFQFIPSQIYDC-----------------------CEMKYLSLAKNYLKFIPIELVKLRNLRQLDLSFNSIEYIPCEMGYWTK-LVDFNIHGNNITYFPQSLIANHKFVCLNISGCQLKEFPLLLC 323          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000023942.1 (SMESG000023942.1)

HSP 1 Score: 70.4774 bits (171), Expect = 4.834e-12
Identity = 53/172 (30.81%), Postives = 83/172 (48.26%), Query Frame = 3
Query:  225 LSNTALTVVP--VTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSI 734
            L+N  +   P  V LF  +    LN+  N++  LP+ +  L  LE LNI  N         ++ LP  + NLK L   NI+ CNL + P +I ++  L  L+IS+N I  L + I  L +L+WL++    +  LP+       L  +    N+   I  + +D+  LK LS 
Sbjct:  417 LNNNTIIAPPNEVNLFPNL--VELNLEYNSLTMLPSSLCQLTKLEQLNIGNNQ--------LSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSF 578          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000002900.1 (SMESG000002900.1)

HSP 1 Score: 67.3958 bits (163), Expect = 3.475e-11
Identity = 50/165 (30.30%), Postives = 79/165 (47.88%), Query Frame = 3
Query:  213 KSINLSNTALTVVPVTLFKR-IEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTIL----------------PKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQHCGLKTLPQEIVGCEKLET 656
            +++NL +  +T +P  +  R + +THL++ +N +  LP D+    NL  LN+  N      PDD+  L                P ++K L+ L+ L++ E  L F+P  I  +  L +L +  N + EL   IGNL  L +L      L +LP EI     LET
Sbjct:  364 QTLNLDHNQITQIPFGILSRAMFLTHLSMKDNLLTGLPPDVKSWENLVELNLGTNQL-AKVPDDIEYLINLEVLILSNNQFKRLPPTVKKLQKLRILDLEENLLEFLPPDIGCLQELQKLTVQSNRLTELPVSIGNLRNLTYLAVGENDLHSLPSEIGSMSALET 527          

HSP 2 Score: 56.225 bits (134), Expect = 1.059e-7
Identity = 107/409 (26.16%), Postives = 186/409 (45.48%), Query Frame = 3
Query:  207 DFKSINLSNTALTVVPVTLFKRIEITHLNVSENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKYLNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIG--NLDQLQWLNAQHCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHLGEKIDSNMESLLQSGQILSD--HISNTIFDLPA------VQAVEMEFCKINYFKSF------QSKALLELHISGNFFQEIPETVLNLNXXXXXXXXXXXXXXXXXXXXXX-XXXTTLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLKXXXXXXXXXXXXXXYLEKLENLDVSSNNISELPLDLCLMKNIK-TAHYFNGLHRIGLWVSS 1379
            + K + L +  L  +P  L   + +  L + EN++ +LP  +S    L +L+I  N         +  +P+ +  L  L +L +    +  +   I  +  L  L + +N I  L S+ G   L  LQ  +  H  L+ LP+ I  C KL TL L  N ++ IP  + ++ +L+   +   HL     +++   L   ++L +     N I  LP       V    +   + NYF SF      Q  +   L++  N   +IP  +L+          K+ LL      +K  ENL  L L  NQ+ K+   +  + +L+VL LS+N+ K+L  ++    K L  L +  N ++ +P DI  L++L+ L V SN ++ELP+ +  ++N+   A   N LH +   + S
Sbjct:  128 NLKELYLYSNKLINLPNELGNLVNLEILMLQENSLTALPDSLSQCRLLRILDIRHN--------KLCEIPQFVFKLHNLTHLLLRFNRIREVDPEIANLEKLQNLTLRENKIRLLPSNPGLEKLVNLQTFDISHNHLEMLPEAIGHCTKLTTLNLQHNELKLIPETIGNLTALERFGLRYNHL-----TSLPGSLSCCRMLCELNTEGNNISQLPEGLLTHLVHVTSIALSR-NYFSSFPLGGPQQFASTQTLNLDHNQITQIPFGILSRAMFLTHLSMKDNLLTGLPPDVKSWENLVELNLGTNQLAKVPDDIEYLINLEVLILSNNQFKRLPPTVKKLQK-LRILDLEENLLEFLPPDIGCLQELQKLTVQSNRLTELPVSIGNLRNLTYLAVGENDLHSLPSEIGS 521          
The following BLAST results are available for this feature:
BLAST of Roc domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SHOC24.097e-1627.34SHOC2 leucine rich repeat scaffold protein [Source... [more]
LRRC73.884e-1525.55leucine rich repeat containing 7 [Source:HGNC Symb... [more]
LRRC74.672e-1525.55leucine rich repeat containing 7 [Source:HGNC Symb... [more]
LRRIQ45.145e-1523.13leucine rich repeats and IQ motif containing 4 [So... [more]
ERBIN1.078e-1431.93erbb2 interacting protein [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
let-4131.285e-1627.10pep chromosome:WBcel235:V:7972924:7977774:-1 gene:... [more]
let-4131.562e-1628.40pep chromosome:WBcel235:V:7972934:7977774:-1 gene:... [more]
Y42G9A.38.387e-1228.10pep chromosome:WBcel235:III:6146214:6148065:1 gene... [more]
Y42G9A.38.387e-1228.10pep chromosome:WBcel235:III:6146266:6148065:1 gene... [more]
Y42G9A.32.353e-1128.10pep chromosome:WBcel235:III:6146214:6148065:1 gene... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrib3.905e-1323.96gene:FBgn0263289 transcript:FBtr0335521[more]
scrib3.930e-1323.96gene:FBgn0263289 transcript:FBtr0308630[more]
scrib3.992e-1323.96gene:FBgn0263289 transcript:FBtr0308634[more]
scrib4.125e-1323.96gene:FBgn0263289 transcript:FBtr0308622[more]
scrib4.545e-1323.96gene:FBgn0263289 transcript:FBtr0308628[more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc78.112e-1625.07leucine rich repeat containing 7 [Source:ZFIN;Acc:... [more]
erbin1.445e-1425.52erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GEN... [more]
erbin1.445e-1425.52erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GEN... [more]
erbin1.519e-1425.52erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GEN... [more]
lrrc73.324e-1424.46leucine rich repeat containing 7 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRD11.747e-1627.06leucine-rich repeats and death domain containing 1... [more]
prrc2a3.265e-1524.49proline rich coiled-coil 2A [Source:Xenbase;Acc:XB... [more]
prrc2a1.827e-1422.74proline rich coiled-coil 2A [Source:Xenbase;Acc:XB... [more]
prrc2a2.087e-1422.74proline rich coiled-coil 2A [Source:Xenbase;Acc:XB... [more]
prrc2a2.192e-1422.74proline rich coiled-coil 2A [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrc78.822e-1525.23leucine rich repeat containing 7 [Source:MGI Symbo... [more]
Lrrc78.865e-1525.23leucine rich repeat containing 7 [Source:MGI Symbo... [more]
Lrrc78.880e-1525.23leucine rich repeat containing 7 [Source:MGI Symbo... [more]
Lrrc79.267e-1525.23leucine rich repeat containing 7 [Source:MGI Symbo... [more]
Lrrc79.359e-1525.23leucine rich repeat containing 7 [Source:MGI Symbo... [more]
back to top
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7SFP1|SHOC2_NEMVE3.694e-1636.36Leucine-rich repeat protein soc-2 homolog OS=Nemat... [more]
sp|O61967|LAP1_CAEEL1.986e-1528.40Protein lap1 OS=Caenorhabditis elegans OX=6239 GN=... [more]
sp|P0C895|Y2010_ARATH3.300e-1532.26LRR repeats and ubiquitin-like domain-containing p... [more]
sp|B0W6M9|SUR8_CULQU3.469e-1525.74Leucine-rich repeat protein soc-2 homolog OS=Culex... [more]
sp|Q96NW7|LRRC7_HUMAN1.865e-1425.55Leucine-rich repeat-containing protein 7 OS=Homo s... [more]
back to top
BLAST of Roc domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IFK11.093e-9928.46malignant fibrous histiocytoma-amplified sequence ... [more]
A0A1S3IGL41.947e-9928.46malignant fibrous histiocytoma-amplified sequence ... [more]
A0A267GL575.603e-9129.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G5481.463e-9029.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G7R01.477e-9029.06Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC23.143e-1628.41leucine rich repeat containing 2 [Source:NCBI gene... [more]
LRRC23.983e-1628.41leucine rich repeat containing 2 [Source:NCBI gene... [more]
LRRC24.097e-1628.41leucine rich repeat containing 2 [Source:NCBI gene... [more]
lrrc71.015e-1525.97leucine rich repeat containing 7 [Source:ZFIN;Acc:... [more]
erbin1.753e-1423.53erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004940.16.106e-1327.37pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-... [more]
LRRC21.629e-1231.05leucine rich repeat containing 2 [Source:HGNC Symb... [more]
scrib5.445e-1228.24scribble planar cell polarity protein [Source:NCBI... [more]
lrch32.914e-1134.06leucine-rich repeats and calponin homology (CH) do... [more]
lrrc401.798e-1030.77leucine rich repeat containing 40 [Source:NCBI gen... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CYR11.481e-828.57Adenylate cyclase; required for cAMP production an... [more]
CCR41.638e-627.27Component of the CCR4-NOT transcriptional complex;... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372276.365e-2034.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469741.054e-1727.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374991.514e-1736.36Leucine-rich repeat protein soc-2 homolog [Source... [more]
EDO351388.260e-1229.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334321.739e-1126.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfhas12.402e-1522.64malignant fibrous histiocytoma amplified sequence ... [more]
erbin8.078e-1526.32erbb2 interacting protein [Source:NCBI gene;Acc:10... [more]
lrch49.266e-1528.29leucine-rich repeat and calponin homology domain-c... [more]
erbin1.158e-1426.32erbb2 interacting protein [Source:NCBI gene;Acc:10... [more]
erbin1.158e-1426.32erbb2 interacting protein [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Roc domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038728.10.000e+098.30SMESG000038728.1[more]
SMESG000038728.10.000e+0100.00SMESG000038728.1[more]
SMESG000016748.15.828e-1624.78SMESG000016748.1[more]
SMESG000023942.14.834e-1230.81SMESG000023942.1[more]
SMESG000002900.13.475e-1130.30SMESG000002900.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019942 ID=SMED30019942|Name=Roc domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3012bp
GAATGGCATCATCGATTAAACGATTGTAGAATTTAGCAGTCATCAATTCC
GCTGCGATAGAATAATCAATGAGAATGTCACATAATTGAAGCTGCCTTGG
TGATAAGAATAGCTAGCAAAATCTGTTGGTGCTTTATTGAAACATTAATA
TGGATGAAAGATCTTTGGAAAATGAAAATCGAGATGCTAGAAAGAACAAT
GAAGATGATTTCAAATCTATCAATTTATCAAACACAGCATTAACAGTCGT
TCCGGTGACTCTGTTCAAAAGAATTGAAATCACCCATTTGAATGTGTCGG
AAAATAATATAAAAAGCTTGCCGGCCGATATTTCGGATTTGGTAAATTTG
GAAGTTTTGAATATTTCTCGGAACGGATTTCATTGCACATCGCCAGATGA
CATGACGATTCTACCGAAGTCTATGAAGAATTTGAAATGTCTTAAATACT
TAAATATCTCCGAATGCAATTTGGTTTTCATTCCGGCAACAATTTGGGAA
ATCACTTCTTTACATCAACTGGATATCAGTAAGAATAATATTGGTGAACT
GAGATCAGATATTGGGAACTTGGACCAACTGCAGTGGCTAAATGCGCAAC
ATTGTGGTTTGAAAACATTACCTCAAGAAATAGTTGGCTGTGAAAAATTA
GAAACATTATTATTGTACGGGAATGTTATTCAAACAATCCCATATCTTCT
AGCTGATATTGGGAGTCTCAAAACTTTATCAATTAATCTCCGCCATCTTG
GTGAAAAAATTGATTCAAATATGGAATCTTTACTCCAGTCTGGACAGATC
CTATCCGATCATATTTCTAATACGATATTTGATCTTCCAGCAGTGCAAGC
AGTCGAAATGGAATTTTGCAAGATAAATTACTTCAAATCCTTCCAATCCA
AAGCTCTATTAGAACTCCACATCAGTGGGAATTTCTTTCAAGAAATACCG
GAAACGGTTTTGAATTTGAACAATTTACAAATCTTAGATTTATCGAAAAA
CCTACTATTAAACATAAATGATGATCTCATCAAATTGGAAAACCTCACAA
CTTTGTATTTGCAAGGAAACCAAATCGAAAAAATAACGAAAAGTTTATTT
CAAATGAAATCGCTCAAAGTTCTCGATCTCAGTCACAACAAAATCAAAAA
ACTGACAATTTCACTAGATTATTACAATAAAAGTCTAGAAACTCTAAAAA
TCAACCATAACAATATCAAAAATATACCGAATGATATTATCTACTTAGAA
AAGCTTGAAAACCTTGATGTGAGTAGTAATAATATATCAGAACTGCCCCT
GGATCTTTGCTTGATGAAAAATATTAAAACTGCTCATTATTTTAACGGAT
TACATAGAATTGGACTGTGGGTCTCAAGCAATCCAATAGAATTTCCTCCT
AAATGTGTCTGGAATACAACAAACATTGATGTCATTTATTCATTTTTACA
GAAAACGAAAATTAAACGATTGCAAATAAAATCCCCAATCAGGGTCGTTT
TAATCGGAGATAACAGTATAAAAGATAACTTTTTAGAAAGGTTTCTTGGT
AAAAGAATTTCTAACGATTCTGAATATTTAACTATCAACCAATGGACATC
TGAAAATTCTGTGCCATTCGTACTAGTAAACGTCAACTGCCATCCAACCT
ATGTAATGCACATACGTCATTATATGGAAGACAACGCCTTCATATGGATA
TTTATTGACCATTTCAAGACAAAAAATCTATTGAAAGAAAGTGAAAAATG
GATTGATCTTGTTATGGAATATTCAACAGATTGTGTTATTCAGATAGTTA
TAGTCAATTACTTTGAAAATAATTCAGAAGATATTTTTCAGAATTTTGTA
AACTTTTCCGACAAGAAATTAATTGAATCTCTAAGAGAGAGATTTTCGAA
TGAAAAGGTTAACATTCTACCAAATATTCTGTTAATTTCACCTGGTGAAA
GTTTGAATGCTTTCAAAGACGACCTAGAGTACATAGCTATAGACAAAGAT
TTATTCCAATCAGATGAAATGTTTAATATTTTTACCAGAGAGACAAAAGC
TATTGAAAACATTTGCAAGTCAACCAAATGTATTTATGTCAATCTGAATG
ATTTAATATCAAAAATTAGAGAAATGTTTCCATTCCCAACGGATTCCATA
TTCTCCTGCCTTAAGTGTCTCCATAAACAAGGAAAGATTTTATGGTTTTA
TAAAAATAAAAAGTTATCCAACAAAATTTATCCGTTTATTAGTTTATTCA
ACAAATCTATTCGAAGCCTGATTCGATTGGATTATGAGGAAGATTTAGAC
TTTGCAAAGAACCCTTTAATCAAAGCCAAAGGTCTTATGAATGGAGAGAA
ATTCGAACAAGTAAAGAAATCATTTTTGAAATATGGTGAAATATGCTACC
CATTGTATAAAGTTTTAACGTTTGAATTTCAAGAGTTGAGAAGCGTCAAA
GATTTTCTGATTGATGCTAACATAGCGTGGGGGGTCCCATTATCTGTGGA
TCTTGAAGAAGACATATTTCAACGTCCTTTCGTCGTTTTAGCTCAATTCA
ATAAAGAAAAATTTGATAAAAGCTGCTTTTTAGATTCTATTTTGAAGAAA
GAAAGTGCAAATATCGATTATGGTTTTACGATTAGGAGCACATCACTAAG
TGATCACTCAAATTTGTTTTTGAATCTGAAATGTGAAGTTAATTGTTGGG
CCGTTCGCAGATATGACTGGATGAATGCTGTCTATTTGCATCATAACAAT
GGAGATGTTCTATTATATAATGAATTATCTACAGATTTACAAATGAATAT
CACGGCTATTGTCCGATCTTGGTCAAAAATGAACCCTGACCCACTTCCGT
GCGATGGAGACTTTAGGAAATGGATCACCGATTGGTACCACTGTGAATCT
GACAGTCGGAAAAATTTTCATTACAATTTCGTCGACCACAGTTTGAAAGA
TATCGAAGAATATGTTTTGAATTTATAAATAAAATTAAATGTTTTATTTT
AAAATAAATGAG
back to top

protein sequence of SMED30019942-orf-1

>SMED30019942-orf-1 ID=SMED30019942-orf-1|Name=SMED30019942-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=943bp
MDERSLENENRDARKNNEDDFKSINLSNTALTVVPVTLFKRIEITHLNVS
ENNIKSLPADISDLVNLEVLNISRNGFHCTSPDDMTILPKSMKNLKCLKY
LNISECNLVFIPATIWEITSLHQLDISKNNIGELRSDIGNLDQLQWLNAQ
HCGLKTLPQEIVGCEKLETLLLYGNVIQTIPYLLADIGSLKTLSINLRHL
GEKIDSNMESLLQSGQILSDHISNTIFDLPAVQAVEMEFCKINYFKSFQS
KALLELHISGNFFQEIPETVLNLNNLQILDLSKNLLLNINDDLIKLENLT
TLYLQGNQIEKITKSLFQMKSLKVLDLSHNKIKKLTISLDYYNKSLETLK
INHNNIKNIPNDIIYLEKLENLDVSSNNISELPLDLCLMKNIKTAHYFNG
LHRIGLWVSSNPIEFPPKCVWNTTNIDVIYSFLQKTKIKRLQIKSPIRVV
LIGDNSIKDNFLERFLGKRISNDSEYLTINQWTSENSVPFVLVNVNCHPT
YVMHIRHYMEDNAFIWIFIDHFKTKNLLKESEKWIDLVMEYSTDCVIQIV
IVNYFENNSEDIFQNFVNFSDKKLIESLRERFSNEKVNILPNILLISPGE
SLNAFKDDLEYIAIDKDLFQSDEMFNIFTRETKAIENICKSTKCIYVNLN
DLISKIREMFPFPTDSIFSCLKCLHKQGKILWFYKNKKLSNKIYPFISLF
NKSIRSLIRLDYEEDLDFAKNPLIKAKGLMNGEKFEQVKKSFLKYGEICY
PLYKVLTFEFQELRSVKDFLIDANIAWGVPLSVDLEEDIFQRPFVVLAQF
NKEKFDKSCFLDSILKKESANIDYGFTIRSTSLSDHSNLFLNLKCEVNCW
AVRRYDWMNAVYLHHNNGDVLLYNELSTDLQMNITAIVRSWSKMNPDPLP
CDGDFRKWITDWYHCESDSRKNFHYNFVDHSLKDIEEYVLNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003591Leu-rich_rpt_typical-subtyp
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0014069postsynaptic density
GO:0016020membrane
GO:0030054cell junction
GO:0035580specific granule lumen
GO:0043005neuron projection
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0010976positive regulation of neuron projection development
GO:0043312neutrophil degranulation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 343..374
e-value: 170.0
score: 5.6
coord: 296..314
e-value: 55.0
score: 9.5
coord: 118..143
e-value: 290.0
score: 3.6
coord: 319..341
e-value: 38.0
score: 10.8
NoneNo IPR availableSMARTSM00364LRR_bac_2coord: 343..362
e-value: 500.0
score: 0.7
coord: 250..269
e-value: 13.0
score: 12.8
coord: 366..386
e-value: 41.0
score: 9.1
coord: 43..60
e-value: 130.0
score: 5.1
coord: 141..160
e-value: 270.0
score: 2.7
NoneNo IPR availablePANTHERPTHR16083LEUCINE RICH REPEAT CONTAINING PROTEINcoord: 22..112
coord: 344..452
coord: 242..335
coord: 101..195
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 20..425
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 366..389
e-value: 0.67
score: 19.0
coord: 296..319
e-value: 0.007
score: 25.6
coord: 165..186
e-value: 410.0
score: 0.0
coord: 95..118
e-value: 120.0
score: 4.5
coord: 141..164
e-value: 43.0
score: 8.1
coord: 320..342
e-value: 280.0
score: 1.4
coord: 42..64
e-value: 140.0
score: 3.9
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 14..83
e-value: 7.6E-10
score: 40.0
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 84..447
e-value: 2.1E-60
score: 206.0
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 22..76
e-value: 5.7E-8
score: 32.4
coord: 298..335
e-value: 1.2E-8
score: 34.6
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 368..389
score: 8.12
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 166..187
score: 6.403
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 298..319
score: 8.066
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 252..273
score: 5.101
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 66..87
score: 4.832
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 345..366
score: 7.697
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 143..164
score: 4.601
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 120..141
score: 6.403
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 275..297
score: 7.412
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 321..342
score: 8.043
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 43..65
score: 6.742