Transcription activator BRG1

Overview
NameTranscription activator BRG1
Smed IDSMED30019938
Length (bp)4565
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription activator BRG1 (SMED30019938) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription activator BRG1 (SMED30019938) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription activator BRG1 (SMED30019938) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription activator BRG1 (SMED30019938) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019938

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019938SMESG000050888.1 SMESG000050884.1 SMESG000050880.1 SmedASXL_017781SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30019938SMESG000076325.1 SMESG000050888.1 SMESG000050880.1 SmedASXL_007902SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neuronSMED30019938SMESG000050888.1 SMESG000050880.1 dd_Smed_v4_16980_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019938SMESG000050888.1 SMESG000050880.1 dd_Smed_v4_16980_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019938SMESG000050888.1 SMESG000050880.1 dd_Smed_v6_16980_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30019938SMESG000050888.1 SMESG000050880.1 SMESG000076325.1 SMESG000050884.1 SMU15028413SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30019938SMESG000050888.1 SMESG000050880.1 SMESG000076325.1 SMESG000050884.1 SMU15028413SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30019938SMESG000076325.1 SMESG000050888.1 SMESG000050884.1 SMESG000050880.1 SMU15002166SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30019938SMESG000076325.1 SMESG000050888.1 SMESG000050884.1 SMESG000050880.1 SMU15002166SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
testis primordiumSMED30019938SMESG000050884.1 Contig6023_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription activator BRG1 vs. Ensembl Human
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:HGNC Symbol;Acc:HGNC:11100])

HSP 1 Score: 1188.71 bits (3074), Expect = 0.000e+0
Identity = 698/1273 (54.83%), Postives = 889/1273 (69.84%), Query Frame = 2
Query:  563 KRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDY--------------------------------SEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVID---------KSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKD-GRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            K+S I+ I  P         + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+V  KI KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q+ K+KK+   +K+ +  E  +  +    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+             +E  +E    +        V+E+  I D       E++  HI        DDEY   Q      Q+YY +AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNWA EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN+   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++                                  EDE PDDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +   E++ +         K   +                + D    +KKRGRP    +S     ++ K   I++ ++ Y+D   GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  348 KQSRITPIQKP---------RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPD-GEPLDETSQM------SDLPVKV------IHVE-----SGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1564          
BLAST of Transcription activator BRG1 vs. Ensembl Human
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:HGNC Symbol;Acc:HGNC:11100])

HSP 1 Score: 1188.71 bits (3074), Expect = 0.000e+0
Identity = 698/1273 (54.83%), Postives = 889/1273 (69.84%), Query Frame = 2
Query:  563 KRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDY--------------------------------SEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVID---------KSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKD-GRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            K+S I+ I  P         + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+V  KI KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q+ K+KK+   +K+ +  E  +  +    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+             +E  +E    +        V+E+  I D       E++  HI        DDEY   Q      Q+YY +AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNWA EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN+   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++                                  EDE PDDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +   E++ +         K   +                + D    +KKRGRP    +S     ++ K   I++ ++ Y+D   GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  348 KQSRITPIQKP---------RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPD-GEPLDETSQM------SDLPVKV------IHVE-----SGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1564          
BLAST of Transcription activator BRG1 vs. Ensembl Human
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:HGNC Symbol;Acc:HGNC:11100])

HSP 1 Score: 1185.24 bits (3065), Expect = 0.000e+0
Identity = 701/1276 (54.94%), Postives = 895/1276 (70.14%), Query Frame = 2
Query:  563 KRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDY--------------------------------SEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHI--IDDADEDVIDKSVENXXXXXXXSMEVPCPPSEL----------DSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKD-GRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            K+S I+ I  P         + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+V  KI KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q+ K+KK+   +K+ +  E  +  +    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+             +E  +E    +        V+E+  I D       E++  HI        DDEY   Q      Q+YY +AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNWA EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN+   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++                                  EDE PDDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ +  I++   + I++ V  K   +K+  +     S            D    +KKRGRP    +S     ++ K   I++ ++ Y+D   GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  153 KQSRITPIQKP---------RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPD-GEPLDETSQM------SDLPVKV------IHVE-----SGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1372          
BLAST of Transcription activator BRG1 vs. Ensembl Human
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:HGNC Symbol;Acc:HGNC:11100])

HSP 1 Score: 1181.01 bits (3054), Expect = 0.000e+0
Identity = 693/1240 (55.89%), Postives = 884/1240 (71.29%), Query Frame = 2
Query:  563 KRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDA---------DEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            K+S I+ I  P         + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+V  KI KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q+ K+KK+   +K+ +  E  +  +    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+             +E  +E    +        V+E+  I D       E++  HI        DDEY   Q      Q+YY +AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNWA EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN+   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +            +    K   +                + D    +KKRGRP    +S     ++ K   I++ ++ Y+D  GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  348 KQSRITPIQKP---------RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPD-GEPLDETSQM------SDLPVKV------IHVE-----SGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1530          
BLAST of Transcription activator BRG1 vs. Ensembl Human
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:HGNC Symbol;Acc:HGNC:11100])

HSP 1 Score: 1181.01 bits (3054), Expect = 0.000e+0
Identity = 693/1240 (55.89%), Postives = 884/1240 (71.29%), Query Frame = 2
Query:  563 KRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDA---------DEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            K+S I+ I  P         + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+V  KI KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q+ K+KK+   +K+ +  E  +  +    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+             +E  +E    +        V+E+  I D       E++  HI        DDEY   Q      Q+YY +AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNWA EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN+   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +            +    K   +                + D    +KKRGRP    +S     ++ K   I++ ++ Y+D  GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  348 KQSRITPIQKP---------RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPD-GEPLDETSQM------SDLPVKV------IHVE-----SGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1530          
BLAST of Transcription activator BRG1 vs. Ensembl Celegans
Match: swsn-4 (SWI/SNF nucleosome remodeling complex component; SWI2/SNF2-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF53])

HSP 1 Score: 1019.99 bits (2636), Expect = 0.000e+0
Identity = 607/1308 (46.41%), Postives = 841/1308 (64.30%), Query Frame = 2
Query:  362 PGENN--DKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLI-NAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILT--------PSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGH-RMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXXXXXXXIV---DEEMNINDEIEPIHI----GTEDDEYN---KDQTQTYYTLAHSVQEEIREQSSLLVNGQ----LKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNE-----LTDSLSKKRIRKEVDY-TDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSME-VPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQFLRENP 4186
            PG+ N  ++     QL QLRAQ+++Y+LL++++ +P +LI +A   +  +       Y++   E  NG+    ++ KI          P+   +P  I   DPV +L  +   +        ++L +   + +P H ++K  IEL+AL+L++LQ ++RS+++  +K+D  LE+ALN  AYR+ KRQ+L+E+R TEKLEK+ K +QE+++RQKH + + A I H KEFKE+HRN   K+ K  KAV+ Y  N+ER ++K++ R E+ RM++LM EDEEGYR L+DEKKD RL YLL QTDE++  L  LV++H+                  + +   +      G   DE                      E  + +   ST + L    AP    +E WL+ +  +EI   D+ + +    E E          D+   +++E +   I      E+DEY+   K Q   YY  AH ++E++ +Q + +  G     LK YQIKGLEW+VSLYNNNLNGILADEMGLGKTIQTI L+TYLME K+ NGP+L+IVPLST+SNW  EF KWAPSV  ++YKG+   R+ ++ Q++ G FNVL+TTYEY+IK+K  L K++WKYMIIDEGHR+KNH+CKLT +LN ++ A +RLLLTGTPLQNKLPELWALLNFLLP IF S  TFEQWFNAPFA +GEKVELNQEET+LIIRRLHKVLRPFLLRRLKKEVESQLPDK EYVIKC+ SALQ+ +Y HMQ KG++L      D K   G R+LMNT++ LRK+CNHPF+F +IE +        + + K         E+ G DL RV+GK ELLDRILPKLKA  HRIL+F QMT++M +   +  +R + +LRLDG+TK D+RGDLL+ FN    D F+FMLSTRAGGLGLNLQ ADTVIIFDSDWNPH D+QAQDRAHRIGQK EVRVLRLIT NSVEEKILAAAR+KLNVDEKVIQAG FDQ+STG ER Q L+ ++  D  E   E+E PDDET+NQM+ARSE+EF ++Q  DI+R   + ++   K RL+   E+P  I+K     E    + E     +  + +++R R+EVDY +D  ++ QF++ + +  DE+  +++V  + K++K+ M  +      +D + L+ K+ +         D  ++ K   +++ +L Y+++DG ++++ F  LP++K+LPDYY++I +PMDF RI +KI+  +Y  + ELN D+NLL +NAQ YN +GS                 +I+  S  +  +W E  D+F+  NP
Sbjct:   77 PGQENGGNQQITPAQLNQLRAQVSAYRLLARNEQVPANLIADAVMLRPKVTTLLPEPYEYPG-EAENGEKLPYDLMKIFNLHQIRCNRPTTISVPSGI---DPVGMLK-QRENMIQNRIGLRMKLLNNLPADIPDHMKLKAEIELRALRLVNLQTQVRSEVMACLKRDTTLETALNPYAYRRTKRQSLREARVTEKLEKQQKMEQERKRRQKHTDLMQAIIQHGKEFKEYHRNNLLKMAKSRKAVMTYHQNNERERKKDEIRNEKLRMQKLMQEDEEGYRALLDEKKDQRLVYLLQQTDEYVDSLCSLVRQHQ----------------NTEKKKKKEDKKIEKGNQMDE----------------------EARVHVRERSTGKALTGDQAPKTEEIEFWLETHPEYEIVPRDQLSDDEEEEEEEAPVEPEEEKDDQYAGMDEETKAKMILEKARNEEDEYDQKTKKQMADYYATAHKIKEKVVKQHTTMGGGDPNLLLKPYQIKGLEWMVSLYNNNLNGILADEMGLGKTIQTISLVTYLMEVKQNNGPYLVIVPLSTLSNWQNEFAKWAPSVTTIIYKGTKDARRRVEGQIRKGAFNVLMTTYEYVIKEKALLGKIRWKYMIIDEGHRLKNHNCKLTLMLNGFFHAQHRLLLTGTPLQNKLPELWALLNFLLPSIFSSCGTFEQWFNAPFATTGEKVELNQEETMLIIRRLHKVLRPFLLRRLKKEVESQLPDKTEYVIKCDQSALQKVIYRHMQ-KGLLL------DAKMSSGARSLMNTVVHLRKLCNHPFLFPNIEDSC-------RAYWKV-------NEVNGTDLMRVAGKLELLDRILPKLKATGHRILMFFQMTSMMNIFEDFLNFRRYTYLRLDGSTKPDERGDLLTQFNAPNSDLFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKKEVRVLRLITANSVEEKILAAARYKLNVDEKVIQAGKFDQRSTGAERKQMLEQIIQADGEE-EEEEEVPDDETVNQMVARSEEEFNIFQSMDIDRRREEANQLHRKPRLLEEHEIPDDILKLSFDYEEMERAREEGREVVDQTPNQRRRRREVDYSSDLLSDEQFMKQVEEVEDEN--NQAVAERKKQRKRKMAGLDENDDSMDDVVLQHKKKK--------TDPELAEKINEMLDVILEYKNEDGELIADVFQTLPTRKELPDYYQVISKPMDFDRINKKIETGRYTVMEELNDDMNLLVNNAQTYNEEGS-----------------EIYVSSETIGKLWKEQYDKFM--NP 1290          
BLAST of Transcription activator BRG1 vs. Ensembl Celegans
Match: pqn-15 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:P91094])

HSP 1 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 395/674 (58.61%), Postives = 498/674 (73.89%), Query Frame = 2
Query: 1676 EDDEY---NKDQTQTYYTLAHSVQEEIREQSSLLVNG----QLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDS--------LSKKRIRKEVDYT-DSFTEAQFLRHIIDDAD 3649
            +DDEY    K   + YYT AH V+EEI+EQ  ++  G    +LK YQIKGLEW+VSL+NNNLNGILADEMGLGKTIQTI  ITYLME K+ +GPFL+IVPLST+ NW  EF+KWA +V  + YKG   TRK  +  +K+G FNVLLTT+EY+I++K  L KL+WKYMIIDEGHR+KN HCKLT++LNT +    RLL+TGTPLQNKLPELWALLNFLLP IF S +TFEQWFNAPFA +GEKVEL QEET+LIIRRLHKVLRPFLLRRLKKEVES+LPDK+E+V++C+MSALQ+ LY HMQ KG++L        K   G+++L NT++ LRK+CNHPF+F+++E++    NF    F            I   DLYRVSGK ELL RILPKL+A  HR+L+F QMT++MT++  +      ++LRLDG+TK D+RG LL  FN    +YF+FMLSTRAGGLGLNLQ ADTVIIFDSDWNPH D+QAQDRAHRIGQK EVRV RLIT NSVEEKILAAAR+KLNVDEKVIQAG FD +STG ER + L+ ++ + E E   ++E P+DE IN +++RSE+EFEL+Q+ D ER  ++ ++ K K RL+  DE+P  I++  A  E +       +            +R R+EVDY+ D+ ++ +FL  + D+ D
Sbjct: 1159 DDDEYENKTKMNIEDYYTTAHGVREEIKEQHFMMGGGNPSLKLKPYQIKGLEWMVSLFNNNLNGILADEMGLGKTIQTIAFITYLMEIKKTSGPFLVIVPLSTVPNWQNEFDKWAANVHLIAYKGPKETRKVFEPIIKSGKFNVLLTTFEYVIREKALLGKLRWKYMIIDEGHRLKNQHCKLTEMLNTRFQCQRRLLITGTPLQNKLPELWALLNFLLPSIFSSCSTFEQWFNAPFATTGEKVELTQEETMLIIRRLHKVLRPFLLRRLKKEVESELPDKMEFVVRCDMSALQKVLYKHMQ-KGLLLD------GKTNTGSKSLRNTMIHLRKLCNHPFLFENVEESC--RNFWDARF------------ISAVDLYRVSGKLELLSRILPKLQATGHRVLMFFQMTSMMTIVEDFLAGGTIQYLRLDGSTKPDERGALLDKFNAPNSEYFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKAEVRVFRLITANSVEEKILAAARYKLNVDEKVIQAGKFDNRSTGAERREILENII-KTENESEEDEEVPNDEDINDILSRSEEEFELFQKMDQERFENEQAQ-KAKPRLVGEDEIPRDILR--AADETDYIEKAKEEGRVPYLEVMPGSRRTRREVDYSADTMSDDKFLEKLFDEDD 1807          

HSP 2 Score: 68.1662 bits (165), Expect = 5.224e-11
Identity = 45/108 (41.67%), Postives = 71/108 (65.74%), Query Frame = 2
Query:  941 EKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHK 1264
            EKR++  +  FL +   H++EFKEFH+       K+ K++  Y TN  +   +E+ + E+ R+++L+ EDEEGYR ++DEKKD RL YLL QTD++I  L  L+K+ +
Sbjct: 1016 EKRRKVTNFHFLQSLTKHAREFKEFHKRNMLNHTKVRKSMQQYITNENKRIAREEMKNEKNRIQKLIQEDEEGYRAMLDEKKDQRLVYLLEQTDDYIKSLCDLLKQQQ 1123          
BLAST of Transcription activator BRG1 vs. Ensembl Celegans
Match: isw-1 (Chromatin-remodeling complex ATPase chain isw-1 [Source:UniProtKB/Swiss-Prot;Acc:P41877])

HSP 1 Score: 423.705 bits (1088), Expect = 1.244e-127
Identity = 231/505 (45.74%), Postives = 313/505 (61.98%), Query Frame = 2
Query: 1772 NGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSI-QSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFD--QKSTG 3277
            NG++++YQ++GL WL SL +N +NGILADEMGLGKT+QTI +I Y+   K    P L+IVP ST+ NWA EF+KW PS+  V+  G    R  + +  +    F+V  TTYE ++K K  L KL W+Y+IIDE HR+KN   KL++ +     +  RLL+TGTPLQN L ELWALLNFLLPDIF S + F+ WF+   A+SG            +++RLHKVL+PFLLRR+K +VE  L  K E  +   +S +QR  Y  +  K + + +G+ K +K +     LMN +M LRK  NHP++F   E                 PG P  T+   Q L   SGK  +LD++L K K    R+LIF Q + ++ L+  +  +R +++ RLDG+T  +DR + +  +N      FIFML+TRAGGLG+NL  AD VII+DSDWNP  DLQA DRAHRIGQK +VRV RLIT N+V+E+I+  A  KL +D  VIQ G     QK+ G
Sbjct:  129 NGEMRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNKASPHLVIVPKSTLQNWANEFKKWCPSINAVVLIGDEAARNQVLRDVILPQKFDVCCTTYEMMLKVKTQLKKLNWRYIIIDEAHRIKNEKSKLSETVRELN-SENRLLITGTPLQNNLHELWALLNFLLPDIFTSSDDFDSWFSND-AMSG---------NTDLVQRLHKVLQPFLLRRIKSDVEKSLLPKKEVKVYVGLSKMQREWYTKVLMKDIDIINGAGKVEKAR-----LMNILMHLRKCVNHPYLFDGAE-----------------PGPPFTTD---QHLVDNSGKMVVLDKLLMKFKEQGSRVLIFSQFSRMLDLLEDFCWWRHYEYCRLDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGLGINLATADVVIIYDSDWNPQSDLQAMDRAHRIGQKKQVRVFRLITENTVDERIIEKAEAKLRLDNIVIQQGRMSEAQKTLG 597          
BLAST of Transcription activator BRG1 vs. Ensembl Celegans
Match: let-418 (pep chromosome:WBcel235:V:5826833:5832866:1 gene:WBGene00002637.1 transcript:F26F12.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-418)

HSP 1 Score: 376.711 bits (966), Expect = 8.995e-107
Identity = 214/518 (41.31%), Postives = 305/518 (58.88%), Query Frame = 2
Query: 1769 VNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQ-----------------SQLK---NGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTR-TLMNTIMQLRKICNHPFMFQHIE-QAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGM 3256
              G+L  YQ++GL WL   ++N  + ILADEMGLGKT+Q++  +  LM++    GPFLI  PLST+ NW  E E+W P    V Y G    R  ++                 S++K   N  F+VLLT+YE I  DK  LS ++W  +++DE HR+KN+     + LN Y +  YR+LLTGTPLQN L EL+ LLNFL  + F  +  F   FN          E+++E+    I +LH +L P +LRRLK +V + +P K E +++ E+SA+Q+  Y +      ILT   +      GGT+ +LMN +M+L+K CNHP++F   E +A  E N M +                G  L + SGKF LL ++L KLK   HR+LIF QMT ++ +M    EY G+++ R+DG+     R D +  +N      FIF+LSTRAGGLG+NL  ADTVII+DSDWNPH D+QA  RAHR+GQK++V + R +T  SVEEKI + A+ K+ ++  V++AG+
Sbjct:  598 TGGKLHPYQLEGLNWLRHCWSNGTDAILADEMGLGKTVQSLTFLYSLMKEGHCKGPFLIAAPLSTIINWEREAEQWCPDFYVVTYVGLRDARVVLREHEFSFVEGAVRSGPKASKMKTTENMKFHVLLTSYETINMDKTILSSIEWGALVVDEAHRLKNNQSLFFKNLNEYTIH-YRVLLTGTPLQNNLEELFHLLNFLSKERFNQLEAFTAEFN----------EISKEDQ---IEKLHNLLGPHMLRRLKADVLTGMPSKSELIVRVELSAMQKKWYKN------ILTRNFDALNVKNGGTQMSLMNVLMELKKCCNHPYLFVKAELEAPKEKNGMYE----------------GTALIKNSGKFVLLQKMLRKLKDGGHRVLIFSQMTRMLDIMEDLCEYEGYRYERIDGSIMGQMRQDAIDRYNAPGAQQFIFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKKSVEEKITSVAKKKMLLNHLVVRAGL 1079          
BLAST of Transcription activator BRG1 vs. Ensembl Celegans
Match: chd-3 (Chromodomain-helicase-DNA-binding protein 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22516])

HSP 1 Score: 370.163 bits (949), Expect = 1.100e-104
Identity = 212/550 (38.55%), Postives = 312/550 (56.73%), Query Frame = 2
Query: 1769 VNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQ--------------------LKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTR-TLMNTIMQLRKICNHPFMF-QHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECP 3352
              G L  YQ++G+ WL   ++N  + ILADEMGLGKT+Q++  +  LM++    GPFLI  PLST+ NW  E E W P    V Y G   +R  I+                      L+N  F+VLLT+YE I  DK  LS + W  +++DE HR+KN+     + L  Y +  YR+LLTGTPLQN L EL+ LLNFL PD F  + +F          + E  E+++E+    I +LH +L P +LRRLK +V + +P K E +++ E+SA+Q+  Y +      ILT   +      GGT+ +L+N IM+L+K CNHP++F +   +A    N M +                G  L + +GKF LL ++L KLK   HR+LIF QMT ++ ++  + +  G+K+ R+DG+     R D +  +N      F+F+LSTRAGGLG+NL  ADTVII+DSDWNPH D+QA  RAHR+GQK++V + R +T  SVEE+I + A+ K+ +   V++AG+  +      + + L  +L     E + E+E P
Sbjct:  612 TGGNLHPYQLEGINWLRHCWSNGTDAILADEMGLGKTVQSLTFLYTLMKEGHTKGPFLIAAPLSTIINWEREAELWCPDFYVVTYVGDRESRMVIREHEFSFVDGAVRGGPKVSKIKTLENLKFHVLLTSYECINMDKAILSSIDWAALVVDEAHRLKNNQSTFFKNLREYNIQ-YRVLLTGTPLQNNLEELFHLLNFLAPDRFNQLESF----------TAEFSEISKEDQ---IEKLHNLLGPHMLRRLKADVLTGMPSKQELIVRVELSAMQKKYYKN------ILTRNFDALNVKNGGTQMSLINIIMELKKCCNHPYLFMKACLEAPKLKNGMYE----------------GSALIKNAGKFVLLQKMLRKLKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYNAPGAKQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKGSVEERITSVAKKKMLLTHLVVRAGLGAKDGKSMSKTE-LDDVLRWGTEELFKEEEAP 1124          
BLAST of Transcription activator BRG1 vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075524)

HSP 1 Score: 1122.46 bits (2902), Expect = 0.000e+0
Identity = 655/1161 (56.42%), Postives = 841/1161 (72.44%), Query Frame = 2
Query:  626 SLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDF-NLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIY-------AVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIG---TEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSL 4072
             LDP+ LL +RE RI  RI  R+ EL     +     R++  IEL+AL++L+ Q+++R + +   ++D  LE+ALN+K Y++ KRQ L+E+R TEKLEK+ K + E+++RQKH EFL A + H K+ +EFHRN   ++ ++NKAV+N+  N+ER ++KEQERIE+ERMRRLMAEDEEGYRKLID+KKD RL +LLSQTDE+I+ LT++VK+HK DQ+ KK++E                  KR    K E+      L +G++  +    +  ++ + +    T +KL    AP++ +L +WL  + GW+           ++++K     +    E      +   NDE     I     EDDEY  ++ QTYY++AH++ E++ EQ+S++VNG LKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI L+TYLM++K+V GP+LIIVPLST+ NW LEFEKWAP+V  V YKGSP  R+ +Q+Q++   FNVLLTTYEY+IKDK  L+K++WKYMIIDEGHRMKNHHCKLTQ+LNT+Y+APYRLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA +GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPDKVEY+IKC+MSALQR LY HMQSKGV+LTDGSEK K GKGG + LMNTI+QLRK+CNHPFMFQHIE+   +H            GV     + G DLYRVSGKFELLDRILPKLKA NHR+L+FCQMT  MT++  Y  +R F +LRLDGTTK++DRG+LL  FN    D F+F+LSTRAGGLGLNLQ ADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL+T NSVEE+ILAAAR+KLN+DEKVIQAGMFDQKSTG+ER QFLQ +L+QD+ E+  E+E PDDE IN MIARSE+E E+++R D ER   D      + RL+   ELP W+ K+D  +ER  +  +    L +  R RKEVDYTDS TE ++L+ I D A+ D  ++  ++K K++K+        S+ DSL LK++R +  +          S K +  I   +   ++DGR LSEPF+KLPS++ LPDYYEIIK+P+D K+I Q+I++ KY  + EL  D   LC NAQ+YN + SL+ L
Sbjct:  397 GLDPITLLQERENRIAARISLRMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLYKRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKDDQMKKKEEE-----------------GKRLIQFKKEL------LMSGEYIGIDEGSIVADMRVHVVEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEE-QTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHT--------GGHGV-----VSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELPDWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRK--EESDDDSLILKRRRRQNLDKR--------SKKQMHKIMSAVIKHNQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQIYNEEASLIYL 1510          
BLAST of Transcription activator BRG1 vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075523)

HSP 1 Score: 1122.46 bits (2902), Expect = 0.000e+0
Identity = 655/1161 (56.42%), Postives = 841/1161 (72.44%), Query Frame = 2
Query:  626 SLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDF-NLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIY-------AVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIG---TEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSL 4072
             LDP+ LL +RE RI  RI  R+ EL     +     R++  IEL+AL++L+ Q+++R + +   ++D  LE+ALN+K Y++ KRQ L+E+R TEKLEK+ K + E+++RQKH EFL A + H K+ +EFHRN   ++ ++NKAV+N+  N+ER ++KEQERIE+ERMRRLMAEDEEGYRKLID+KKD RL +LLSQTDE+I+ LT++VK+HK DQ+ KK++E                  KR    K E+      L +G++  +    +  ++ + +    T +KL    AP++ +L +WL  + GW+           ++++K     +    E      +   NDE     I     EDDEY  ++ QTYY++AH++ E++ EQ+S++VNG LKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI L+TYLM++K+V GP+LIIVPLST+ NW LEFEKWAP+V  V YKGSP  R+ +Q+Q++   FNVLLTTYEY+IKDK  L+K++WKYMIIDEGHRMKNHHCKLTQ+LNT+Y+APYRLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA +GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPDKVEY+IKC+MSALQR LY HMQSKGV+LTDGSEK K GKGG + LMNTI+QLRK+CNHPFMFQHIE+   +H            GV     + G DLYRVSGKFELLDRILPKLKA NHR+L+FCQMT  MT++  Y  +R F +LRLDGTTK++DRG+LL  FN    D F+F+LSTRAGGLGLNLQ ADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL+T NSVEE+ILAAAR+KLN+DEKVIQAGMFDQKSTG+ER QFLQ +L+QD+ E+  E+E PDDE IN MIARSE+E E+++R D ER   D      + RL+   ELP W+ K+D  +ER  +  +    L +  R RKEVDYTDS TE ++L+ I D A+ D  ++  ++K K++K+        S+ DSL LK++R +  +          S K +  I   +   ++DGR LSEPF+KLPS++ LPDYYEIIK+P+D K+I Q+I++ KY  + EL  D   LC NAQ+YN + SL+ L
Sbjct:  397 GLDPITLLQERENRIAARISLRMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLYKRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKDDQMKKKEEE-----------------GKRLIQFKKEL------LMSGEYIGIDEGSIVADMRVHVVEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEE-QTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHT--------GGHGV-----VSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELPDWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRK--EESDDDSLILKRRRRQNLDKR--------SKKQMHKIMSAVIKHNQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQIYNEEASLIYL 1510          
BLAST of Transcription activator BRG1 vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0333580)

HSP 1 Score: 1122.07 bits (2901), Expect = 0.000e+0
Identity = 655/1161 (56.42%), Postives = 841/1161 (72.44%), Query Frame = 2
Query:  626 SLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDF-NLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIY-------AVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIG---TEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSL 4072
             LDP+ LL +RE RI  RI  R+ EL     +     R++  IEL+AL++L+ Q+++R + +   ++D  LE+ALN+K Y++ KRQ L+E+R TEKLEK+ K + E+++RQKH EFL A + H K+ +EFHRN   ++ ++NKAV+N+  N+ER ++KEQERIE+ERMRRLMAEDEEGYRKLID+KKD RL +LLSQTDE+I+ LT++VK+HK DQ+ KK++E                  KR    K E+      L +G++  +    +  ++ + +    T +KL    AP++ +L +WL  + GW+           ++++K     +    E      +   NDE     I     EDDEY  ++ QTYY++AH++ E++ EQ+S++VNG LKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI L+TYLM++K+V GP+LIIVPLST+ NW LEFEKWAP+V  V YKGSP  R+ +Q+Q++   FNVLLTTYEY+IKDK  L+K++WKYMIIDEGHRMKNHHCKLTQ+LNT+Y+APYRLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA +GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPDKVEY+IKC+MSALQR LY HMQSKGV+LTDGSEK K GKGG + LMNTI+QLRK+CNHPFMFQHIE+   +H            GV     + G DLYRVSGKFELLDRILPKLKA NHR+L+FCQMT  MT++  Y  +R F +LRLDGTTK++DRG+LL  FN    D F+F+LSTRAGGLGLNLQ ADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL+T NSVEE+ILAAAR+KLN+DEKVIQAGMFDQKSTG+ER QFLQ +L+QD+ E+  E+E PDDE IN MIARSE+E E+++R D ER   D      + RL+   ELP W+ K+D  +ER  +  +    L +  R RKEVDYTDS TE ++L+ I D A+ D  ++  ++K K++K+        S+ DSL LK++R +  +          S K +  I   +   ++DGR LSEPF+KLPS++ LPDYYEIIK+P+D K+I Q+I++ KY  + EL  D   LC NAQ+YN + SL+ L
Sbjct:  405 GLDPITLLQERENRIAARISLRMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLYKRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKDDQMKKKEEE-----------------GKRLIQFKKEL------LMSGEYIGIDEGSIVADMRVHVVEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEE-QTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHT--------GGHGV-----VSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELPDWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRK--EESDDDSLILKRRRRQNLDKR--------SKKQMHKIMSAVIKHNQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQIYNEEASLIYL 1518          
BLAST of Transcription activator BRG1 vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075526)

HSP 1 Score: 1121.69 bits (2900), Expect = 0.000e+0
Identity = 655/1161 (56.42%), Postives = 841/1161 (72.44%), Query Frame = 2
Query:  626 SLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDF-NLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIY-------AVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIG---TEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSL 4072
             LDP+ LL +RE RI  RI  R+ EL     +     R++  IEL+AL++L+ Q+++R + +   ++D  LE+ALN+K Y++ KRQ L+E+R TEKLEK+ K + E+++RQKH EFL A + H K+ +EFHRN   ++ ++NKAV+N+  N+ER ++KEQERIE+ERMRRLMAEDEEGYRKLID+KKD RL +LLSQTDE+I+ LT++VK+HK DQ+ KK++E                  KR    K E+      L +G++  +    +  ++ + +    T +KL    AP++ +L +WL  + GW+           ++++K     +    E      +   NDE     I     EDDEY  ++ QTYY++AH++ E++ EQ+S++VNG LKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI L+TYLM++K+V GP+LIIVPLST+ NW LEFEKWAP+V  V YKGSP  R+ +Q+Q++   FNVLLTTYEY+IKDK  L+K++WKYMIIDEGHRMKNHHCKLTQ+LNT+Y+APYRLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA +GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPDKVEY+IKC+MSALQR LY HMQSKGV+LTDGSEK K GKGG + LMNTI+QLRK+CNHPFMFQHIE+   +H            GV     + G DLYRVSGKFELLDRILPKLKA NHR+L+FCQMT  MT++  Y  +R F +LRLDGTTK++DRG+LL  FN    D F+F+LSTRAGGLGLNLQ ADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL+T NSVEE+ILAAAR+KLN+DEKVIQAGMFDQKSTG+ER QFLQ +L+QD+ E+  E+E PDDE IN MIARSE+E E+++R D ER   D      + RL+   ELP W+ K+D  +ER  +  +    L +  R RKEVDYTDS TE ++L+ I D A+ D  ++  ++K K++K+        S+ DSL LK++R +  +          S K +  I   +   ++DGR LSEPF+KLPS++ LPDYYEIIK+P+D K+I Q+I++ KY  + EL  D   LC NAQ+YN + SL+ L
Sbjct:  401 GLDPITLLQERENRIAARISLRMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLYKRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKDDQMKKKEEE-----------------GKRLIQFKKEL------LMSGEYIGIDEGSIVADMRVHVVEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEE-QTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHT--------GGHGV-----VSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELPDWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRK--EESDDDSLILKRRRRQNLDKR--------SKKQMHKIMSAVIKHNQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQIYNEEASLIYL 1514          
BLAST of Transcription activator BRG1 vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075525)

HSP 1 Score: 1121.69 bits (2900), Expect = 0.000e+0
Identity = 655/1161 (56.42%), Postives = 841/1161 (72.44%), Query Frame = 2
Query:  626 SLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDF-NLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIY-------AVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIG---TEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSL 4072
             LDP+ LL +RE RI  RI  R+ EL     +     R++  IEL+AL++L+ Q+++R + +   ++D  LE+ALN+K Y++ KRQ L+E+R TEKLEK+ K + E+++RQKH EFL A + H K+ +EFHRN   ++ ++NKAV+N+  N+ER ++KEQERIE+ERMRRLMAEDEEGYRKLID+KKD RL +LLSQTDE+I+ LT++VK+HK DQ+ KK++E                  KR    K E+      L +G++  +    +  ++ + +    T +KL    AP++ +L +WL  + GW+           ++++K     +    E      +   NDE     I     EDDEY  ++ QTYY++AH++ E++ EQ+S++VNG LKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI L+TYLM++K+V GP+LIIVPLST+ NW LEFEKWAP+V  V YKGSP  R+ +Q+Q++   FNVLLTTYEY+IKDK  L+K++WKYMIIDEGHRMKNHHCKLTQ+LNT+Y+APYRLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA +GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVE QLPDKVEY+IKC+MSALQR LY HMQSKGV+LTDGSEK K GKGG + LMNTI+QLRK+CNHPFMFQHIE+   +H            GV     + G DLYRVSGKFELLDRILPKLKA NHR+L+FCQMT  MT++  Y  +R F +LRLDGTTK++DRG+LL  FN    D F+F+LSTRAGGLGLNLQ ADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL+T NSVEE+ILAAAR+KLN+DEKVIQAGMFDQKSTG+ER QFLQ +L+QD+ E+  E+E PDDE IN MIARSE+E E+++R D ER   D      + RL+   ELP W+ K+D  +ER  +  +    L +  R RKEVDYTDS TE ++L+ I D A+ D  ++  ++K K++K+        S+ DSL LK++R +  +          S K +  I   +   ++DGR LSEPF+KLPS++ LPDYYEIIK+P+D K+I Q+I++ KY  + EL  D   LC NAQ+YN + SL+ L
Sbjct:  401 GLDPITLLQERENRIAARISLRMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLYKRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKDDQMKKKEEE-----------------GKRLIQFKKEL------LMSGEYIGIDEGSIVADMRVHVVEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEE-QTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHT--------GGHGV-----VSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELPDWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDDGAEFDEEEEEDDSKRKRRKRKNRK--EESDDDSLILKRRRRQNLDKR--------SKKQMHKIMSAVIKHNQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQNAQIYNEEASLIYL 1514          
BLAST of Transcription activator BRG1 vs. Ensembl Zebrafish
Match: smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5964])

HSP 1 Score: 1199.11 bits (3101), Expect = 0.000e+0
Identity = 683/1206 (56.63%), Postives = 880/1206 (72.97%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXX----------XXXXXXXXXXIVDEEMNINDEIEPIHIGTE-----DDEYNKDQTQT----YYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEH-NFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQFLR 4177
            + LDPVELL +RE R+Q RI  RI EL +   S  P  R K  +ELKAL+LL+ Q+++R D++  M++D  LE+ALN KAY++ KRQTL+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+++ KI KL+KA+  + TN+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV EHK  Q  K+KK+   +K+K+  +              + +  I  +    D N  +  LP    + +    T + L    AP    LE WL+ N G+E+    ++ +              +  E  E +++D   +   E    HI        DDEY+    QT    YY +AH+V E + +QS+ L+NG LK+YQI+GLEW+VSLYNNNLNGILADEMGLGKTIQTIGLITYLME KR+NGP+LIIVPLST+SNW  E +KWAPS++K+ YKG+P+ R+S+  QL++G FNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSA+Q+ LY HMQ KG++LTDGSEKDKKGKGG +TLMNTIMQL+KICNHP+MFQHIE++ AEH  F        P G+     I G DLYR SGKFELLDRILPKLKA NHR+L+FCQMT+LMT++  YF YR F +LRLDGTTKS+DR  LL  FN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  EDE PDDET+NQMIAR+EDEFEL+ R D++R   D    K K RLM  DELPSWI+K+DA +ER     E      +  R R++VDY+D+ TE Q+LR I    D ++ +   E + K++K+   V       D    KK+RGRP    +S     ++ +  +I++ ++NYRD  GR LSE F++LPS+K+LP+YYE+I++P+DFK+IK++++ +KY+++ +L  D+ LLC NAQ YN++GS                 QI+EDSI+L+SV+   + +  R
Sbjct:  338 QGLDPVELLQEREYRLQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRLDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAIATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVYEHKAAQAAKEKKKKRKKKKKEAGD-------------AEGMGAIGPDGEPIDENSQMSELP----VKVIQTETGKVLQGTDAPKSSQLEAWLEMNPGYEVAPRSDSEESGSDFEEEDDEEVVSRAESEEKKVIDPNSDEVSETAAKHIIESAKQDVDDEYSSQAGQTSSQSYYGVAHAVIERVDKQSTFLINGTLKQYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEHLGF--------PNGI-----ISGPDLYRASGKFELLDRILPKLKATNHRVLLFCQMTSLMTILEDYFGYRNFLYLRLDGTTKSEDRAMLLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEE-QNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWILKDDAEVERLTCEEEEEKIFGRGSRHRRDVDYSDALTEKQWLRAI---EDGNLEEIEEEIRLKRRKRRRHVDKDVRREDGDKAKKRRGRPPAEKLSPNPPKLTKQMNAIVDTVINYRDISGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSVSDLEKDVMLLCHNAQTYNLEGS-----------------QIYEDSIVLQSVFKSARQKITR 1492          
BLAST of Transcription activator BRG1 vs. Ensembl Zebrafish
Match: smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5964])

HSP 1 Score: 1198.73 bits (3100), Expect = 0.000e+0
Identity = 683/1206 (56.63%), Postives = 880/1206 (72.97%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXX----------XXXXXXXXXXIVDEEMNINDEIEPIHIGTE-----DDEYNKDQTQT----YYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEH-NFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQFLR 4177
            + LDPVELL +RE R+Q RI  RI EL +   S  P  R K  +ELKAL+LL+ Q+++R D++  M++D  LE+ALN KAY++ KRQTL+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+++ KI KL+KA+  + TN+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV EHK  Q  K+KK+   +K+K+  +              + +  I  +    D N  +  LP    + +    T + L    AP    LE WL+ N G+E+    ++ +              +  E  E +++D   +   E    HI        DDEY+    QT    YY +AH+V E + +QS+ L+NG LK+YQI+GLEW+VSLYNNNLNGILADEMGLGKTIQTIGLITYLME KR+NGP+LIIVPLST+SNW  E +KWAPS++K+ YKG+P+ R+S+  QL++G FNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSA+Q+ LY HMQ KG++LTDGSEKDKKGKGG +TLMNTIMQL+KICNHP+MFQHIE++ AEH  F        P G+     I G DLYR SGKFELLDRILPKLKA NHR+L+FCQMT+LMT++  YF YR F +LRLDGTTKS+DR  LL  FN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  EDE PDDET+NQMIAR+EDEFEL+ R D++R   D    K K RLM  DELPSWI+K+DA +ER     E      +  R R++VDY+D+ TE Q+LR I    D ++ +   E + K++K+   V       D    KK+RGRP    +S     ++ +  +I++ ++NYRD  GR LSE F++LPS+K+LP+YYE+I++P+DFK+IK++++ +KY+++ +L  D+ LLC NAQ YN++GS                 QI+EDSI+L+SV+   + +  R
Sbjct:  338 QGLDPVELLQEREYRLQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRLDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAIATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVYEHKAAQAAKEKKKKRKKKKKEAGD-------------AEGMGAIGPDGEPIDENSQMSELP----VKVIQTETGKVLQGTDAPKSSQLEAWLEMNPGYEVAPRSDSEESGSDFEEEDDEEVVSRAESEEKKVIDPNSDEVSETAAKHIIESAKQDVDDEYSSQAGQTSSQSYYGVAHAVIERVDKQSTFLINGTLKQYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEHLGF--------PNGI-----ISGPDLYRASGKFELLDRILPKLKATNHRVLLFCQMTSLMTILEDYFGYRNFLYLRLDGTTKSEDRAMLLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEE-QNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWILKDDAEVERLTCEEEEEKIFGRGSRHRRDVDYSDALTEKQWLRAI---EDGNLEEIEEEIRLKRRKRRRHVDKDVRREDGDKAKKRRGRPPAEKLSPNPPKLTKQMNAIVDTVINYRDISGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSVSDLEKDVMLLCHNAQTYNLEGS-----------------QIYEDSIVLQSVFKSARQKIAR 1492          
BLAST of Transcription activator BRG1 vs. Ensembl Zebrafish
Match: smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5964])

HSP 1 Score: 1197.96 bits (3098), Expect = 0.000e+0
Identity = 683/1206 (56.63%), Postives = 880/1206 (72.97%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXX----------XXXXXXXXXXIVDEEMNINDEIEPIHIGTE-----DDEYNKDQTQT----YYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEH-NFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQFLR 4177
            + LDPVELL +RE R+Q RI  RI EL +   S  P  R K  +ELKAL+LL+ Q+++R D++  M++D  LE+ALN KAY++ KRQTL+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+++ KI KL+KA+  + TN+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV EHK  Q  K+KK+   +K+K+  +              + +  I  +    D N  +  LP    + +    T + L    AP    LE WL+ N G+E+    ++ +              +  E  E +++D   +   E    HI        DDEY+    QT    YY +AH+V E + +QS+ L+NG LK+YQI+GLEW+VSLYNNNLNGILADEMGLGKTIQTIGLITYLME KR+NGP+LIIVPLST+SNW  E +KWAPS++K+ YKG+P+ R+S+  QL++G FNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSA+Q+ LY HMQ KG++LTDGSEKDKKGKGG +TLMNTIMQL+KICNHP+MFQHIE++ AEH  F        P G+     I G DLYR SGKFELLDRILPKLKA NHR+L+FCQMT+LMT++  YF YR F +LRLDGTTKS+DR  LL  FN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  EDE PDDET+NQMIAR+EDEFEL+ R D++R   D    K K RLM  DELPSWI+K+DA +ER     E      +  R R++VDY+D+ TE Q+LR I    D ++ +   E + K++K+   V       D    KK+RGRP    +S     ++ +  +I++ ++NYRD  GR LSE F++LPS+K+LP+YYE+I++P+DFK+IK++++ +KY+++ +L  D+ LLC NAQ YN++GS                 QI+EDSI+L+SV+   + +  R
Sbjct:  338 QGLDPVELLQEREYRLQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRLDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAIATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVYEHKAAQAAKEKKKKRKKKKKEAGD-------------AEGMGAIGPDGEPIDENSQMSELP----VKVIQTETGKVLQGTDAPKSSQLEAWLEMNPGYEVAPRSDSEESGSDFEEEDDEEVVSRAESEEKKVIDPNSDEVSETAAKHIIESAKQDVDDEYSSQAGQTSSQSYYGVAHAVIERVDKQSTFLINGTLKQYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEHLGF--------PNGI-----ISGPDLYRASGKFELLDRILPKLKATNHRVLLFCQMTSLMTILEDYFGYRNFLYLRLDGTTKSEDRAMLLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEE-QNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWILKDDAEVERLTCEEEEEKIFGRGSRHRRDVDYSDALTEKQWLRAI---EDGNLEEIEEEIRLKRRKRRRHVDKDVRREDGDKAKKRRGRPPAEKLSPNPPKLTKQMNAIVDTVINYRDISGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSVSDLEKDVMLLCHNAQTYNLEGS-----------------QIYEDSIVLQSVFKSARQKIAR 1492          
BLAST of Transcription activator BRG1 vs. Ensembl Zebrafish
Match: smarca4a (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4a [Source:ZFIN;Acc:ZDB-GENE-030605-1])

HSP 1 Score: 1188.33 bits (3073), Expect = 0.000e+0
Identity = 688/1218 (56.49%), Postives = 884/1218 (72.58%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA------------VDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTE-----DDEYNKDQ----TQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHI----IDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLK---------KKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR++  K+ KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV+ HK  Q +K KK+   +K+ +  E  +  L    G   DE  ++       D  + V      IH+D     + + L  + AP  G L+ WL+ N G+E+               D+  +          +  I D +     E++  HI        DDEY         Q+YY +AH+V E++ +QSSLLVNGQLK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNW  EF+KWAPSV+KV YKGSP  R++    L++G FNVL+TTYEYIIKDK  L+KL+WKYMI+DEGHRMKNHHCKLTQ+LNT+YLAP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMTTLMT+M  YF YR FK+LRLDGTTK++DRG LL  FND  H YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIARSE+EF+ + R D++R   +    K + RLM  DELP+WI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I    +D+ +E+V  K    + +K+ + +++P P +   S   +         KKRGRP    +S     ++ K    ++ ++ Y+D +GR LSE FI+LPS+K+LP+YYE+I++P+DF++IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  377 RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKANIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSITAKMQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRAHKAAQALKDKKKKKKKKKPENAEGGAPALGPD-GEPLDETSQM------SDLPVKV------IHVD-----SGKILTGMDAPKAGQLDTWLEMNPGYEVAPRSDSEDSGSDEEEDDEEEPQPSQAPTEEKKVIPDPDSEDVSEVDARHIIEHAKQDVDDEYGNSAFIRGLQSYYAVAHAVTEKVEKQSSLLVNGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEFKRLNGPFLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPAARRAFLPILRSGKFNVLVTTYEYIIKDKQVLAKLRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGSDLYRASGKFELLDRILPKLRATNHKVLLFCQMTTLMTIMEDYFAYRNFKYLRLDGTTKAEDRGMLLKNFNDPSHQYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARSEEEFDHFMRMDLDRRREEARNPKRRPRLMEEDELPTWIMKDDAEVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAIEEGTLDEIEEEVRHKKT-TRKRKRDRDLDLPGPATPSSSGRSRDKDDDGKKQKKRGRPPAEKLSPNPPSLTKKMKKTVDAVIKYKDGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRSHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1545          
BLAST of Transcription activator BRG1 vs. Ensembl Zebrafish
Match: smarca4a (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4a [Source:ZFIN;Acc:ZDB-GENE-030605-1])

HSP 1 Score: 1188.33 bits (3073), Expect = 0.000e+0
Identity = 688/1218 (56.49%), Postives = 884/1218 (72.58%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA------------VDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTE-----DDEYNKDQ----TQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHI----IDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLK---------KKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR++  K+ KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV+ HK  Q +K KK+   +K+ +  E  +  L    G   DE  ++       D  + V      IH+D     + + L  + AP  G L+ WL+ N G+E+               D+  +          +  I D +     E++  HI        DDEY         Q+YY +AH+V E++ +QSSLLVNGQLK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNW  EF+KWAPSV+KV YKGSP  R++    L++G FNVL+TTYEYIIKDK  L+KL+WKYMI+DEGHRMKNHHCKLTQ+LNT+YLAP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMTTLMT+M  YF YR FK+LRLDGTTK++DRG LL  FND  H YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIARSE+EF+ + R D++R   +    K + RLM  DELP+WI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I    +D+ +E+V  K    + +K+ + +++P P +   S   +         KKRGRP    +S     ++ K    ++ ++ Y+D +GR LSE FI+LPS+K+LP+YYE+I++P+DF++IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  377 RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKANIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSITAKMQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRAHKAAQALKDKKKKKKKKKPENAEGGAPALGPD-GEPLDETSQM------SDLPVKV------IHVD-----SGKILTGMDAPKAGQLDTWLEMNPGYEVAPRSDSEDSGSDEEEDDEEEPQPSQAPTEEKKVIPDPDSEDVSEVDARHIIEHAKQDVDDEYGNSAFIRGLQSYYAVAHAVTEKVEKQSSLLVNGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEFKRLNGPFLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPAARRAFLPILRSGKFNVLVTTYEYIIKDKQVLAKLRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGSDLYRASGKFELLDRILPKLRATNHKVLLFCQMTTLMTIMEDYFAYRNFKYLRLDGTTKAEDRGMLLKNFNDPSHQYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARSEEEFDHFMRMDLDRRREEARNPKRRPRLMEEDELPTWIMKDDAEVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAIEEGTLDEIEEEVRHKKT-TRKRKRDRDLDLPGPATPSSSGRSRDKDDDGKKQKKRGRPPAEKLSPNPPSLTKKMKKTVDAVIKYKDGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRSHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1545          
BLAST of Transcription activator BRG1 vs. Ensembl Xenopus
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:NCBI gene;Acc:496545])

HSP 1 Score: 1176.77 bits (3043), Expect = 0.000e+0
Identity = 690/1220 (56.56%), Postives = 885/1220 (72.54%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA---------VDXXXXXXXXXXXXXXXXXIVDEEMNI----NDEIEPIHIGT--------EDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPC---PPSEL------DSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDK-DGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKEFHR+V  KI KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q +K+KK    +K ++  E     L    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+            DE  +E    +  +  +  VDE   I    +D++  +H            DDEY          Q+YY +AH+V E++ +QS+LLVNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNW  EF+KW PSV+KV YKGSP  R++    L++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MS+LQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A  H++L+FCQMTTLMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN++  +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +   E++ ++  + K  +K+K    PC   P +        D    +KKRGRP    +S     ++ K   I++ ++ Y+D  +GR LSE FI+LPS+K+LP+YYE+I++P+DF++IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  344 RGLDPVEVLQEREYRLQARIAHRIQELENLPGSLPGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEFHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAVQALKEKKRRKKKKVQEITEGQQSALGPD-GEPLDETSQM------SDLPIKV------IHVE-----SGKILTGADAPKAGQLEAWLEMNPGYEVAPRSDTEESESEDEEEEEDEQQQPSVTSLLAVDETKKIADPDSDDVSEVHAREIIDNARQDVDDEYGISHAETSGLQSYYAVAHAVSEKVDKQSTLLVNGILKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWVYEFDKWGPSVVKVSYKGSPAARRAFVPMLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFSG----GI-----VQGADLYRASGKFELLDRILPKLRATQHKVLLFCQMTTLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNESSSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERKVFLQAILEHEEQDEEEDEVP-DDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRNRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKTTRKRKRDIDPCIVMPTTSTRGRERDDEGKKQKKRGRPPAEKLSPNPPKLTKKMKKIVDAVIKYKDSGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1515          
BLAST of Transcription activator BRG1 vs. Ensembl Xenopus
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:NCBI gene;Acc:496545])

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 683/1186 (57.59%), Postives = 873/1186 (73.61%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA-VDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDK-DGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKEFHR+V  KI KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q +K+KK    +K ++  E     L    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+    D    E    E         +   +++DE    H  T          Q+YY +AH+V E++ +QS+LLVNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNW  EF+KW PSV+KV YKGSP  R++    L++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MS+LQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A  H++L+FCQMTTLMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN++  +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +   E++ ++  + K  +K+K    PC     D    +KKRGRP    +S     ++ K   I++ ++ Y+D  +GR LSE FI+LPS+K+LP+YYE+I++P+DF++IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  318 RGLDPVEVLQEREYRLQARIAHRIQELENLPGSLPGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEFHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAVQALKEKKRRKKKKVQEITEGQQSALGPD-GEPLDETSQM------SDLPIKV------IHVE-----SGKILTGADAPKAGQLEAWLEMNPGYEVAPRSDTEESESEDEEECACMFPPSNARQDVDDEYGISHAETSG-------LQSYYAVAHAVSEKVDKQSTLLVNGILKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWVYEFDKWGPSVVKVSYKGSPAARRAFVPMLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFSG----GI-----VQGADLYRASGKFELLDRILPKLRATQHKVLLFCQMTTLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNESSSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERKVFLQAILEHEEQDEEEDEVP-DDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRNRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKTTRKRKRDIDPC--IRDDEGKKQKKRGRPPAEKLSPNPPKLTKKMKKIVDAVIKYKDSGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1446          
BLAST of Transcription activator BRG1 vs. Ensembl Xenopus
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:NCBI gene;Acc:496545])

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 688/1210 (56.86%), Postives = 881/1210 (72.81%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXXXXXXXI--VDEEMNI----NDEIEPIHIGT--------EDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPC---PPSEL------DSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDK-DGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELK 4162
            + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKEFHR+V  KI KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q +K+KK    +K ++  E     L    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G   Y  D    +    + + +   +  VDE   I    +D++  +H            DDEY          Q+YY +AH+V E++ +QS+LLVNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNW  EF+KW PSV+KV YKGSP  R++    L++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MS+LQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A  H++L+FCQMTTLMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN++  +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +   E++ ++  + K  +K+K    PC   P +        D    +KKRGRP    +S     ++ K   I++ ++ Y+D  +GR LSE FI+LPS+K+LP+YYE+I++P+DF++IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++
Sbjct:  344 RGLDPVEVLQEREYRLQARIAHRIQELENLPGSLPGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEFHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAVQALKEKKRRKKKKVQEITEGQQSALGPD-GEPLDETSQM------SDLPIKV------IHVE-----SGKILTGADAPKAGQLEAWLEMNPGV-YYTSDTFMAQEEDEQQQPSVTSLLAVDETKKIADPDSDDVSEVHAREIIDNARQDVDDEYGISHAETSGLQSYYAVAHAVSEKVDKQSTLLVNGILKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWVYEFDKWGPSVVKVSYKGSPAARRAFVPMLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFSG----GI-----VQGADLYRASGKFELLDRILPKLRATQHKVLLFCQMTTLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNESSSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERKVFLQAILEHEEQDEEEDEVP-DDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRNRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKTTRKRKRDIDPCIVMPTTSTRGRERDDEGKKQKKRGRPPAEKLSPNPPKLTKKMKKIVDAVIKYKDSGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVR 1504          
BLAST of Transcription activator BRG1 vs. Ensembl Xenopus
Match: gtf3c2 (general transcription factor IIIC subunit 2 [Source:Xenbase;Acc:XB-GENE-997570])

HSP 1 Score: 1175.61 bits (3040), Expect = 0.000e+0
Identity = 681/1245 (54.70%), Postives = 890/1245 (71.49%), Query Frame = 2
Query:  557 KSKRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTEDDEY----NKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDY--------------SEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLR-------------------HIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQFLR 4177
            + K++ IS I  P         + LDPVE+L +RE R+Q RI  RI EL +   S  P  R K  +ELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQTL+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+V  KI KL+KAV  +  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT LV EHK+ Q  K+KK+   +K ++  E +   L    G+  + +          D +  +  LP ++   IH   T + L+   AP    LE WL+ N G+E+    ++       E E+           +  ++        DDEY    +  Q+Q+YY +AH+V E + +QSSLL+NG LK YQI+GLEW+VSL+NNNLNGILADEMGLGKTIQTI LITYLME KR+NGP+LIIVPLST+SNW  EF+KWAPSV+K+ YKG+P  R+S+  QL+ G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSALQ+ LY HMQ+KG++LTDGSEKDKKGKGG +TLMNTIMQLRKICNHPF+FQHIE++ AE      H G +  G+     I G DLYR SGKFELLDRILPKL+A NHR+L+FCQMT+LMT+M  YF +R F +LRLDGTTKS+DR  LL  FN+    +FIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E  +                EDE PDDET+NQMIAR E+EFEL+ R D++R   D      K RLM  D+LPSWI+K+DA +ER     E      +  R R++VDY+D+ T+ Q+LR                     I+D + + +++ V  K +K++++++      + D    KK+RGRP    +S     ++ +  ++++ ++NY+D +GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY++I +L  DI LLC NAQ +N++GS                 QI+EDSI+L+SV+   + + ++
Sbjct:  300 QQKQNRISPIQKP---------QGLDPVEILQEREYRLQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTSLVWEHKKAQAAKEKKKKKKKKAEENAEGVGSGL----GMDGELI----------DESSQMSDLPVKV---IHT-ETGKVLLAPEAPKASQLETWLEMNPGYEVAPRSDSEGSSSEYEEEVLFRHYNGLYCLVKHDV--------DDEYSMQEDARQSQSYYGVAHAVTERVEKQSSLLINGSLKHYQIQGLEWMVSLFNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWLYEFDKWAPSVVKIAYKGTPAMRRSLVPQLRTGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPFIFQHIEESFAE------HLGYS-NGI-----INGPDLYRTSGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRASLLKRFNEEGSPFFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQNEVLAANTGMASVILRPEEDEVPDDETLNQMIARHEEEFELFMRMDLDRRREDARNPNRKPRLMEEDDLPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTDKQWLRVSVIYFIILTLVEFIQRRFFAIEDGNLEEMEEEVRLKKRKRRRNVDKDV--VKEDGEKTKKRRGRPPAEKLSPNPPKLTKQMNAVVDTVINYKDSNGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSISDLEKDIMLLCHNAQTFNLEGS-----------------QIYEDSIVLQSVFRSARQKIVK 1478          
BLAST of Transcription activator BRG1 vs. Ensembl Xenopus
Match: SMARCA4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:NCBI gene;Acc:496545])

HSP 1 Score: 1175.61 bits (3040), Expect = 0.000e+0
Identity = 683/1186 (57.59%), Postives = 874/1186 (73.69%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA-VDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDK-DGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKEFHR+V  KI KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q +K+KK    +K ++  E     L    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+    D    E    E         +   +++DE    H  T          Q+YY +AH+V E++ +QS+LLVNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNW  EF+KW PSV+KV YKGSP  R++    L++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MS+LQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A  H++L+FCQMTTLMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN++  +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +   E++ ++  + K  +K+K    PC   + D    +KKRGRP    +S     ++ K   I++ ++ Y+D  +GR LSE FI+LPS+K+LP+YYE+I++P+DF++IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  314 RGLDPVEVLQEREYRLQARIAHRIQELENLPGSLPGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEFHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAVQALKEKKRRKKKKVQEITEGQQSALGPD-GEPLDETSQM------SDLPIKV------IHVE-----SGKILTGADAPKAGQLEAWLEMNPGYEVAPRSDTEESESEDEEECACMFPPSNARQDVDDEYGISHAETSG-------LQSYYAVAHAVSEKVDKQSTLLVNGILKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWVYEFDKWGPSVVKVSYKGSPAARRAFVPMLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFSG----GI-----VQGADLYRASGKFELLDRILPKLRATQHKVLLFCQMTTLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNESSSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERKVFLQAILEHEEQDEEEDEVP-DDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRNRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKTTRKRKRDIDPCIVMD-DEGKKQKKRGRPPAEKLSPNPPKLTKKMKKIVDAVIKYKDSGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1443          
BLAST of Transcription activator BRG1 vs. Ensembl Mouse
Match: Smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:MGI Symbol;Acc:MGI:99603])

HSP 1 Score: 1177.16 bits (3044), Expect = 0.000e+0
Identity = 684/1225 (55.84%), Postives = 889/1225 (72.57%), Query Frame = 2
Query:  557 KSKRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLP-------PEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVD---EEMNINDEIEPIHIGTED--DEYN----KDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVW 4150
            + K+S IS I  P         + LDPVE+L +RE R+Q RI  RI EL S   S  P  R K  +ELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQTL+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+V  KI KL+KAV  +  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT LV EHK+ Q  K+KK+                        +    K  +N   G+  L     P        ++ + + +  T + L    AP    L+ WL+ N G+E+             +E ++E   +  E  E  ++D   EE++  D  + I    +D  DEY+       +Q+YYT+AH++ E + +QS+LL+NG LK YQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGP+LIIVPLST+SNW  EF+KWAPSV+K+ YKG+P  R+S+  QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSALQ+ LY HMQ+KG++LTDGSEKDKKGKGG +TLMNTIMQLRKICNHP+MFQHIE++ AE      H G +  GV     I G +LYR SGKFELLDRILPKL+A NHR+L+FCQMT+LMT+M  YF +R F +LRLDGTTKS+DR  LL  FN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E  +  ++   DDET+NQMIAR E+EF+L+ R D++R   D    K K RLM  DELPSWI+K+DA +ER     E      +  R R++VDY+D+ TE Q+LR  I+D + + +++ V  K +K++++++    P + D    KK+RGRP    +S     ++ +  +II+ ++NY+D  GR LSE FI+LPS+KDLP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GS                 QI+EDSI+L+SV+
Sbjct:  333 QQKQSRISPIQKP---------QGLDPVEILQEREYRLQARIAHRIQELESLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVWEHKQAQAAKEKKK-----------------------RRRRKKKAEENAEGGEPALGPDGEPIDESSQMSDLPVKVTHTETGKVLFGPEAPKASQLDAWLEMNPGYEVAPRSDSEESESDYEEEDEEEESSRQETEEKILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAE------HLGYS-NGV-----INGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVP-DDETLNQMIARREEEFDLFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLR-AIEDGNLEEMEEEVRLKKRKRRRNVDK--DPVKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKDLPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGS-----------------QIYEDSIVLQSVF 1492          
BLAST of Transcription activator BRG1 vs. Ensembl Mouse
Match: Smarca4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:MGI Symbol;Acc:MGI:88192])

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 690/1240 (55.65%), Postives = 884/1240 (71.29%), Query Frame = 2
Query:  563 KRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDA---------DEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            K+S I+ I  P         + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+F+E+HR+V  K+ KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q+ K+KK+   +K+ +  E  +  +    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+             +E  +E    +        V+E+  I D       E++  HI        DDEY   Q      Q+YY +AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNWA EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN+   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +            +    K   +                + +    +KKRGRP    +S     ++ K   I++ ++ Y+D  GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  348 KQSRITPIQKP---------RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPD-GEPLDETSQM------SDLPVKV------IHVE-----SGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1530          
BLAST of Transcription activator BRG1 vs. Ensembl Mouse
Match: Smarca4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:MGI Symbol;Acc:MGI:88192])

HSP 1 Score: 1172.53 bits (3032), Expect = 0.000e+0
Identity = 690/1241 (55.60%), Postives = 884/1241 (71.23%), Query Frame = 2
Query:  563 KRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDA---------DEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRD-KDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            K+S I+ I  P         + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+F+E+HR+V  K+ KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q+ K+KK+   +K+ +  E  +  +    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+             +E  +E    +        V+E+  I D       E++  HI        DDEY   Q      Q+YY +AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNWA EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN+   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +            +    K   +                + +    +KKRGRP    +S     ++ K   I++ ++ Y+D   GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  348 KQSRITPIQKP---------RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPD-GEPLDETSQM------SDLPVKV------IHVE-----SGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1531          
BLAST of Transcription activator BRG1 vs. Ensembl Mouse
Match: Smarca4 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:MGI Symbol;Acc:MGI:88192])

HSP 1 Score: 1169.45 bits (3024), Expect = 0.000e+0
Identity = 694/1244 (55.79%), Postives = 893/1244 (71.78%), Query Frame = 2
Query:  563 KRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHI--IDDADEDVIDKSVENXXXXXXXSMEVPCPPSEL----------DSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRD-KDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            K+S I+ I  P         + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+F+E+HR+V  K+ KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q+ K+KK+   +K+ +  E  +  +    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+             +E  +E    +        V+E+  I D       E++  HI        DDEY   Q      Q+YY +AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNWA EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN+   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ +  I++   + I++ V  K   +K+  +     S            +    +KKRGRP    +S     ++ K   I++ ++ Y+D   GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  348 KQSRITPIQKP---------RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPD-GEPLDETSQM------SDLPVKV------IHVE-----SGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1534          
BLAST of Transcription activator BRG1 vs. Ensembl Mouse
Match: Smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:MGI Symbol;Acc:MGI:99603])

HSP 1 Score: 1167.14 bits (3018), Expect = 0.000e+0
Identity = 684/1243 (55.03%), Postives = 890/1243 (71.60%), Query Frame = 2
Query:  557 KSKRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLP-------PEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVD---EEMNINDEIEPIHIGTED--DEYN----KDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDK------------------DGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVW 4150
            + K+S IS I  P         + LDPVE+L +RE R+Q RI  RI EL S   S  P  R K  +ELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQTL+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+V  KI KL+KAV  +  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT LV EHK+ Q  K+KK+                        +    K  +N   G+  L     P        ++ + + +  T + L    AP    L+ WL+ N G+E+             +E ++E   +  E  E  ++D   EE++  D  + I    +D  DEY+       +Q+YYT+AH++ E + +QS+LL+NG LK YQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGP+LIIVPLST+SNW  EF+KWAPSV+K+ YKG+P  R+S+  QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSALQ+ LY HMQ+KG++LTDGSEKDKKGKGG +TLMNTIMQLRKICNHP+MFQHIE++ AE      H G +  GV     I G +LYR SGKFELLDRILPKL+A NHR+L+FCQMT+LMT+M  YF +R F +LRLDGTTKS+DR  LL  FN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E  +  ++   DDET+NQMIAR E+EF+L+ R D++R   D    K K RLM  DELPSWI+K+DA +ER     E      +  R R++VDY+D+ TE Q+LR  I+D + + +++ V  K +K++++++    P + D    KK+RGRP    +S     ++ +  +II+ ++NY+D+                   GR LSE FI+LPS+KDLP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GS                 QI+EDSI+L+SV+
Sbjct:  333 QQKQSRISPIQKP---------QGLDPVEILQEREYRLQARIAHRIQELESLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVWEHKQAQAAKEKKK-----------------------RRRRKKKAEENAEGGEPALGPDGEPIDESSQMSDLPVKVTHTETGKVLFGPEAPKASQLDAWLEMNPGYEVAPRSDSEESESDYEEEDEEEESSRQETEEKILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAE------HLGYS-NGV-----INGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVP-DDETLNQMIARREEEFDLFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLR-AIEDGNLEEMEEEVRLKKRKRRRNVDK--DPVKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVPCNSQLEIEGNSSGRQLSEVFIQLPSRKDLPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGS-----------------QIYEDSIVLQSVF 1510          
BLAST of Transcription activator BRG1 vs. UniProt/SwissProt
Match: sp|P51532|SMCA4_HUMAN (Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2)

HSP 1 Score: 1188.71 bits (3074), Expect = 0.000e+0
Identity = 698/1273 (54.83%), Postives = 889/1273 (69.84%), Query Frame = 2
Query:  563 KRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDY--------------------------------SEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVID---------KSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKD-GRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            K+S I+ I  P         + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+V  KI KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q+ K+KK+   +K+ +  E  +  +    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+             +E  +E    +        V+E+  I D       E++  HI        DDEY   Q      Q+YY +AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNWA EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN+   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++                                  EDE PDDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +   E++ +         K   +                + D    +KKRGRP    +S     ++ K   I++ ++ Y+D   GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  348 KQSRITPIQKP---------RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPD-GEPLDETSQM------SDLPVKV------IHVE-----SGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1564          
BLAST of Transcription activator BRG1 vs. UniProt/SwissProt
Match: sp|A7Z019|SMCA4_BOVIN (Transcription activator BRG1 OS=Bos taurus OX=9913 GN=SMARCA4 PE=2 SV=1)

HSP 1 Score: 1181.01 bits (3054), Expect = 0.000e+0
Identity = 698/1241 (56.24%), Postives = 896/1241 (72.20%), Query Frame = 2
Query:  563 KRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVID--KSVENXXXXXXXSMEVPCPPS-------ELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRD-KDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            K+S I+ I  P         + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+V  KI KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q+ K+KK+   +K+ +  E  +  +    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+             +E  +E    +        V+E+  I D       E++  HI        DDEY   Q      Q+YY +AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNWA EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN+   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +   E++ +  +  ++  K+K+ S   P  P+       + D    +KKRGRP    +S     ++ K   I++ ++ Y+D   GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  340 KQSRITPIQKP---------RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPD-GEPLDETSQM------SDLPVKV------IHVE-----SGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGPSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1523          
BLAST of Transcription activator BRG1 vs. UniProt/SwissProt
Match: sp|Q6DIC0|SMCA2_MOUSE (Probable global transcription activator SNF2L2 OS=Mus musculus OX=10090 GN=Smarca2 PE=1 SV=1)

HSP 1 Score: 1177.16 bits (3044), Expect = 0.000e+0
Identity = 684/1225 (55.84%), Postives = 889/1225 (72.57%), Query Frame = 2
Query:  557 KSKRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLP-------PEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVD---EEMNINDEIEPIHIGTED--DEYN----KDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVW 4150
            + K+S IS I  P         + LDPVE+L +RE R+Q RI  RI EL S   S  P  R K  +ELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQTL+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+V  KI KL+KAV  +  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT LV EHK+ Q  K+KK+                        +    K  +N   G+  L     P        ++ + + +  T + L    AP    L+ WL+ N G+E+             +E ++E   +  E  E  ++D   EE++  D  + I    +D  DEY+       +Q+YYT+AH++ E + +QS+LL+NG LK YQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGP+LIIVPLST+SNW  EF+KWAPSV+K+ YKG+P  R+S+  QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSALQ+ LY HMQ+KG++LTDGSEKDKKGKGG +TLMNTIMQLRKICNHP+MFQHIE++ AE      H G +  GV     I G +LYR SGKFELLDRILPKL+A NHR+L+FCQMT+LMT+M  YF +R F +LRLDGTTKS+DR  LL  FN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E  +  ++   DDET+NQMIAR E+EF+L+ R D++R   D    K K RLM  DELPSWI+K+DA +ER     E      +  R R++VDY+D+ TE Q+LR  I+D + + +++ V  K +K++++++    P + D    KK+RGRP    +S     ++ +  +II+ ++NY+D  GR LSE FI+LPS+KDLP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GS                 QI+EDSI+L+SV+
Sbjct:  327 QQKQSRISPIQKP---------QGLDPVEILQEREYRLQARIAHRIQELESLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVWEHKQAQAAKEKKK-----------------------RRRRKKKAEENAEGGEPALGPDGEPIDESSQMSDLPVKVTHTETGKVLFGPEAPKASQLDAWLEMNPGYEVAPRSDSEESESDYEEEDEEEESSRQETEEKILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAE------HLGYS-NGV-----INGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVP-DDETLNQMIARREEEFDLFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLR-AIEDGNLEEMEEEVRLKKRKRRRNVDK--DPVKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKDLPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGS-----------------QIYEDSIVLQSVF 1486          
BLAST of Transcription activator BRG1 vs. UniProt/SwissProt
Match: sp|Q8K1P7|SMCA4_RAT (Transcription activator BRG1 OS=Rattus norvegicus OX=10116 GN=Smarca4 PE=1 SV=1)

HSP 1 Score: 1176.77 bits (3043), Expect = 0.000e+0
Identity = 690/1240 (55.65%), Postives = 884/1240 (71.29%), Query Frame = 2
Query:  563 KRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDA---------DEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            K+S I+ I  P         + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+F+E+HR+V  K+ KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q+ K+KK+   +K+ +  E  +  +    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+             +E  +E    +        V+E+  I D       E++  HI        DDEY   Q      Q+YY +AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNWA EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN+   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +            +    K   +                + +    +KKRGRP    +S     ++ K   I++ ++ Y+D  GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  348 KQSRITPIQKP---------RGLDPVEILQEREYRLQARIVHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPD-GEPLDETSQM------SDLPVKV------IHVE-----SGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1530          
BLAST of Transcription activator BRG1 vs. UniProt/SwissProt
Match: sp|Q3TKT4|SMCA4_MOUSE (Transcription activator BRG1 OS=Mus musculus OX=10090 GN=Smarca4 PE=1 SV=1)

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 690/1240 (55.65%), Postives = 884/1240 (71.29%), Query Frame = 2
Query:  563 KRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQT-----QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDA---------DEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            K+S I+ I  P         + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+F+E+HR+V  K+ KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV++HK  Q+ K+KK+   +K+ +  E  +  +    G   DE  ++       D  + V      IH++     + + L    AP  G LE WL+ N G+E+             +E  +E    +        V+E+  I D       E++  HI        DDEY   Q      Q+YY +AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNWA EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YRGFK+LRLDGTTK++DRG LL  FN+   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIAR E+EF+L+ R D++R   +    K K RLM  DELPSWI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +            +    K   +                + +    +KKRGRP    +S     ++ K   I++ ++ Y+D  GR LSE FI+LPS+K+LP+YYE+I++P+DFK+IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  348 KQSRITPIQKP---------RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPD-GEPLDETSQM------SDLPVKV------IHVE-----SGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1530          
BLAST of Transcription activator BRG1 vs. TrEMBL
Match: A0A4E0RV45 (Global transcription activator snf2l2 OS=Fasciola hepatica OX=6192 GN=D915_007926 PE=4 SV=1)

HSP 1 Score: 1367.83 bits (3539), Expect = 0.000e+0
Identity = 765/1268 (60.33%), Postives = 939/1268 (74.05%), Query Frame = 2
Query:  566 RSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVK------------NLFAGDFNL-----------AVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEP-----------IHIGTEDDEYNK------DQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSKKRIRKEVDYTDSFTEAQFLRHI----IDDADE-------------DVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRP---------FNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            RS ++ I  P         + LDPVELL +RE RIQ+RI QRI EL+S ++   P  R+  ++EL++L+LL+ Q+++R DI+ +M++D  LE+ALNVKAYR+PK+QTLKE+RFTEKLEK++K++QEKR+RQKHQEFLNA + H K+F+EFHRNVN +++K+NKAVLNY  N+ER KRKEQERI+RERMRRLMAEDEEGYR LIDEKKD RLH+LL+QTDEFI  LTKLV+EHKR+Q  ++ +E    +++ +   L   ++    L+ DE  +  +              F  +FN            A   L P++ I ++  +T++      AP+   +  WL+E+ GWE+   D +                 DEE+      +            +H+GTEDDEYNK      +  Q+YYTLAH+V+EE++EQ S+LV+G+LKEYQ++GLEWLVSLYNNNLNGILADEMGLGKTIQTI LIT+LMEKKRVNGPFLIIVPLS MSNWALEF++WAPSV K+LYKGSP  R+ +Q QLK    NVLLTTYEYIIKDK +LSK+KWKYMIIDEGHRMKNHHCKLTQ+LNTYY+APYRLLLTGTPLQNKLPELWALLNFLLP IF+SVNTFEQWFNAPF+ +GEKVELNQEETLLIIRRLHKVLRPFLLRRLK+EVESQLP+KVEYVIKCEMSALQR LY+HMQSKGVILTDGSEKDKKGKGG RTL+NTIMQLRKICNHPFMF HIE AIAE NFM  H G  PPGVP+PT++ G+ LYR SGKFELLDRILPKLKA  HR+LIFCQMT+LMT+M  YF+YR F++LRLDGTT+S+DRGDLL  FND   D FIF+LSTRAGGLGLNLQAADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRLI+ NSVEEKILAAARFKL+VD+KVIQAGMFDQKSTGTER QFLQALL QDE  D  EDE PDDETINQM+ARSE+EFE+YQR D+ER  +++ + + + RLM + ELP WI++++  +ER+L   E       KR RKEVDY+D+ TE QFL+ I    +++A+E              + D S  +    +  S+ +  PP+       K++RGRP            ++S K      + L II   + Y+D D R+LSEPF+KLP++K+LPDYYE+IK+PMDF RIKQ++++ KY +I EL  DI LLC NAQ YNMDGSL                 IFEDS++L+SVW   +++ 
Sbjct:  271 RSRLTPIQRP---------QGLDPVELLKEREQRIQSRIAQRIKELSSLTMFSTPEQRISLMLELRSLRLLNFQRQLRQDIVASMRRDTSLETALNVKAYRRPKKQTLKEARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLTHGKDFREFHRNVNSRMVKINKAVLNYKANAERDKRKEQERIDRERMRRLMAEDEEGYRCLIDEKKDQRLHHLLTQTDEFIGNLTKLVREHKREQTKQRVRERSERRRQAQETALQNAVNYYRRLA-DEAVRSGRPPPTYLATLPPTEKFPEEFNQVNRDWLNGKAPAANILLPQVRIPMYQATTKEICEGDAAPMASEVYSWLQEHPGWEVLPTDVDGSTVQDLLD-------TDEELKRKRRFDDDDDDDDDDSAMVHVGTEDDEYNKRGESSANAPQSYYTLAHAVREEVKEQPSILVHGKLKEYQLRGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITHLMEKKRVNGPFLIIVPLSVMSNWALEFDRWAPSVKKILYKGSPQARRILQGQLKASKINVLLTTYEYIIKDKSALSKVKWKYMIIDEGHRMKNHHCKLTQVLNTYYIAPYRLLLTGTPLQNKLPELWALLNFLLPTIFESVNTFEQWFNAPFSATGEKVELNQEETLLIIRRLHKVLRPFLLRRLKREVESQLPEKVEYVIKCEMSALQRVLYSHMQSKGVILTDGSEKDKKGKGGCRTLLNTIMQLRKICNHPFMFSHIELAIAEQNFMATHGGNPPPGVPLPTQVEGKVLYRASGKFELLDRILPKLKACGHRVLIFCQMTSLMTIMQDYFDYRNFRYLRLDGTTRSEDRGDLLVKFNDTSEDIFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLISINSVEEKILAAARFKLDVDQKVIQAGMFDQKSTGTERRQFLQALLEQDEEADEEEDEAPDDETINQMLARSEEEFEIYQRMDMERQFTESQQARQEQRLMEYSELPKWIIRDEVELERSLRVEE--SVFGMKRQRKEVDYSDALTERQFLKAIDEGSLEEAEERQRQKRATRKKRKRIDDSSFMDDASSEAGSISMTAPPTA------KRRRGRPPHSSGSTGGRGGALSPKQTKKMQRLLDII---IEYKDNDQRVLSEPFMKLPTRKELPDYYEVIKKPMDFHRIKQRVRDGKYHSIDELEADIMLLCKNAQTYNMDGSL-----------------IFEDSVVLQSVWTNARERL 1493          

HSP 2 Score: 66.2402 bits (160), Expect = 9.028e-7
Identity = 27/45 (60.00%), Postives = 39/45 (86.67%), Query Frame = 2
Query:  371 NNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLIN 505
            N+   F+++QL+QLRAQIN+YKLL+KSQP+P++LI AAEG+Q + 
Sbjct:  128 NSQTPFMRDQLVQLRAQINAYKLLAKSQPVPETLILAAEGRQFVG 172          
BLAST of Transcription activator BRG1 vs. TrEMBL
Match: H2KT90 (Putative global transcription activator SNF2L2 OS=Clonorchis sinensis OX=79923 GN=Smarca2 PE=4 SV=1)

HSP 1 Score: 1367.44 bits (3538), Expect = 0.000e+0
Identity = 763/1243 (61.38%), Postives = 947/1243 (76.19%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQI-------IXXXXXXXXXXXXXXIEYLSKTL--SKRCG--------------LSKDEVCKIVKNLFAG-DFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA--VDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTEDDEYNK------DQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSKKRIRKEVDYTDSFTEAQFLRHIIDDA-----------------DEDVIDKSVENXXXXXXXS--MEVPCPPSELDSLNLKKKRGRPFNNS-----VSSKDNLMSAKYLSIINKLL----NYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            + LDPVELL +RE RIQ+RI QRI EL+S S    P  R+  LIEL++L+LL+ Q+++R DI+++M++D  LE+ALNVKAYR+PK+QTL+E+RFTEKLEK++KY+QEKR+RQKHQEFLNA + H K+F+EFHRNVN +++K+NKAVLNY  N+ER KRKEQERI+RERMRRLMAEDEEGYR LID KKD RLH+LL+QTDEFI+ LTKLV+EHKR+Q          +++       +  + Y  ++   S R G              +  +E+ ++ ++   G   N +VQ   PE+HI ++  +T++ L    APL   +  WL+++ GWE+    VD +  +      E  + +   EE + +D+   +H+GTEDDEYNK      +  Q+YYTLAH+V+EE++EQ+S+LV+G+LKEYQ++GLEWLVSLYNNNLNGILADEMGLGKTIQTI LIT+LMEKKRVNGPFLIIVPLS MSNWA+EF++WAPSV K+LYKGSP  R+ +Q QLK    NVLLTTYEYIIKDK +LSK+KWKYMIIDEGHRMKNHHCKLTQ+LNTYY APYRLLLTGTPLQNKLPELWALLNFLLP IF+SVNTFEQWFNAPFA +GEKVELNQEETLLIIRRLHKVLRPFLLRRLK+EVESQLP+KVEYVIKC+MSALQR LY+HMQSKGVILTDGSEKDKKGKGG RTLMNTIMQLRKICNHPFMF HIE AIAE +F+  H G  PPG+P+PT++ G+ LYR SGKFELLDRILPKLKA  HR+LIFCQMT+LMT+M  YF+YR F++LRLDGTT+++DRG+LL  FND   D FIF+LSTRAGGLGLNLQAADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRLI+ NSVEEKILAAARFKL+VD+KVIQAGMFDQKSTGTER QFLQALL QDE  D  EDE PDDETINQM+AR+E+EFE+YQR D+ER  +++ + K + RLM + ELP+WI++++A +ER+L   +    L  KR RKEVDY+D+ TE QFL+ I + +                  + + D S  +    +  S  M  P  P        K++RGRP ++S      S   + +S K +  + +LL    +Y+DKD RILSEPF+KLP++K+LPDYYE+IK+PMDF RIKQ++++ KY+++ EL  D+ LLC NAQ YNMDGSL                 IFEDS++L+SVW   +++ 
Sbjct:  280 QGLDPVELLKEREQRIQSRIAQRIKELSSLSAFSTPEQRVSLLIELRSLRLLNFQRQLRQDIVSSMRRDTSLETALNVKAYRRPKKQTLREARFTEKLEKQMKYEQEKRRRQKHQEFLNAVLSHGKDFREFHRNVNSRMMKINKAVLNYKANAERDKRKEQERIDRERMRRLMAEDEEGYRCLIDAKKDQRLHHLLTQTDEFISNLTKLVREHKREQSKQRVREKADRRRMAQETALQNAVNYYRRSAEESLRSGNPPPAYLATLPPIDMFPEELQQVNRDWICGKQPNASVQL--PEVHISVYQTTTKELLEGSSAPLASEVYTWLQDHPGWEVTPTDVDGSTIQDLLETEEDLKRKRRSEEDDDDDDSTMVHVGTEDDEYNKRGESGANVPQSYYTLAHAVREEVKEQASILVHGRLKEYQLRGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITHLMEKKRVNGPFLIIVPLSVMSNWAMEFDRWAPSVKKILYKGSPQARRLLQVQLKASKINVLLTTYEYIIKDKAALSKIKWKYMIIDEGHRMKNHHCKLTQVLNTYYTAPYRLLLTGTPLQNKLPELWALLNFLLPTIFESVNTFEQWFNAPFAATGEKVELNQEETLLIIRRLHKVLRPFLLRRLKREVESQLPEKVEYVIKCDMSALQRVLYSHMQSKGVILTDGSEKDKKGKGGCRTLMNTIMQLRKICNHPFMFTHIELAIAEQSFISNHGGNPPPGMPLPTQVEGKMLYRSSGKFELLDRILPKLKACGHRVLIFCQMTSLMTIMQDYFDYRNFRYLRLDGTTRAEDRGELLVKFNDTTEDIFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLISINSVEEKILAAARFKLDVDQKVIQAGMFDQKSTGTERRQFLQALLEQDEEADEEEDEAPDDETINQMLARTEEEFEIYQRMDVERQFAESQQTKREPRLMEYAELPNWIIRDEAELERSLLMEDGVFGL--KRQRKEVDYSDALTERQFLKAIDEGSLEEAEERQRQRRAARKKRKRIDDSSFLDDASSEAGSTIMAAPSTP--------KRRRGRPPHSSGPRTGTSRNSSAVSPKLIKKLRRLLDIIIDYKDKDQRILSEPFMKLPTRKELPDYYEVIKKPMDFHRIKQRVRDGKYRSVDELEADVMLLCKNAQTYNMDGSL-----------------IFEDSVVLQSVWTNARERL 1493          

HSP 2 Score: 65.855 bits (159), Expect = 1.130e-6
Identity = 33/67 (49.25%), Postives = 44/67 (65.67%), Query Frame = 2
Query:  326 YHNYDQQKSALKPGENN----DKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDN 514
            Y +  Q   A  P   N       FLK+QL+QLRAQI++YKLLSKSQP+P +++ AAEG+Q I + N
Sbjct:  112 YGHLHQAAPAQAPETGNLVTSQTPFLKDQLVQLRAQISAYKLLSKSQPVPDTILMAAEGRQFIGHAN 178          
BLAST of Transcription activator BRG1 vs. TrEMBL
Match: A0A4S2MEU9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000544 PE=4 SV=1)

HSP 1 Score: 1365.9 bits (3534), Expect = 0.000e+0
Identity = 764/1243 (61.46%), Postives = 948/1243 (76.27%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTL---------SKRCG--------------LSKDEVCKIVKNLFAG-DFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA--VDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTEDDEYNK------DQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSKKRIRKEVDYTDSFTEAQFLRHIIDDA-----------------DEDVIDKSVENXXXXXXXS--MEVPCPPSELDSLNLKKKRGRPFNNS-----VSSKDNLMSAKYLSIINKLL----NYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            + LDPVELL +RE RIQ+RI QRI EL+S S    P  R+  LIEL++L+LL+ Q+++R DI+++M++D  LE+ALNVKAYR+PK+QTL+E+RFTEKLEK++KY+QEKR+RQKHQEFLNA + H K+F+EFHRNVN +++K+NKAVLNY  N+ER KRKEQERI+RERMRRLMAEDEEGYR LID KKD RLH+LL+QTDEFI+ LTKLV+EHKR+Q  ++ +E    ++  +   L   +         S R G              +  +E+ ++ ++   G   N +VQ   PE+HI ++  +T++ L    APL   +  WL+++ GWE+    VD +  +      E  + +   EE + +D+   +H+GTEDDEYNK      +  Q+YYTLAH+V+EE++EQ+S+LV+G+LKEYQ++GLEWLVSLYNNNLNGILADEMGLGKTIQTI LIT+LMEKKRVNGPFLIIVPLS MSNWA+EF++WAPSV K+LYKGSP  R+ +Q QLK    NVLLTTYEYIIKDK +LSK+KWKYMIIDEGHRMKNHHCKLTQ+LNTYY APYRLLLTGTPLQNKLPELWALLNFLLP IF+SVNTFEQWFNAPFA +GEKVELNQEETLLIIRRLHKVLRPFLLRRLK+EVESQLP+KVEYVIKC+MSALQR LY+HMQSKGVILTDGSEKDKKGKGG RTLMNTIMQLRKICNHPFMF HIE AIAE +F+  H G  PPG+P+PT++ G+ LYR SGKFELLDRILPKLKA  HR+LIFCQMT+LMT+M  YF+YR F++LRLDGTT+++DRG+LL  FND   D FIF+LSTRAGGLGLNLQAADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRLI+ NSVEEKILAAARFKL+VD+KVIQAGMFDQKSTGTER QFLQALL QDE  D  EDE PDDETINQM+AR+E+EFE+YQR D+ER  +++ + K + RLM + ELP+WI++++A +ER+L   +    L  KR RKEVDY+D+ TE QFL+ I + +                  + + D S  +    +  S  M  P  P        K++RGRP ++S      S   + +S K +  + +LL    +Y+DKD RILSEPF+KLP++K+LPDYYE+IK+PMDF RIKQ++++ KY+++ EL  D+ LLC NAQ YNMDGSL                 IFEDS++L+SVW   +++ 
Sbjct:  280 QGLDPVELLKEREQRIQSRIAQRIKELSSLSAFSTPEQRVSLLIELRSLRLLNFQRQLRQDIVSSMRRDTSLETALNVKAYRRPKKQTLREARFTEKLEKQMKYEQEKRRRQKHQEFLNAVLSHGKDFREFHRNVNSRMMKINKAVLNYKANAERDKRKEQERIDRERMRRLMAEDEEGYRCLIDAKKDQRLHHLLTQTDEFISNLTKLVREHKREQSKQRVREKADRRRMAQETALQNAVNYYRRLAEESLRSGNPPPAYLATLPPIDMFPEELQQVNRDWICGKQPNASVQL--PEVHISVYQTTTKELLEGSSAPLASEVYTWLQDHPGWELTPTDVDGSTIQDLLETEEDLKRKRRSEEDDDDDDSTMVHVGTEDDEYNKRGESGANVPQSYYTLAHAVREEVKEQASILVHGRLKEYQLRGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITHLMEKKRVNGPFLIIVPLSVMSNWAMEFDRWAPSVKKILYKGSPQARRLLQVQLKASKINVLLTTYEYIIKDKAALSKVKWKYMIIDEGHRMKNHHCKLTQVLNTYYTAPYRLLLTGTPLQNKLPELWALLNFLLPTIFESVNTFEQWFNAPFAATGEKVELNQEETLLIIRRLHKVLRPFLLRRLKREVESQLPEKVEYVIKCDMSALQRVLYSHMQSKGVILTDGSEKDKKGKGGCRTLMNTIMQLRKICNHPFMFTHIELAIAEQSFISNHGGNPPPGMPLPTQVEGKMLYRSSGKFELLDRILPKLKACGHRVLIFCQMTSLMTIMQDYFDYRNFRYLRLDGTTRAEDRGELLVKFNDTTEDIFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLISINSVEEKILAAARFKLDVDQKVIQAGMFDQKSTGTERRQFLQALLEQDEEADEEEDEAPDDETINQMLARTEEEFEIYQRMDVERQFAESQQTKREPRLMEYAELPNWIIRDEAELERSLLMEDGVFGL--KRQRKEVDYSDALTERQFLKAIDEGSLEEAEERQRQRRAARKKRKRIDDSSFLDDASSEAGSTIMAAPSTP--------KRRRGRPPHSSGPRTGTSRNSSAVSPKLIKKLRRLLDIIIDYKDKDQRILSEPFMKLPTRKELPDYYEVIKKPMDFHRIKQRVRDGKYRSVDELEADVMLLCKNAQTYNMDGSL-----------------IFEDSVVLQSVWTNARERL 1493          

HSP 2 Score: 66.6254 bits (161), Expect = 6.757e-7
Identity = 47/138 (34.06%), Postives = 65/138 (47.10%), Query Frame = 2
Query:  248 SNSKSYPGYFNLPPITNHNIPSLNQTYHNYDQQKSALKPGENN----DKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLIN--NDNKSIYDFKA------NENTNGKSKRSNISKILTP---SNHGIPG 616
            S     PG  +LP             Y +  Q   A  P   N       FLK+QL+QLRAQI++YKLLSKSQP+P +++ AAEG+Q I   N N S+           N  + G S+ ++     +P   +  G PG
Sbjct:   99 SGPPGDPGTASLP-------------YGHLHQAAPAQAPETGNLVTSQTPFLKDQLVQLRAQISAYKLLSKSQPVPDTILMAAEGRQFIGHANLNGSVQPGSGAQPNAWNAASQGASQVTSAPTSTSPQGDTQRGTPG 223          
BLAST of Transcription activator BRG1 vs. TrEMBL
Match: A0A4V3SH69 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000544 PE=4 SV=1)

HSP 1 Score: 1363.98 bits (3529), Expect = 0.000e+0
Identity = 768/1262 (60.86%), Postives = 954/1262 (75.59%), Query Frame = 2
Query:  566 RSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTL---------SKRCG--------------LSKDEVCKIVKNLFAG-DFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA--VDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTEDDEYNK------DQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSKKRIRKEVDYTDSFTEAQFLRHIIDDA-----------------DEDVIDKSVENXXXXXXXS--MEVPCPPSELDSLNLKKKRGRPFNNS-----VSSKDNLMSAKYLSIINKLL----NYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            RS ++ I  P         + LDPVELL +RE RIQ+RI QRI EL+S S    P  R+  LIEL++L+LL+ Q+++R DI+++M++D  LE+ALNVKAYR+PK+QTL+E+RFTEKLEK++KY+QEKR+RQKHQEFLNA + H K+F+EFHRNVN +++K+NKAVLNY  N+ER KRKEQERI+RERMRRLMAEDEEGYR LID KKD RLH+LL+QTDEFI+ LTKLV+EHKR+Q  ++ +E    ++  +   L   +         S R G              +  +E+ ++ ++   G   N +VQ   PE+HI ++  +T++ L    APL   +  WL+++ GWE+    VD +  +      E  + +   EE + +D+   +H+GTEDDEYNK      +  Q+YYTLAH+V+EE++EQ+S+LV+G+LKEYQ++GLEWLVSLYNNNLNGILADEMGLGKTIQTI LIT+LMEKKRVNGPFLIIVPLS MSNWA+EF++WAPSV K+LYKGSP  R+ +Q QLK    NVLLTTYEYIIKDK +LSK+KWKYMIIDEGHRMKNHHCKLTQ+LNTYY APYRLLLTGTPLQNKLPELWALLNFLLP IF+SVNTFEQWFNAPFA +GEKVELNQEETLLIIRRLHKVLRPFLLRRLK+EVESQLP+KVEYVIKC+MSALQR LY+HMQSKGVILTDGSEKDKKGKGG RTLMNTIMQLRKICNHPFMF HIE AIAE +F+  H G  PPG+P+PT++ G+ LYR SGKFELLDRILPKLKA  HR+LIFCQMT+LMT+M  YF+YR F++LRLDGTT+++DRG+LL  FND   D FIF+LSTRAGGLGLNLQAADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRLI+ NSVEEKILAAARFKL+VD+KVIQAGMFDQKSTGTER QFLQALL QDE  D  EDE PDDETINQM+AR+E+EFE+YQR D+ER  +++ + K + RLM + ELP+WI++++A +ER+L   +    L  KR RKEVDY+D+ TE QFL+ I + +                  + + D S  +    +  S  M  P  P        K++RGRP ++S      S   + +S K +  + +LL    +Y+DKD RILSEPF+KLP++K+LPDYYE+IK+PMDF RIKQ++++ KY+++ EL  D+ LLC NAQ YNMDGSL                 IFEDS++L+SVW   +++ 
Sbjct:  270 RSRLTPIQRP---------QGLDPVELLKEREQRIQSRIAQRIKELSSLSAFSTPEQRVSLLIELRSLRLLNFQRQLRQDIVSSMRRDTSLETALNVKAYRRPKKQTLREARFTEKLEKQMKYEQEKRRRQKHQEFLNAVLSHGKDFREFHRNVNSRMMKINKAVLNYKANAERDKRKEQERIDRERMRRLMAEDEEGYRCLIDAKKDQRLHHLLTQTDEFISNLTKLVREHKREQSKQRVREKADRRRMAQETALQNAVNYYRRLAEESLRSGNPPPAYLATLPPIDMFPEELQQVNRDWICGKQPNASVQL--PEVHISVYQTTTKELLEGSSAPLASEVYTWLQDHPGWELTPTDVDGSTIQDLLETEEDLKRKRRSEEDDDDDDSTMVHVGTEDDEYNKRGESGANVPQSYYTLAHAVREEVKEQASILVHGRLKEYQLRGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITHLMEKKRVNGPFLIIVPLSVMSNWAMEFDRWAPSVKKILYKGSPQARRLLQVQLKASKINVLLTTYEYIIKDKAALSKVKWKYMIIDEGHRMKNHHCKLTQVLNTYYTAPYRLLLTGTPLQNKLPELWALLNFLLPTIFESVNTFEQWFNAPFAATGEKVELNQEETLLIIRRLHKVLRPFLLRRLKREVESQLPEKVEYVIKCDMSALQRVLYSHMQSKGVILTDGSEKDKKGKGGCRTLMNTIMQLRKICNHPFMFTHIELAIAEQSFISNHGGNPPPGMPLPTQVEGKMLYRSSGKFELLDRILPKLKACGHRVLIFCQMTSLMTIMQDYFDYRNFRYLRLDGTTRAEDRGELLVKFNDTTEDIFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLISINSVEEKILAAARFKLDVDQKVIQAGMFDQKSTGTERRQFLQALLEQDEEADEEEDEAPDDETINQMLARTEEEFEIYQRMDVERQFAESQQTKREPRLMEYAELPNWIIRDEAELERSLLMEDGVFGL--KRQRKEVDYSDALTERQFLKAIDEGSLEEAEERQRQRRAARKKRKRIDDSSFLDDASSEAGSTIMAAPSTP--------KRRRGRPPHSSGPRTGTSRNSSAVSPKLIKKLRRLLDIIIDYKDKDQRILSEPFMKLPTRKELPDYYEVIKKPMDFHRIKQRVRDGKYRSVDELEADVMLLCKNAQTYNMDGSL-----------------IFEDSVVLQSVWTNARERL 1493          

HSP 2 Score: 66.6254 bits (161), Expect = 6.735e-7
Identity = 47/138 (34.06%), Postives = 65/138 (47.10%), Query Frame = 2
Query:  248 SNSKSYPGYFNLPPITNHNIPSLNQTYHNYDQQKSALKPGENN----DKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLIN--NDNKSIYDFKA------NENTNGKSKRSNISKILTP---SNHGIPG 616
            S     PG  +LP             Y +  Q   A  P   N       FLK+QL+QLRAQI++YKLLSKSQP+P +++ AAEG+Q I   N N S+           N  + G S+ ++     +P   +  G PG
Sbjct:   99 SGPPGDPGTASLP-------------YGHLHQAAPAQAPETGNLVTSQTPFLKDQLVQLRAQISAYKLLSKSQPVPDTILMAAEGRQFIGHANLNGSVQPGSGAQPNAWNAASQGASQVTSAPTSTSPQGDTQRGTPG 223          
BLAST of Transcription activator BRG1 vs. TrEMBL
Match: A0A1S8X2Z7 (Protein, SNF2 family OS=Opisthorchis viverrini OX=6198 GN=X801_03100 PE=4 SV=1)

HSP 1 Score: 1362.44 bits (3525), Expect = 0.000e+0
Identity = 757/1245 (60.80%), Postives = 940/1245 (75.50%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQI-------IXXXXXXXXXXXXXXIEYLSKTL--SKRCG--------------LSKDEVCKIVKNLFAG-DFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA--VDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTEDDEYNK------DQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILT--XXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSKKRIRKEVDYTDSFTEAQFLRHIIDDA-----------------DEDVIDKSVENXXXXXXXS--MEVPCPPSELDSLNLKKKRGRPFNNS-----VSSKDNLMSAKYLSIINKLLN----YRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            + LDPVELL +RE RIQ+RI QRI EL+S S    P  R+  LIEL++L+LL+ Q+++R DI+++M++D  LE+ALNVKAYR+PK+QTL+E+RFTEKLEK++KY+QEKR+RQKHQEFLNA + H K+F+EFHRNVN +++K+NKAVLNY  N+ER KRKEQERI+RERMRRLMAEDEEGYR LID KKD RLH+LL+QTDEFI+ LTKLV+EHKR+Q          +++       +  I Y  +    S R G              +  +E+ ++ ++   G   N +VQ   PE+HI ++  +T++ L    APL   +  WL+++ GWE+    VD +  +      E  + +   EE + +D+   +H+GTEDDEYNK      +  Q+YYTLAH+V+EE++EQ+S+LV+G+LKEYQ++GLEWLVSLYNNNLNGILADEMGLGKTIQTI LIT+LMEKKRVNGPFLIIVPLS MSNWA+EF++WAPSV K+LYKGSP  R+ +Q QLK    NVLLTTYEYIIKDK +LSK+KWKYMIIDEGHRMKNHHCKLTQ+LNTYY APYRLLLTGTPLQNKLPELWALLNFLLP IF+SVNTFEQWFNAPFA +GEKVELNQEETLLIIRRLHKVLRPFLLRRLK+EVESQLP+KVEYVIKC+MSALQR LY+HMQSKGVILT     +K   GKGG RTLMNTIMQLRKICNHPFMF HIE AIAE +F+  H G  PPG+P+PT++ G+ LYR SGKFELLDRILPKLKA  HR+LIFCQMT+LMT+M  YF+YR F++LRLDGTT+++DRG+LL  FND   D FIF+LSTRAGGLGLNLQAADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRLI+ NSVEEKILAAARFKL+VD+KVIQAGMFDQKSTGTER QFLQALL QDE  D  EDE PDDETINQM+AR+E+EFE+YQR D+ER  +++ + K + RLM + ELP+WI++++A +ER+L   +    L  KR RKEVDY+D+ TE QFL+ I + +                  + + D S  +    +  S  M  P  P        K++RGRP ++S      S   + +S K +  + +LL+    Y+DKD RILSEPF+KLP++K+LPDYYE+IK+PMDF RIKQ++++ KY+++ EL  D+ LLC NAQ YNMDGSL                 IFEDS++L+SVW   +++ 
Sbjct:  280 QGLDPVELLKEREQRIQSRIAQRIKELSSLSAFSTPEQRVSLLIELRSLRLLNFQRQLRQDIVSSMRRDTSLETALNVKAYRRPKKQTLREARFTEKLEKQMKYEQEKRRRQKHQEFLNAVLSHGKDFREFHRNVNSRMMKINKAVLNYKANAERDKRKEQERIDRERMRRLMAEDEEGYRCLIDAKKDQRLHHLLTQTDEFISNLTKLVREHKREQSKQRVREKADRRRMAQETALQNAINYYRRLAEESLRSGNPPPAYLATLPPVDMFPEELQQVNRDWICGKQPNASVQL--PEVHISVYQTTTKELLEGSSAPLASEVYTWLQDHPGWEVTPTDVDGSTIQDLLETEEDLKRKRRSEEDDDDDDSTMVHVGTEDDEYNKRGESGANVPQSYYTLAHAVREEVKEQASILVHGRLKEYQLRGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITHLMEKKRVNGPFLIIVPLSVMSNWAMEFDRWAPSVKKILYKGSPQARRLLQVQLKASKINVLLTTYEYIIKDKAALSKIKWKYMIIDEGHRMKNHHCKLTQVLNTYYTAPYRLLLTGTPLQNKLPELWALLNFLLPTIFESVNTFEQWFNAPFAATGEKVELNQEETLLIIRRLHKVLRPFLLRRLKREVESQLPEKVEYVIKCDMSALQRVLYSHMQSKGVILTDGSEKDKKASGKGGCRTLMNTIMQLRKICNHPFMFTHIELAIAEQSFISNHGGNPPPGMPLPTQVEGKMLYRSSGKFELLDRILPKLKACGHRVLIFCQMTSLMTIMQDYFDYRNFRYLRLDGTTRAEDRGELLVKFNDTTEDIFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLISINSVEEKILAAARFKLDVDQKVIQAGMFDQKSTGTERRQFLQALLEQDEEADEEEDEAPDDETINQMLARTEEEFEIYQRMDVERQFAESQQTKREPRLMEYAELPNWIIRDEAELERSLLMEDGVFGL--KRQRKEVDYSDALTERQFLKAIDEGSLEEAEERQRQRRAARKKRKRIDDSSFLDDASSEAGSTIMAAPSTP--------KRRRGRPPHSSGPRTGTSRNSSAVSPKLIKKLRRLLDIIIEYKDKDQRILSEPFMKLPTRKELPDYYEVIKKPMDFHRIKQRVRDGKYRSVDELEADVMLLCKNAQTYNMDGSL-----------------IFEDSVVLQSVWTNARERL 1495          

HSP 2 Score: 65.0846 bits (157), Expect = 1.638e-6
Identity = 28/43 (65.12%), Postives = 38/43 (88.37%), Query Frame = 2
Query:  386 FLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDN 514
            FLK+QL+QLRAQI++YKLLSKSQP+P +++ AAEG+Q I + N
Sbjct:  136 FLKDQLVQLRAQISAYKLLSKSQPVPDTILMAAEGRQFIGHTN 178          
BLAST of Transcription activator BRG1 vs. Ensembl Cavefish
Match: smarca2 (probable global transcription activator SNF2L2 [Source:NCBI gene;Acc:103043671])

HSP 1 Score: 1217.99 bits (3150), Expect = 0.000e+0
Identity = 705/1302 (54.15%), Postives = 910/1302 (69.89%), Query Frame = 2
Query:  383 SFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINN-----DNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHI-------------------------------------KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKG--WEIYAVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEH-NFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVW 4150
            +F   QL QLRAQI +YK+L + QP+P++L  A +GK+ +        N S Y+    +   G    S   K+  P+  G P                                        + LDPVELL +RE R+Q RI  RI EL +   S  P  R K  +ELKAL+LL+ Q+++R D++  M++D  LE+ALN KAY++ KRQTL+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+++ KI KL+KAV  + TN+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT LV EHK  Q  K+KK+   +K+K++ +     +    G   DE  ++                  E+ + +    T + L    AP    LE WL+ N G    +   + ++          +  + VD+E ++              +  +  +Q+YY +AH+V E++ +QS+LL+NG LK YQI+GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGP+LIIVPLST+SNW  E +KWAPS++K+ YKG+P+ R+S+  QL++G FNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSA+Q+ LY HMQ KG++LTDGSEKDKKGKGG +TLMNTIMQL+KICNHP+MFQHIE++ AEH  F        P G+     I G DLYR SGKFELLDRILPKL   NHR+L+FCQMTTLMT+M  YF YR F +LRLDGTTKS+DR  LL  FN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  EDE PDDET+NQMIAR+EDEFEL+ R D++R   D    K K RLM  DELPSWI+K+DA +ER     E      +  R R++VDY+D+ TE Q+LR I D   E++ +   E + KK+K+   V   P   +    KKKRGRP    +S     ++ +  +II  ++NYRD  GR LSE F++LPS+K+LP+YYE+I++P+DFK+IK++++ +KY+++ +L  D+ LLC NAQ YN++GS                 QI+EDSI+L+SV+
Sbjct:  175 AFSPVQLQQLRAQILAYKILGRGQPLPENLQLAVQGKRSLPTMQQQPVNSSPYNRPPGQ---GAEAPSGPQKLPVPAPSGRPSPAPPQASTLLQQPQQGPGQPSLIIQLQQKQNRVTPVQKPQGLDPVELLQEREYRLQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAVATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTTLVYEHKAAQAAKEKKKRKKKKKKEEGDAEGLGVIGPDGEPIDESSQMS-----------------ELPVKVIQTETGKVLQGTDAPKSSQLEAWLEMNPGNYSTVSYSNHSDVMVCCFAIARSAKQDVDDEYSV--------------QAGETSSQSYYGVAHAVIEKVEKQSTLLINGTLKHYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKQILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEHLGF--------PNGI-----ISGSDLYRASGKFELLDRILPKLHTTNHRVLLFCQMTTLMTIMEDYFAYRNFLYLRLDGTTKSEDRAALLKTFNEEGSPYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEE-QNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRRDVDYSDAMTEKQWLRAIEDGNLEEMEE---EIRLKKRKRRRHVDKGPRREEGEKAKKKRGRPPAEKLSPNPPRLTKQMAAIIETVINYRDGSGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSLGDLEKDVMLLCHNAQTYNLEGS-----------------QIYEDSIVLQSVF 1408          
BLAST of Transcription activator BRG1 vs. Ensembl Cavefish
Match: smarca2 (probable global transcription activator SNF2L2 [Source:NCBI gene;Acc:103043671])

HSP 1 Score: 1208.36 bits (3125), Expect = 0.000e+0
Identity = 688/1197 (57.48%), Postives = 879/1197 (73.43%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTE-----DDEYN----KDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEH-NFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVW 4150
            + LDPVELL +RE R+Q RI  RI EL +   S  P  R K  +ELKAL+LL+ Q+++R D++  M++D  LE+ALN KAY++ KRQTL+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+++ KI KL+KAV  + TN+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT LV EHK  Q  K+KK+   +K+K++ +     +    G   DE  ++                  E+ + +    T + L    AP    LE WL+ N G+E+             +E ++E   +  E  E +I+D   +   E    HI        DDEY+    +  +Q+YY +AH+V E++ +QS+LL+NG LK YQI+GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGP+LIIVPLST+SNW  E +KWAPS++K+ YKG+P+ R+S+  QL++G FNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSA+Q+ LY HMQ KG++LTDGSEKDKKGKGG +TLMNTIMQL+KICNHP+MFQHIE++ AEH  F        P G+     I G DLYR SGKFELLDRILPKL   NHR+L+FCQMTTLMT+M  YF YR F +LRLDGTTKS+DR  LL  FN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  EDE PDDET+NQMIAR+EDEFEL+ R D++R   D    K K RLM  DELPSWI+K+DA +ER     E      +  R R++VDY+D+ TE Q+LR I D   E++ +   E + KK+K+   V   P   +    KKKRGRP    +S     ++ +  +II  ++NYRD  GR LSE F++LPS+K+LP+YYE+I++P+DFK+IK++++ +KY+++ +L  D+ LLC NAQ YN++GS                 QI+EDSI+L+SV+
Sbjct:  348 QGLDPVELLQEREYRLQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAVATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTTLVYEHKAAQAAKEKKKRKKKKKKEEGDAEGLGVIGPDGEPIDESSQMS-----------------ELPVKVIQTETGKVLQGTDAPKSSQLEAWLEMNPGYEVAPRSDSEESGSEFEEEDEEEVVSRAESEEKKIIDPNSDEVSETAAKHIIESAKQDVDDEYSVQAGETSSQSYYGVAHAVIEKVEKQSTLLINGTLKHYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKQILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEHLGF--------PNGI-----ISGSDLYRASGKFELLDRILPKLHTTNHRVLLFCQMTTLMTIMEDYFAYRNFLYLRLDGTTKSEDRAALLKTFNEEGSPYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEE-QNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRRDVDYSDAMTEKQWLRAIEDGNLEEMEE---EIRLKKRKRRRHVDKGPRREEGEKAKKKRGRPPAEKLSPNPPRLTKQMAAIIETVINYRDGSGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSLGDLEKDVMLLCHNAQTYNLEGS-----------------QIYEDSIVLQSVF 1493          
BLAST of Transcription activator BRG1 vs. Ensembl Cavefish
Match: smarca2 (probable global transcription activator SNF2L2 [Source:NCBI gene;Acc:103043671])

HSP 1 Score: 1207.2 bits (3122), Expect = 0.000e+0
Identity = 688/1197 (57.48%), Postives = 879/1197 (73.43%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA----------VDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTE-----DDEYN----KDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEH-NFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVW 4150
            + LDPVELL +RE R+Q RI  RI EL +   S  P  R K  +ELKAL+LL+ Q+++R D++  M++D  LE+ALN KAY++ KRQTL+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR+++ KI KL+KAV  + TN+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT LV EHK  Q  K+KK+   +K+K++ +     +    G   DE  ++                  E+ + +    T + L    AP    LE WL+ N G+E+             +E ++E   +  E  E +I+D   +   E    HI        DDEY+    +  +Q+YY +AH+V E++ +QS+LL+NG LK YQI+GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGP+LIIVPLST+SNW  E +KWAPS++K+ YKG+P+ R+S+  QL++G FNVL+TTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSA+Q+ LY HMQ KG++LTDGSEKDKKGKGG +TLMNTIMQL+KICNHP+MFQHIE++ AEH  F        P G+     I G DLYR SGKFELLDRILPKL   NHR+L+FCQMTTLMT+M  YF YR F +LRLDGTTKS+DR  LL  FN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  EDE PDDET+NQMIAR+EDEFEL+ R D++R   D    K K RLM  DELPSWI+K+DA +ER     E      +  R R++VDY+D+ TE Q+LR I D   E++ +   E + KK+K+   V   P   +    KKKRGRP    +S     ++ +  +II  ++NYRD  GR LSE F++LPS+K+LP+YYE+I++P+DFK+IK++++ +KY+++ +L  D+ LLC NAQ YN++GS                 QI+EDSI+L+SV+
Sbjct:  348 QGLDPVELLQEREYRLQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQDVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSISGKIQKLSKAVATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTTLVYEHKAAQAAKEKKKRKKKKKKEEGDAEGLGVIGPDGEPIDESSQMS-----------------ELPVKVIQTETGKVLQGTDAPKSSQLEAWLEMNPGYEVAPRSDSEESGSEFEEEDEEEVVSRAESEEKKIIDPNSDEVSETAAKHIIESAKQDVDDEYSVQAGETSSQSYYGVAHAVIEKVEKQSTLLINGTLKHYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMRRSLVPQLRSGKFNVLITTYEYIIKDKQILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEHLGF--------PNGI-----ISGSDLYRASGKFELLDRILPKLHTTNHRVLLFCQMTTLMTIMEDYFAYRNFLYLRLDGTTKSEDRAALLKTFNEEGSPYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEE-QNMEEDEVPDDETLNQMIARNEDEFELFMRMDLDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRRDVDYSDAMTEKQWLRAIEDGNLEEMEE---EIRLKKRKRRRHVDKGPRREEGEKAKKKRGRPPAEKLSPNPPRLTKQMAAIIETVINYRDGSGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRSHKYRSLGDLEKDVMLLCHNAQTYNLEGS-----------------QIYEDSIVLQSVF 1493          
BLAST of Transcription activator BRG1 vs. Ensembl Cavefish
Match: smarca4a (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4a [Source:ZFIN;Acc:ZDB-GENE-030605-1])

HSP 1 Score: 1172.53 bits (3032), Expect = 0.000e+0
Identity = 712/1422 (50.07%), Postives = 941/1422 (66.17%), Query Frame = 2
Query:  191 AYSSKSNENSNYGNFPS-LNSNSKSYPGYFNLPPITNHNIPSLNQTYHNYDQQKSALKPGENNDK-----------SFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANEN---------TNGKSKRSNISKILTPSNHG----------------------IPGHI---------------------KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHIGTE-----DDEYNKDQ----TQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHI----IDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNL----------KKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
              S +   +S  G  PS ++++S+ YP            +P+                P E ND             F +NQL QLRAQI +YK+L++ Q +P  L  A +GK+ +    + + +                N  +  S   K++ P   G                       PG                       + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR++  K+ K+ KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV+ HK  Q +K+KK+   +K+  +            G + DE  ++       D  + V      IH+D     + + L  + AP  G LE WL+ N G+ ++    +       E ++ +    +E+  I D       E++  HI        DDEY         Q+YY++AH+V E + +QS+L+VNG LK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNW LEF+KWAPSV+KV YKGSP  R++    L++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+YLAP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+K+++ I C        LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMTTLMT+M  YF YR FK+LRLDGTTK++DRG LL  FND    YF+F+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIARSE+EF+ + R D++R   +    K + RLM  DELP+WI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I    +D+ +E+V  K    + +K+ + +++P P +   S             +KKRGRP    +S   + ++ K   I++ ++ Y+D +GR LSE FI+LPS+K+LP+YYE+I++P+DF++IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:   95 GMSMRQGAHSGMGPPPSPMDTHSQGYPSPLGGSEHAPSPVPANGPPSGPMMPSGPGGVPMEGNDPQAMGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQALPDHLQMAVQGKRPMPGMQQGMPNMPPASGPGAGPPGPMVNAAAPASAPQKLIPPQPTGRPSPAPPSVPPAASPVMPPQTQSPGQPAQPPTMMLHPKQNRITPIQKPRGLDPVEILQEREYRLQARITHRIQELENIPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSITGKVQKVTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRAHKAVQALKEKKKKKKKKKTGENGEGGALALGPDGEALDETSQM------SDLPVKV------IHVD-----SGKILTGLDAPKAGQLETWLEMNPGY-VWTSVHSVCTEEEEEQQLAQAVATEEKKKIPDPDSEDVSEVDARHIIDHAKQDVDDEYGSAAFEVGLQSYYSVAHAVTETVDKQSTLMVNGTLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEYKRINGPFLIIVPLSTLSNWVLEFDKWAPSVVKVSYKGSPAARRAFLPILRSGKFNVLLTTYEYIIKDKQVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKIQFSI-C-------LLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEH---LGFTG----GI-----VQGPDLYRASGKFELLDRILPKLRATNHKVLLFCQMTTLMTIMEDYFAYRNFKYLRLDGTTKAEDRGMLLKNFNDPASSYFVFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARSEEEFDHFMRMDLDRRREEARNPKRRPRLMEEDELPTWIMKDDAEVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAIEEGTLDEIEEEVRHKKT-TRKRKRDRDLDLPGPSTPSSSGGRSRDKDEDGKKQKKRGRPPAEKLSPNPSSLTKKMKKIVDAVIKYKDGNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRSHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1459          
BLAST of Transcription activator BRG1 vs. Ensembl Cavefish
Match: ENSAMXT00000045183.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:20055319:20094907:-1 gene:ENSAMXG00000011238.2 transcript:ENSAMXT00000045183.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1159.44 bits (2998), Expect = 0.000e+0
Identity = 673/1182 (56.94%), Postives = 870/1182 (73.60%), Query Frame = 2
Query:  626 SLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXX-----XXXXXIVDEEMNIND-------EIEPIHIGTE-----DDEYNKDQ----TQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDK-SVENXXXXXXXSMEVPCPPSELDSLNLK---------KKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRD-KDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSL 4072
             LDPVE+L +RE R++ RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M+++  LE+AL+ KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR++  KI KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV+ HK  Q +K+KK+   +K+K +            G   DE  ++       D  + V      IH+D     + + L  + AP  G LE WL+ N G+E+    ++       E E           V+E+  I D       E++  HI        DDEY         Q+YY +AH+V E + +QSSLL+NGQLK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGP+LIIVPLST+SNW  EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+YLAP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQ IE++ +EH   L   G    G+     + G DLYR SGKFE+LDRILPKL+A NH++L+FCQMTTLMT+M  YF YR FK+LRLDGTTK++DRG LL  FND +  YFIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIARSE+EF+ + R D++R   +    K K RLM  DELP+WI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I +   E++ ++   +   +K+K+  ++   PS   + + +         KKRGRP    ++     ++ K   I++ ++ Y++  +GR LSE FI+LPS+K+LP+YYE+I++P+DF++IK++I+ ++Y+++ +L  D+ LLC NAQ +N++GSLV +
Sbjct:  368 GLDPVEILQEREYRLEARITHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRETALETALDAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSITGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRAHKAAQALKEKKKKKKKKKKLENAEGQPVALGPDGEPLDETSQM------SDLPVKV------IHVD-----SGKILTGVDAPKAGQLETWLEMNPGYEVAPRSDSEDTGSEEEEEEEEELQPSQAPVEEKKKIPDPDSEDVSEVDARHIIEHAKQDVDDEYGGAAFARGLQSYYAVAHAVTERVDKQSSLLINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEYKRLNGPYLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKQVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQQIEESFSEH---LGFSG----GI-----VQGADLYRASGKFEVLDRILPKLRATNHKVLLFCQMTTLMTIMEDYFAYRNFKYLRLDGTTKAEDRGMLLKTFNDPESQYFIFLLSTRAGGLGLNLQSADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARSEEEFDHFMRMDLDRRREEARNPKRKPRLMEEDELPTWIMKDDAEVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRHKKTTRKRKRDRDLDAGPSTSGTRSGRDKDEESKRQKKRGRPPAEKLTPNPPALTKKMKKIVDAMIKYKESSNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRSHRYRSLNDLERDVMLLCQNAQTFNLEGSLVRI 1519          
BLAST of Transcription activator BRG1 vs. Ensembl Sea Lamprey
Match: SMARCA2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:HGNC Symbol;Acc:HGNC:11098])

HSP 1 Score: 1036.17 bits (2678), Expect = 0.000e+0
Identity = 530/872 (60.78%), Postives = 653/872 (74.89%), Query Frame = 2
Query: 1679 DDEYNKDQ---TQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIY-GQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDY-------------------------------SEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXS-MEVPCPPSELDSL------NLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRD-----KDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVW 4150
            DDEY + +   +Q+YYT+AH+V E +  QSSLLVNG LK YQ++GLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNW +EF+KW PSV+K+ YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+KL+WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSALQ+ LY HMQ+KGV+LTDGSEKDKKGKGG +TLMNTI+QLRKI NHP+MFQHIE++ AEH             +  P  I  G DL+R SGKFELLDRILPKL+ +NHR+L+FCQMT+LMT+M  YF +R F++LRLDGTTKS+DR +LL  FN+    YFIF+LSTRAGGLGLNLQAADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+G ER  FLQA+L  +E  +                                 EDE PDDET+NQMIARSE+EFE++ R D++R   D    + + RLM  DELP+WI+K+DA +ER    +E      +  R RKEVDY+DS TE Q+L+  I++ + D++++ V  K  +K+K   + P P  E            KKKRGRP           ++ K   II+ ++ YRD       GR LS+ FI+LPS+K+LP+YYE+I++P+DF +IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDS +L+ V+
Sbjct:  699 DDEYRRQEVSGSQSYYTMAHAVSERVECQSSLLVNGSLKMYQVQGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPFLIIVPLSTLSNWMMEFDKWGPSVVKISYKGSPIARRAFMPQLRSGKFNVLLTTYEYIIKDKHVLAKLRWKYMIVDEGHRMKNHHCKLTQVLNTHYIAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFALTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKVLYRHMQAKGVLLTDGSEKDKKGKGGAKTLMNTIVQLRKIANHPYMFQHIEESFAEH-------------LGFPNSIVQGADLFRASGKFELLDRILPKLRVSNHRVLLFCQMTSLMTIMEDYFAFRSFRYLRLDGTTKSEDRSNLLKTFNEPNSPYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSGHERRAFLQAVLEHEEQNEVRVWSTNGFVHHHHEQHQPGSVQRYVFSPPQREEDEVPDDETVNQMIARSEEEFEMFMRMDLDRRREDARNPRRRPRLMEEDELPNWIIKDDAEVERLTCEDEEEKLFGRGSRQRKEVDYSDSLTEKQWLK-AIEEGNLDLLEEEVRMKKARKRKRDPDTPGPSRERVGAAPEPEEKAKKKRGRPPVEKPVPNPPALTRKMKRIIDTVIKYRDSVPVRSCGRQLSDVFIQLPSRKELPEYYELIRRPVDFNKIKERIRIHKYRSMDDLEKDVMLLCHNAQTFNLEGSL-----------------IYEDSKVLQGVF 1539          

HSP 2 Score: 155.992 bits (393), Expect = 2.310e-38
Identity = 95/160 (59.38%), Postives = 128/160 (80.00%), Query Frame = 2
Query:  794 IRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQ 1273
            +R +++  M++D  LE+ALN KAY++ KRQTL+E+R TEKLEK+ K +QE++++QKHQE+LN+ + H+K+FKEFHR +  K+ K+ +AV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYR LID+KKD RL YLL QTDE+I  LT LV+EHK  Q
Sbjct:  394 LRQEVVACMRRDTTLETALNAKAYKRSKRQTLREARITEKLEKQQKIEQERKRKQKHQEYLNSILQHAKDFKEFHRTMTAKVQKVTRAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRNLIDQKKDKRLAYLLMQTDEYIGNLTDLVREHKIQQ 553          
BLAST of Transcription activator BRG1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001164.1 (pep scaffold:Pmarinus_7.0:GL482256:352:18794:-1 gene:ENSPMAG00000001030.1 transcript:ENSPMAT00000001164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 783.482 bits (2022), Expect = 0.000e+0
Identity = 440/739 (59.54%), Postives = 546/739 (73.88%), Query Frame = 2
Query:  968 EFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEI------------YAVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIE-PIHIGTE---------DDEYNKDQ------TQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPH 3100
            E+L + + H+K+FKE+HR++  K+ KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE+I  LT LV EHK  Q  K +++   +K+K   +     +    G   DE  ++                  E+ + + +  + + L    AP    L+ WL+ N G+E+               D+  ++   +E         +E   I +  E P H+  +         DDEY   +      + +YY +AH++ E +  QSSL++NG LK YQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTIGLITYLME KR+NGP+LIIVPLST+SNW +EF+KWAPSV+K+ YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LN++Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQ+ LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNH +MFQHIE++ +EH   L   G    G+     I G +LYR SGKFE+LDRILPKL+A NHR+L+FCQMT LMT+M  YF +R F++LRLDGTTK+D+RGDLL MFN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH
Sbjct:    1 EYLTSILQHAKDFKEYHRSMAAKVQKLTKAVSTYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYIGNLTDLVCEHKATQAAKDREKKKKKKKKAAEKADGGAVGPD-GEPLDESSQM-----------------SELPVRVIHVESGRILSGEDAPRANQLDAWLEMNPGYEVALRSDSEESGSEDEEDDEEEDDKEDEVPHQPPSSTEERKKITNPDEVPEHVAKDIILSAKQDVDDEYKIKEGMDLIGSSSYYAMAHAITESVDRQSSLMINGSLKMYQVQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMENKRLNGPYLIIVPLSTLSNWVIEFDKWAPSVVKISYKGSPAARRAFMVQLRSGKFNVLLTTYEYIIKDKHVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNSHYIAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQKVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHVYMFQHIEESFSEH---LGFSG----GI-----IQGAELYRASGKFEVLDRILPKLRATNHRVLLFCQMTALMTIMEDYFAFRSFRYLRLDGTTKADERGDLLKMFNEPDSPYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPH 709          
BLAST of Transcription activator BRG1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001160.1 (pep scaffold:Pmarinus_7.0:GL482256:352:18794:-1 gene:ENSPMAG00000001030.1 transcript:ENSPMAT00000001160.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 403/676 (59.62%), Postives = 496/676 (73.37%), Query Frame = 2
Query: 1157 GYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEI------------YAVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIE-PIHIGTE---------DDEYNKDQ------TQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPH 3100
            GYRKLID+KKD RL YLL QTDE+I  LT LV EHK  Q  K +++   +K+K   +     +    G   DE  ++                  E+ + + +  + + L    AP    L+ WL+ N G+E+               D+  ++   +E         +E   I +  E P H+  +         DDEY   +      + +YY +AH++ E +  QSSL++NG LK YQ++GLEW+VSLYNNNLNGILADEMGLGKTIQTIGLITYLME KR+NGP+LIIVPLST+SNW +EF+KWAPSV+K+ YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LN++Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQ+ LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNH +MFQHIE++ +EH   L   G    G+     I G +LYR SGKFE+LDRILPKL+A NHR+L+FCQMT LMT+M  YF +R F++LRLDGTTK+D+RGDLL MFN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH
Sbjct:  123 GYRKLIDQKKDKRLAYLLQQTDEYIGNLTDLVCEHKATQAAKDREKKKKKKKKAAEKADGGAVGPD-GEPLDESSQM-----------------SELPVRVIHVESGRILSGEDAPRANQLDAWLEMNPGYEVALRSDSEESGSEDEEDDEEEDDKEDEVPHQPPSSTEERKKITNPDEVPEHVAKDIILSAKQDVDDEYKIKEGMDLIGSSSYYAMAHAITESVDRQSSLMINGSLKMYQVQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMENKRLNGPYLIIVPLSTLSNWVIEFDKWAPSVVKISYKGSPAARRAFMVQLRSGKFNVLLTTYEYIIKDKHVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNSHYIAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQKVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHVYMFQHIEESFSEH---LGFSG----GI-----IQGAELYRASGKFEVLDRILPKLRATNHRVLLFCQMTALMTIMEDYFAFRSFRYLRLDGTTKADERGDLLKMFNEPDSPYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPH 768          
BLAST of Transcription activator BRG1 vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 434.106 bits (1115), Expect = 3.292e-136
Identity = 235/550 (42.73%), Postives = 329/550 (59.82%), Query Frame = 2
Query: 1751 EQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSI-QSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAG---MFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARS 3388
            E  S +  G +++YQ++GL WL+SLY N +NGILADEMGLGKT+QTI L+ Y+   + + GP +++VP ST+ NW  EFE+W PS+  V   G    R S  Q  +    ++V +T+YE II++K    K  W+Y++IDE HR+KN   KL++I+  +     RLLLTGTPLQN L ELW+LLNFLLPD+F S +TF  WF+       ++          ++ RLH VLRPFLLRR+K +VE  LP K E  I   +S +QR  Y  +  K + + + + K  K +     L+N +MQLRK CNHP++F   E                 PG P  T+ +   +   SGK  +LD++LPKL     R+LIF QMT +M ++  Y  +RG+++ RLDG T  +DR   ++ FN      F+FMLSTRAGGLG+NL  AD VI++DSDWNP +DLQA DRAHRIGQK  VRV R IT ++VE++I+  A  KL +D  VIQ G   + DQ +    + + LQ +         S++    DE I+ ++ R 
Sbjct:  102 ESPSYVKCGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMAEFERWVPSLRAVCLIGDKDHRVSASQPIVPPIEWDVCVTSYEMIIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTT-NRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADTFTSWFDTNNCFGDQQ----------LVERLHMVLRPFLLRRIKADVEKSLPPKKECKIYIGLSKMQREWYTKILMKDIDILNSAGKMDKMR-----LLNILMQLRKCCNHPYLFDGAE-----------------PGPPYTTDTH---IVINSGKMVVLDKLLPKLHEQGSRVLIFSQMTRMMDILEDYCMWRGYEYCRLDGQTPHEDRQVSIASFNAPDSSKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKVVRVFRFITESTVEDRIVERAEMKLRLDSIVIQQGPGRLVDQVANKLGKDEMLQMIRYGATQVFSSKESQITDEDIDVILERG 615          
BLAST of Transcription activator BRG1 vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 431.795 bits (1109), Expect = 2.432e-131
Identity = 231/561 (41.18%), Postives = 334/561 (59.54%), Query Frame = 2
Query: 1724 AHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQL-KNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQ---AG-MFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSE 3391
            A ++     E  + +  G +++YQ++GL WL+SLY N +NGILADEMGLGKT+QTI L+ Y+   + + GP +++VP ST+ NW  EFE+W PS+  V   G+   R +    +     ++V +T+YE +I++K    K  W+Y++IDE HR+KN   KL+ I+  +  +  RLLLTGTPLQN L ELW+LLNFLLPD+F S   F+ WF+    +  ++          ++ RLH VLRPFLLRR+K +VE  L  K E  I   +S +QR  Y  +  K + + + + K  K +     L+N +MQLRK CNHP++F   E                 PG P  T+ +   L   SGK  +LD++LPKL+    R+L+F QMT ++ ++  Y  ++G+ + RLDG T  +DR + ++ +N      FIFMLSTRAGGLG+NL  AD VI++DSDWNP +DLQA DRAHRIGQ   VRV R +T N+VEE+I+  A  KL +D  VIQ   AG + DQ++    + + LQ + +       S D    DE I+ ++ R E
Sbjct:  118 ATNICTRFEESPTYVKGGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHHRNIQGPHMVLVPKSTLHNWMNEFERWVPSLRAVCLIGNKDQRVATDENVYTKREWDVCVTSYEIVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSDIVREFK-STNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSSEDFDSWFDTNNCLGDQE----------LVERLHMVLRPFLLRRIKADVEKSLQPKKEVKIYIGLSKMQREWYTKILMKDIDILNSAGKMDKLR-----LLNILMQLRKCCNHPYLFDGAE-----------------PGPPYTTDTH---LVNNSGKMVVLDKLLPKLQEQGSRVLLFSQMTRMLDILEDYCMWKGYGYCRLDGQTPHEDRQEAIAAYNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKRVRVFRFLTENTVEERIVERAEMKLRLDSIVIQQVCAGRLIDQQANKLGKDEMLQMIRHGATHVFASRDSEITDEEIDVVLERGE 642          
BLAST of Transcription activator BRG1 vs. Ensembl Yeast
Match: SNF2 (Catalytic subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; contains DNA-stimulated ATPase activity; functions interdependently in transcriptional activation with Snf5p and Snf6p [Source:SGD;Acc:S000005816])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 367/703 (52.20%), Postives = 480/703 (68.28%), Query Frame = 2
Query: 1715 YTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISG--EKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECP------DDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKN-DAIIERNLFSNELTDSLSKKRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKD 3796
            Y +AH ++E+I++Q S+LV G LK+YQIKGL+W+VSL+NN+LNGILADEMGLGKTIQTI L+TYL E K + GP+L+IVPLST+SNW+ EF KWAP++  + +KGSP  RK+ Q++++ G F+V+LTT+EYIIK++  LSK+KW +MIIDEGHRMKN   KL+  LNT+Y A YRL+LTGTPLQN LPELWALLNF+LP IF SV +F++WFN PFA +G  +K+EL++EETLL+IRRLHKVLRPFLLRRLKK+VE +LPDKVE V+KC+MSALQ+ +Y  M     +        K      R   N IMQL+KICNHPF+F+ +E  I                   PT     D++RV+GKFELLDRILPKLKA  HR+LIF QMT +M +M  +  Y   K+LRLDG TKSD+R +LL +FN    +Y  F+LSTRAGGLGLNLQ ADTVIIFD+DWNPH DLQAQDRAHRIGQKNEVR+LRLIT NSVEE IL  A  KL++D KVIQAG FD KST  E+   L++LL+ +E      +          D  IN+++AR+++E  +  R D +R   +   G +KSRL+   ELP    ++  A ++R    +    +    R RK   Y D+ +E Q+LR   + +D++  DK    +  KK+   E      E+   N+      P  N++S++D
Sbjct:  745 YNVAHRIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGL--RGFNNQIMQLKKICNHPFVFEEVEDQIN------------------PTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRSKKEEELG-VKSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYNDNMSEEQWLRQ-FEVSDDEKNDKQARKQRTKKEDKSEAIDGNGEIKGENIDADNDGPRINNISAED 1425          

HSP 2 Score: 67.0106 bits (162), Expect = 2.340e-11
Identity = 39/106 (36.79%), Postives = 61/106 (57.55%), Query Frame = 2
Query: 3803 MSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLV---SLTDSNYNSLSFCDI 4111
            ++ + L + +  LNY ++ GR LS+ F+  PSK   PDYY IIK P+ F  I   I+   Y ++ E   D +L+ SNA++YN +GS+V   SL      +  +C+I
Sbjct: 1550 VAKQALDLYHFALNYENEAGRKLSDIFLSKPSKALYPDYYMIIKYPVAFDNINTHIETLAYNSLKETLQDFHLIFSNARIYNTEGSVVYEDSLELEKVVTKKYCEI 1655          
BLAST of Transcription activator BRG1 vs. Ensembl Yeast
Match: STH1 (ATPase component of the RSC chromatin remodeling complex; required for expression of early meiotic genes; promotes base excision repair in chromatin; essential helicase-related protein homologous to Snf2p [Source:SGD;Acc:S000001388])

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 382/684 (55.85%), Postives = 476/684 (69.59%), Query Frame = 2
Query: 1646 DEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISG--EKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKS------RLMSHDELPSWIVKNDAIIERNLFSNELTDSLSKKRIRKEVDYTDSFTEAQFLRHIIDD--ADEDVIDK 3667
            +E++PI     D+E  K     YY +AH ++E+I +Q S+LV G LKEYQ++GLEW+VSLYNN+LNGILADEMGLGKTIQ+I LITYL E K+  GPFL+IVPLST++NW LEFEKWAPS+  ++YKG+P  R S+Q Q++ GNF+VLLTTYEYIIKDK  LSK  W +MIIDEGHRMKN   KL+  ++ YY    RL+LTGTPLQN LPELWALLNF+LP IF S  TFE WFN PFA +G  EK+EL +EETLLIIRRLHKVLRPFLLRRLKKEVE  LPDKVE VIKC++S LQ+ LY  M     +   G+  +   KGG + L N IMQLRKICNHPF+F  +E                  GV  P+      L+RV+GKFELLDR+LPK KA+ HR+L+F QMT +M +M  +   +  K++RLDG+TK+++R ++L+ FN    DYF F+LSTRAGGLGLNLQ ADTVIIFD+DWNPH DLQAQDRAHRIGQKNEVR+LRLIT +SVEE IL  A  KL++D KVIQAG FD KST  E+  FL+ L+  +   D  +    DD+ +N  +ARS DE  L+ + D ERM  + +  K +       RL+  DELP  + + D  IE + F  E ++ L + R +K V Y D  TE QFL  + DD  + ED I K
Sbjct:  432 EEVQPIT----DEEREKTD---YYEVAHRIKEKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFV-GAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVE------------------GVVNPSRGNSDLLFRVAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLIESETNRDDDDKAELDDDELNDTLARSADEKILFDKIDKERMNQERADAKAQGLRVPPPRLIQLDELPK-VFRED--IEEH-FKKEDSEPLGRIRQKKRVYYDDGLTEEQFLEAVEDDNMSLEDAIKK 1085          

HSP 2 Score: 56.9954 bits (136), Expect = 2.185e-8
Identity = 27/73 (36.99%), Postives = 42/73 (57.53%), Query Frame = 2
Query: 3881 FIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLS 4099
            F KLPSK+D PDY+++I++PM    I +  K   YKT+ E+   +  +  NA+ YN +GS V +     N  +
Sbjct: 1278 FEKLPSKRDYPDYFKVIEKPMAIDIILKNCKNGTYKTLEEVRQALQTMFENARFYNEEGSWVYVDADKLNEFT 1350          
BLAST of Transcription activator BRG1 vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 437.187 bits (1123), Expect = 3.444e-132
Identity = 228/504 (45.24%), Postives = 324/504 (64.29%), Query Frame = 2
Query: 1745 IREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSI-QSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAG 3253
            + E  S + +G+L++YQ++GL WL+SL+ N L+GILADEMGLGKT+QTI  + YL   K++ GPFLIIVP ST+ NW  EF KW P+V  ++  G   TR  I ++ +    F+VL+T+YE +I++K +L +L W+Y++IDE HR+KN    L+QI+  +Y +  RLL+TGTPLQN L ELWALLNFLLPDIF     F++WF           E +QE   ++I++LH VL PFLLRR+K +VE  L  K+E  +   M+ +Q   Y  +  K +     +    K +G TR L+N +MQLRK CNHP++F+  E                 PG P  T+   + L   SGK  +LD++L +LK    R+LIF QM+ L+ ++  Y  +R F++ R+DG+T  ++R + +  +N    + F+F+L+TRAGGLG+NL  ADTVI+FDSDWNP  DLQA DRAHRIGQK +V V R +T N++EEK++  A  KL +D+ VIQ G
Sbjct:  172 VSESPSFVKSGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIILEARFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFY-SKNRLLITGTPLQNNLHELWALLNFLLPDIFGDSELFDEWFEQ------NNSEQDQE---IVIQQLHSVLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDI--DAVNGAVGKREGKTR-LLNIVMQLRKCCNHPYLFEGAE-----------------PGPPYTTD---EHLIFNSGKMIILDKLLKRLKEKGSRVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQLVIQQG 642          
BLAST of Transcription activator BRG1 vs. Ensembl Yeast
Match: ISW1 (ATPase subunit of imitation-switch (ISWI) class chromatin remodelers; with Ioc3p forms Isw1a complex involved in repression of transcription initiation; with Ioc2p and Ioc4p forms Isw1b complex involved in regulation of transcription elongation; Isw1b recruited to ORFs by H3K36 methylation and acts with Chd1p to prevent trans-histone exchange over coding regions; Isw1p import into nucleus depends on C-terminal bipartite nuclear targeting signal KRIR X19 KKAK [Source:SGD;Acc:S000000449])

HSP 1 Score: 414.075 bits (1063), Expect = 7.531e-124
Identity = 229/507 (45.17%), Postives = 323/507 (63.71%), Query Frame = 2
Query: 1730 SVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKS-IQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQ 3247
            S++ + RE S   VNGQL+ YQI+G+ WLVSL+ N + GILADEMGLGKT+QTI  + YL   +++ GPFL+I P ST++NW  E  +W P V   + +G    R   IQ +L   +F+V++ +YE II++K  L K+ W+Y+IIDE HR+KN    L+Q+L  +  +  RLL+TGTPLQN L ELWALLNFLLPDIF     F+ WF      S E  E +Q++   I+++LH VL+PFLLRR+K +VE+ L  K E  +   MS++Q+  Y  +  K   L   +  +   +  TR L+N +MQLRK CNHP++F   E                 PG P  T+   + L   + K ++LD++L KLK    R+LIF QM+ L+ ++  Y  +R +++ R+DG+T  +DR   +  +N      F+F+L+TRAGGLG+NL +AD V+++DSDWNP  DLQA DRAHRIGQK +V+V RL+T+NSVEEKIL  A  KL +D+ VIQ
Sbjct:  180 SIEFQFRE-SPAYVNGQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPGPFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQKKLLGCDFDVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREF-TSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDAQDFDDWF------SSESTEEDQDK---IVKQLHTVLQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQKKWYKKILEKD--LDAVNGSNGSKESKTR-LLNIMMQLRKCCNHPYLFDGAE-----------------PGPPYTTD---EHLVYNAAKLQVLDKLLKKLKEEGSRVLIFSQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLDQLVIQ 652          
BLAST of Transcription activator BRG1 vs. Ensembl Yeast
Match: CHD1 (Chromatin remodeler that regulates various aspects of transcription; acts in in conjunction with Isw1b to regulate chromatin structure and maintain chromatin integrity during transcription elongation by RNAP II by preventing trans-histone exchange over coding regions; contains a chromo domain, a helicase domain and a DNA-binding domain; component of both the SAGA and SLIK complexes [Source:SGD;Acc:S000000966])

HSP 1 Score: 407.527 bits (1046), Expect = 4.013e-119
Identity = 225/531 (42.37%), Postives = 321/531 (60.45%), Query Frame = 2
Query: 1700 QTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQ----------SQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFD 3262
            Q  + YT      E++  Q   +  G+L+++Q+ G+ W+  L++   NGILADEMGLGKT+QT+  I++L+  +R NGP +I+VPLSTM  W   FEKWAP +  + Y G+  +R +I+             K   FNVLLTTYEYI+KD+  L  +KW++M +DE HR+KN    L + LN++ +A  R+L+TGTPLQN + EL AL+NFL+P  F    T +Q       I  E  +  QEE    I  LH+ ++PF+LRRLKK+VE  LP K E +++ E+S +Q   Y     K ++  + S      KGG  +L+N + +L+K  NHP++F + E+ +      LQ FG       +  E   + L   SGK  LLD++L +LK   HR+LIF QM  ++ ++G Y   +G  F RLDGT  S  R   +  FN    + F+F+LSTRAGGLG+NL  ADTV+IFDSDWNP  DLQA  RAHRIGQKN V V RL++ ++VEE++L  AR K+ ++  +I  G+ D
Sbjct:  349 QYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVA-NRMLITGTPLQNNIKELAALVNFLMPGRF----TIDQ------EIDFENQDEEQEE---YIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY-----KNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERV------LQKFGDGK----MTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTD 850          
BLAST of Transcription activator BRG1 vs. Ensembl Nematostella
Match: EDO48116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK66])

HSP 1 Score: 1169.84 bits (3025), Expect = 0.000e+0
Identity = 644/1152 (55.90%), Postives = 829/1152 (71.96%), Query Frame = 2
Query:  794 IRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXXXXXXX-----------IVDEEMNINDEIEPIHIGTEDDEYNKDQTQ---TYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYS--------------EDECPDDETINQMIARSEDEFELYQRFDIERMMS---DNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKD-GRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVW 4150
            +R +++   ++D  LE+ALN KAY++ K+Q+L+E+R TEKLEK+ K +QE+++RQKHQE+LN  + H+++FKE+HR+V  KI+KLNKAV+NY + ++R K+KE+ERIE+ERMRRLMAEDEEGYRKLID KKD RLHYLLSQTDE+IA LTK+V++HKRD                  + L K   +R     DE     K                  HI + +  T + L    AP  G LE WL  + G+ +    E+ +    +E +  E E           +  +E +  ++ + ++   ++ E   +  Q    YY++AHS++E I EQ S+LV G+LKEYQ+ GLEW+VSL+NNNLNGILADEMGLGKTIQTI L +YL+EKKR+NGPFL+IVPLST+SNW LEFEKWAPS I V YKGSP  R+S  + L+ G FNV+LTTYEY+++DK  L+K++WKYM++DEGHRMKNHHCKLTQ+LNT+Y A +R+LLTGTPLQN+LPELWALLNFLLP IF+SV+TFEQWFNAPFA++GEKVELN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYV+KC+MS LQR LYNHM  KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHPFMFQHIE++IAEH   L   G    G+     + G D+YR SGKFELLDRILPKLK   HR+L+FCQMT+LMT++  YF ++GF +LRLDGTTKS+DRG LLS+FN     YF+F+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+ EVRVLRL+T NSVEEKILAAAR+KLNVDEKVIQAGMF+Q ST +ER  FL ALL+ +  +D +              E E PDDET+NQMIARSE+EFELYQR DIER  +   D +  + + RLM+ +ELP WI+K+D  +ER  +  E     ++  R RK+VDY++  TE Q+L+ I D   E+V ++    K  KK++      P    D+  +KKKRGRP    +S     ++ K   ++  ++ + D+D GR L+EPF+ LP+KKDLPDYY+IIKQP+D ++I+++I  +KY+ + +L+ D  L+C NAQ YNM+GS+                 IF+DSI L+S++
Sbjct:  337 LRHEVVACTRKDTTLETALNSKAYKRSKKQSLREARITEKLEKQQKMEQERKRRQKHQEYLNMILQHARDFKEYHRSVQSKIVKLNKAVMNYHSVTDREKKKEEERIEKERMRRLMAEDEEGYRKLIDHKKDKRLHYLLSQTDEYIASLTKMVQQHKRDHK----------------KKLQKGRVRRKSDFDDETPDADK------------------HIPVVDTETGEVLKGDDAPTAGELEDWLTTHPGYAVAPRQEDEESDEDDEEDEEEEEEESTQNLLYRDVKSKEKSEREKRKELYGKDDEGELESENPQEAINYYSIAHSMKETITEQPSMLVGGRLKEYQLAGLEWMVSLHNNNLNGILADEMGLGKTIQTIALFSYLIEKKRLNGPFLVIVPLSTLSNWQLEFEKWAPSAIVVSYKGSPNMRRSAGAVLRTGKFNVVLTTYEYVMRDKAILAKVRWKYMVVDEGHRMKNHHCKLTQVLNTHYAAQHRILLTGTPLQNRLPELWALLNFLLPTIFKSVSTFEQWFNAPFAMTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVVKCDMSILQRILYNHMYKKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPFMFQHIEESIAEH---LGFHG----GI-----VTGPDIYRASGKFELLDRILPKLKRNKHRVLMFCQMTSLMTILEDYFNWKGFPYLRLDGTTKSEDRGQLLSLFNAKDSPYFVFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQEKEVRVLRLMTVNSVEEKILAAARYKLNVDEKVIQAGMFNQNSTSSERKAFLMALLDTENDDDEAPKSNSNGASSAAMEESEVPDDETVNQMIARSEEEFELYQRMDIERRRTEVRDPTTHRRRPRLMADNELPRWILKDDNEVERLTWEEEEEKMFARGSRQRKKVDYSEHLTEKQWLKAIEDGCLEEVEERQKTRKVAKKRRREGTEEP----DAPKMKKKRGRPPAVRLSPNPPDLTKKMKRLLKYVVKHVDEDTGRSLAEPFLILPTKKDLPDYYQIIKQPVDIRKIRERINSHKYRCLEDLDEDFTLMCRNAQTYNMEGSI-----------------IFDDSIKLQSLF 1421          
BLAST of Transcription activator BRG1 vs. Ensembl Nematostella
Match: EDO40761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S667])

HSP 1 Score: 435.647 bits (1119), Expect = 4.350e-132
Identity = 228/502 (45.42%), Postives = 318/502 (63.35%), Query Frame = 2
Query: 1751 EQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKS-IQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAG 3253
            E  + +  G++++YQ++GL WL+SLY N +NGILADEMGLGKT+QTI L+ Y+   + V GP ++I P ST++NW  EFE+W PS+  V   G+   R + I+  +  G ++V +T+YE +I++K    K  W+Y++IDE HR+KN   KL++I+     A  RLLLTGTPLQN L ELWALLNFLLPD+F S + F+ WFN     S   VE  Q     ++ RLH VLRPFLLRRLK +VE +L  K E  +   ++ +QR+ Y  +  K + + +G+ K  K +     L+N +MQLRK CNHP++F   E                 PG P  T+++   L   SGK  +LD++L +LK    R+LIF QMT L+ ++  Y  +R + + RLDG T  ++R   ++ FN      FIFMLSTRAGGLG+NL  AD VI++DSDWNP +DLQA DRAHRIGQK +V+V R I+ ++VEE+I+  A  KL +D  VIQ G
Sbjct:  134 ESPNYIKGGEMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKNFRNVPGPHMVICPKSTLANWMAEFERWCPSIRAVCLIGNQEQRTAFIRDTMLPGEWDVCVTSYEMVIREKAVFKKFAWRYIVIDEAHRIKNEKSKLSEIVRELRSA-NRLLLTGTPLQNNLHELWALLNFLLPDVFSSSDDFDAWFN-----SNNLVEEKQ-----LVERLHSVLRPFLLRRLKSDVEKRLLPKKETKVYTGLTKMQRSWYTKILMKDIDVVNGAGKTDKMR-----LLNILMQLRKCCNHPYLFDGAE-----------------PGPPYTTDVH---LIENSGKMRVLDKLLARLKQEGSRVLIFSQMTRLLDILEDYCLWRQYDYCRLDGQTPHEERQAYINSFNMPGSTKFIFMLSTRAGGLGINLATADIVILYDSDWNPQVDLQAMDRAHRIGQKKQVKVFRFISESTVEERIIERAEMKLRLDAVVIQQG 599          
BLAST of Transcription activator BRG1 vs. Ensembl Nematostella
Match: EDO39585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J4])

HSP 1 Score: 370.933 bits (951), Expect = 7.412e-111
Identity = 219/578 (37.89%), Postives = 316/578 (54.67%), Query Frame = 2
Query: 1730 SVQEEIREQSSLL--VNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQS--------QLKNG------------NFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDE 3397
            + +E   +Q + L    G+L EYQ +GL WL   +    N ILADEMGLGKTIQTI  +  LM++    GPFL+  PLST+ NW  EFE WAP +  V Y G   +R +I++          K+G             F+VLLT+YE +  D  SL  + W  +++DE HR+KN+  K  + L+ Y +  Y+LLLTGTPLQN L ELW LL FL P  F + N F   F+           + +E+    I++LH +L P +LRRLK +V   +P K E +++ E+S +Q+  Y        ILT   E          +L+N +M+L+K CNHP++F     A A      Q  G  P             L   SGK  LL ++L KL+   HR+LIF QMT ++ L+  + E  G+K+ R+DG+     R + +  FN      F F+LSTRAGGLG+NL  ADTV I+DSDWNPH D+QA  RAHRIGQ N+V + R +T +SVEE+I   A+ K+ +   V++ G+   K+T   + + L  +L     E + +D+  D E+ + ++   +D+
Sbjct:  239 NCKERYEKQPAYLDETGGKLHEYQREGLNWLRFSWAQGTNTILADEMGLGKTIQTISFLYSLMKEGHSQGPFLVSAPLSTLVNWEREFEFWAPDMYVVTYAGDKESRATIRNFDFSFDEDAFKSGLKAYKLKKDSPVKFHVLLTSYELVSIDSASLQSIDWAMLVVDEAHRLKNNQSKFFRTLSDYNIG-YKLLLTGTPLQNNLEELWNLLFFLDPVEFNNKNNFLTEFD----------NVAKEDQ---IKKLHDILGPHMLRRLKADVLKGIPSKSELIVRVELSPMQKKYYKW------ILTRNFEALNTKGAQQVSLLNVMMELKKCCNHPYLFH----AAALEAKRTQSGGYEP-----------NSLTEASGKLMLLVKMLKKLREQGHRVLIFSQMTRMLDLLEDFLEGHGYKYERIDGSVNGAARQEAIDRFNAPTSQAFCFLLSTRAGGLGINLATADTVFIYDSDWNPHNDIQAFSRAHRIGQNNKVMIYRFVTRSSVEERITQVAKKKMMLTHLVVRPGLGSNKATIMSKSE-LDDILKFGTSELFKDDDTKDGESGDSVVFHYDDK 780          
BLAST of Transcription activator BRG1 vs. Ensembl Nematostella
Match: EDO47298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMN4])

HSP 1 Score: 365.54 bits (937), Expect = 7.001e-105
Identity = 204/502 (40.64%), Postives = 293/502 (58.37%), Query Frame = 2
Query: 1781 LKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQS-----QLKNGN-------FNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQA 3250
            L+EYQ++G+ WL+  + N  N ILADEMGLGKTIQ+I  + + M++  + GP L+I PLST+SNW  EFE W   +  V+Y GS ++R  IQ      + ++G        F VL+TTYE II D   LS + W+ +IIDE HR+KN +CKL + LN   +  +R+LLTGTPLQN + EL++LLNFL P  F S   F              +E    +T   + +L ++L+P +LRRLK++VE  +  K E +I+ E++ +Q+  Y  +  +         K          LMNT+M+LRK CNHPF+    E+ I      LQ +G+         + +   +   SGK  L+ ++LPKLK   H++L+F QM   + ++  Y  +  + + R+DG  + + R   +  F+    D F+F+L TRAGGLG+NL AADTVIIFDSDWNP  DLQAQ R HRIGQ   V+V RLIT NS E ++   A  KL +D+ V+Q+
Sbjct:  229 LREYQLEGVNWLMFCWCNRQNSILADEMGLGKTIQSIAFL-FEMQRYGIRGPNLVIAPLSTISNWQREFESWN-DINAVVYHGSASSRHLIQEYEFYYRDEHGQPIPNIFKFQVLITTYEIIIADNMQLSTVPWRAVIIDEAHRLKNRNCKLLEGLNNLQME-HRILLTGTPLQNNVEELFSLLNFLEPSQFPSQGAF-------------LMEFGDLKTESQVDKLKQLLKPMMLRRLKEDVEKNIAPKEETIIEVELTTVQKKFYRAILERNFAF---LAKGTSSTANVPNLMNTMMELRKCCNHPFLITGAEEKI------LQEYGREH------VDRHTHAMIEASGKLVLIHKLLPKLKLGGHKVLVFSQMVRCLDILEDYLVHMKYPYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQSRSVKVYRLITRNSYEREMFDRASMKLGLDKAVLQS 699          
BLAST of Transcription activator BRG1 vs. Ensembl Nematostella
Match: EDO41059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5B2])

HSP 1 Score: 320.087 bits (819), Expect = 6.471e-95
Identity = 190/527 (36.05%), Postives = 301/527 (57.12%), Query Frame = 2
Query: 1781 LKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQL--KNGNFNVLLTTYEYI---IKDKCSLSKLKWKYMIIDEGHRMKN----HHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIR--RLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQH-----------------IEQAIAEHNFMLQHFGKAP---------PGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQA 3250
            LK YQ+ GL WL+ ++   +NGILADEMGLGKT+Q I  I +L+EK   +GP LIIVP ST++NW  EF++W P++   LY GS   R  ++ ++  ++ +F V++TTY       +D   L +L+  Y++ DEGH +KN     + KLT+I      A  RLLLTGTP+QN L EL +LL+F++P IF                  +K++ + +   +  R  +  K+++PF+LRRLKK+V  +LP K E+VI CE+S  Q+ L++ +  K          + +    +R   N +M LR + NHP + ++                 IE   +E + + +                   + + + G++L   SGKFE L+ +LP++K    R+L+F Q T +M ++  Y ++ G+++ RLDG T   +R  ++  FN +  D F+F+LST+AGGLG+NL +A+ VI+ D D+NP+ D QA+DR HR+GQ  +V V RLI  ++VE+ +L  A  KL +++ V+ A
Sbjct:  113 LKPYQLTGLNWLILMHEQGVNGILADEMGLGKTVQAISFIAHLIEKGD-DGPHLIIVPSSTLNNWVKEFKQWCPTIRFTLYYGSQEERTYLREEILDEHSDFKVIITTYNMATGGFEDTSFLRQLRPHYVVFDEGHMLKNMQSQRYLKLTRI-----RAKRRLLLTGTPMQNDLLELMSLLSFVMPTIFDGRTD-----GLKLLFGNKKLDRDADSGYIKERAEQAKKIMKPFVLRRLKKDVLQELPQKHEHVIHCELSTSQKDLHSKLMLK-------CYNEYRDASKSRDYKNILMALRMMSNHPLLLRNYYKDETLREMAVKYCRDIENRGSEVDLVCEDMTVMSDFELHRLCLEQRSLSSYVLGEELLYDSGKFERLNAMLPEMKDNGDRVLLFSQFTLVMDIIEVYLQHCGYRYFRLDGQTPVVERQPMIDNFN-SDPDIFLFLLSTKAGGLGINLTSANVVILHDIDFNPYNDKQAEDRCHRVGQTRDVHVYRLIAKDTVEDNMLKCANSKLKLEKDVVSA 620          
BLAST of Transcription activator BRG1 vs. Ensembl Medaka
Match: smarca4a (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 [Source:NCBI gene;Acc:101163329])

HSP 1 Score: 1189.87 bits (3077), Expect = 0.000e+0
Identity = 692/1220 (56.72%), Postives = 887/1220 (72.70%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA---------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHIGTE-----DDEYN----KDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHI----IDDADEDVIDKSVENXXXXXXXSMEVPCPPSEL-------DSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            + LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+ALN KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR++  KI K  KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV+ HK +Q +K+KK+   +K+ +  E  + +L    G   DE  ++       D  + V      IH+D     + + L  + AP  G LE WL+ N G+E+            D+ ++E    + +     + +E+  I D       E++  HI        DDEY     +   Q+YY +AH+V E++ +QSSLL+NGQLK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGPFLIIVPLST+SNW  EF+KWAPSV+KV YKGSP  R+     L++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+YLAP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MSALQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHPFMFQHIE++ +EH   L   G    G+     + G DLYR SGKFELLDRILPKL+A NH++L+FCQMT+LMT+M  YF YR FK+LRLDGTTK++DRG LL  FND   +YFIF+LSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+G ER  FLQA+L  +E ++  ++   DDET+NQMIARSE+EFE + R D++R   D    K K RLM  D+LP+WI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I    ++D +E+V  K    K ++ +                   + +   KKRGRP    +S     ++ K   II+ ++ Y+D +GR LSE FI+LPS+K+LP+YYE+I++P+DF++IK++I+ +KY+++ +L  D+ LLC NAQ +N++GSL                 I+EDSI+L+SV+  ++ + 
Sbjct:  368 RGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSITAKIQKATKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRAHKAEQALKEKKKKKKKKKPESAETGAASLGPD-GEPLDETSQM------SDLPVKV------IHVD-----SGKILTGVDAPRAGQLEAWLEMNPGYEVAPRSDSEDSGSDDDEDEEDEEEDQQKPSAALSEEKKKIPDPDSEDVSEVDVQHIIEHAKQDVDDEYGNASFQRGLQSYYAVAHAVTEKVDKQSSLLINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEYKRINGPFLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPVARRLFVPILRSGKFNVLLTTYEYIIKDKQVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPFMFQHIEESFSEH---LGFSG----GI-----VSGPDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRSFKYLRLDGTTKAEDRGMLLKTFNDPASEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSGYERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARSEEEFEQFMRMDLDRRREDARNPKRKPRLMEEDDLPNWILKDDAEVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAIEEGNLEDMEEEVRHKKTTRKRRRDRDHDGGSSSLGSSSRGRDKDEEVKKAKKRGRPPAEKLSPNPLSLTKKMKKIIDAVIKYKDSNGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRSHKYRSLNDLEKDVMLLCQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSVRQKI 1539          
BLAST of Transcription activator BRG1 vs. Ensembl Medaka
Match: ENSORLT00000036279.1 (transcription activator BRG1 [Source:NCBI gene;Acc:101162023])

HSP 1 Score: 1172.53 bits (3032), Expect = 0.000e+0
Identity = 684/1219 (56.11%), Postives = 885/1219 (72.60%), Query Frame = 2
Query:  626 SLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLS-KRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYA------VDXXXXXXXXXXXXXXXXXIVDEEMNIND-------EIEPIHI-----GTEDDEYNKDQ----TQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHI---IDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLN---------LKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDK-DGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
             LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+AL+ KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR++  K+ KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV+ HK  Q +K+KK+   +K+KK      +T +    G   DE  ++       D  + V      IH+D  N      L  + AP  G LE WL+ N G+E+         ++  +E    E        VD++  I D       E++  HI        DDEY+        Q+YY +AH+V E++ +QS+LL+NGQLK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGP+LIIVPLST+SNW  EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+YLAP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MS+LQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQ IE++ +EH   L   G    G+     + G DLYR SGKFE+LDRILPKL+A NH++L+FCQMT+LMT+M  YF YR FK+LRLDGTTK++DRG LL  FN  + +YFIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIARSE+EFEL+ R D++R   +    + K RLM  DELP+WI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I     +  E+ +      + +K+ + +++P P S   S            ++KRGRP    +S     ++ K   I++ ++ Y+D   GR LSE FI+LPS+K+LP+YYE+I++P+DF++IK++I+ ++Y+T+ +L  D+ LL  NAQ +N++GSL                 I+EDSI+L+SV+  L+ + 
Sbjct:  406 GLDPVEILQEREYRLQARIAHRIAELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALDAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSMTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRAHKAAQALKEKKKKKKKKKKKMENAEGQTPALGPDGEPLDETSQM------SDLPVKV------IHVDSGN-----ILTGVDAPKAGQLETWLEMNPGYEVAPRSDSEDSEDEEEEEEEEEEPQPSSTSVDDKKKITDPDSEDVSEVDVRHIIENAKQDVDDEYSGAAFARGLQSYYAVAHAVTEKVEKQSTLLINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKQVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQQIEESFSEH---LGFSG----GI-----VQGPDLYRASGKFEVLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRTFKYLRLDGTTKAEDRGMLLKTFNSPESEYFIFLLSTRAGGLGLNLQSADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARSEEEFELFMRMDLDRRREEARNPRRKPRLMEEDELPTWIMKDDAEVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAIEEGTLEEVEEEVRHKKTTRKRKRDRDLDLPGPSSSCGSRGRGDKDEDGKRQRKRGRPPVEKLSPNPPALTKKMRKIVDAVIKYKDSASGRQLSEVFIQLPSRKELPEYYELIRKPVDFRKIKERIRSHRYRTLGDLERDVMLLFQNAQTFNLEGSL-----------------IYEDSIVLQSVFTSLRQKI 1577          
BLAST of Transcription activator BRG1 vs. Ensembl Medaka
Match: ENSORLT00000039803.1 (probable global transcription activator SNF2L2 [Source:NCBI gene;Acc:101161713])

HSP 1 Score: 1171.76 bits (3030), Expect = 0.000e+0
Identity = 681/1196 (56.94%), Postives = 872/1196 (72.91%), Query Frame = 2
Query:  623 KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEP----------IHIGTE-----DDEYN--KDQT--QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVW 4150
            + LDP+ +L +RE R+Q RI  RI EL S   S  P  R K  +ELKAL+LL+ Q+++R D++  M++D  LE+ALN KAYR+ KRQTL+E+R TEKLEK+ K +QEK++RQKHQE+LN+ + H+K+FKE+HR+V+ KI K+ ++V  + TN+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT LV EHK  Q  K+KK     K+K   +    +     G   DE  ++                  E+ + +    T + L    AP    LE WL+ N G+E+ A   +++E      E  E E+   EM     I+P           HI        DDEY+   DQT  Q+YY +AH+V E++ +QS+LL+NG LK YQI+GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGP+LIIVPLST+SNW  E +KWAPSV+K+ YKG+P  R+ +  QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSA+Q+ LY HMQ KG++LTDGSEKDKKGKGG +TLMNTIMQL+KICNHP+MFQHIE++ AE      H G  P G+     I G DLYR SGKFELLDRILPKL A  HR+L+FCQMTTLMT+M  YF YR F +LRLDGTTKS+DR  LL  FN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL + NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E  +  ++   DDET+NQMIAR+EDEFEL+ R D++R   D    K K RLM  DELPSWI+K+DA +ER  +  E      +  R R++VDY+D+ TE Q+LR  I+D + + +++ +  K +K+K+  +      E      +K+RGRP    +S     ++ +  +II+ ++NYRD  GR LSE F++LPS+K+LP+YYE+I++P+DFK+IK++++ +KY+++ +L  D+ LLC NAQ +N++GS                 QI+EDSI+L+SV+
Sbjct:  351 QGLDPMGILQEREFRLQARIAHRIQELESLPGSLPPDLRTKATVELKALRLLNFQRQLRQDVVACMRRDTTLETALNSKAYRRSKRQTLREARMTEKLEKQQKLEQEKKRRQKHQEYLNSILQHAKDFKEYHRSVSGKIQKITRSVATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTALVYEHKAAQAAKEKKRKKKRKKKVDGDGEGTSAFGLDGEPIDESSQMS-----------------ELPVKVIQTETGKVLQGTDAPKSSQLEAWLEMNPGYEV-APRSDSEESGSEFEEEEEDEMTKGEMEEKKIIDPNGDEVTVKAAKHIIESAKQDVDDEYSVPTDQTSLQSYYGVAHAVIEKVDKQSTLLINGMLKHYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSVVKIAYKGTPALRRGLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQ-KGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAE------HLG-YPNGI-----ISGPDLYRASGKFELLDRILPKLHATGHRVLLFCQMTTLMTIMEDYFGYRNFLYLRLDGTTKSEDRAALLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCSVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQNEEEDEVP-DDETLNQMIARNEDEFELFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTYEEEEEKMFGRGSRCRRDVDYSDALTEKQWLR-AIEDGNLEEMEEEIRLKKRKRKRRQDKDSSSREEGGGKARKRRGRPPAEKLSPNPPKLTKQMNTIIDTVINYRDGAGRQLSEVFVQLPSRKELPEYYELIRKPVDFKKIKERVRNHKYRSVGDLEKDVMLLCQNAQTFNLEGS-----------------QIYEDSIVLQSVF 1496          
BLAST of Transcription activator BRG1 vs. Ensembl Medaka
Match: ENSORLT00000004949.2 (transcription activator BRG1 [Source:NCBI gene;Acc:101162023])

HSP 1 Score: 936.791 bits (2420), Expect = 0.000e+0
Identity = 480/743 (64.60%), Postives = 588/743 (79.14%), Query Frame = 2
Query: 1679 DDEYNKDQ----TQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHI---IDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLN---------LKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRDK 3856
            DDEY+        Q+YY +AH+V E++ +QS+LL+NGQLK+YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGP+LIIVPLST+SNW  EF+KWAPSV+KV YKGSP  R++   QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+YLAP R+LLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GEKV+LN+EET+LIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKC+MS+LQR LY HMQ+KGV+LTDGSEKDKKGKGGT+TLMNTIMQLRKICNHP+MFQ IE++ +EH   L   G    G+     + G DLYR SGKFE+LDRILPKL+A NH++L+FCQMT+LMT+M  YF YR FK+LRLDGTTK++DRG LL  FN  + +YFIF+LSTRAGGLGLNLQ+ADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL T NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E ++  ++   DDET+NQMIARSE+EFEL+ R D++R   +    + K RLM  DELP+WI+K+DA +ER     E      +  R RKEVDY+DS TE Q+L+ I     +  E+ +      + +K+ + +++P P S   S            ++KRGRP    +S     ++ K   I++ ++ Y+D+
Sbjct:  619 DDEYSGAAFARGLQSYYAVAHAVTEKVEKQSTLLINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKQVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQQIEESFSEH---LGFSG----GI-----VQGPDLYRASGKFEVLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRTFKYLRLDGTTKAEDRGMLLKTFNSPESEYFIFLLSTRAGGLGLNLQSADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVP-DDETVNQMIARSEEEFELFMRMDLDRRREEARNPRRKPRLMEEDELPTWIMKDDAEVERLTCEEEEEKMFGRGSRQRKEVDYSDSLTEKQWLKAIEEGTLEEVEEEVRHKKTTRKRKRDRDLDLPGPSSSCGSRGRGDKDEDGKRQRKRGRPPVEKLSPNPPALTKKMRKIVDAVIKYKDR 1348          

HSP 2 Score: 160.614 bits (405), Expect = 4.267e-39
Identity = 123/218 (56.42%), Postives = 168/218 (77.06%), Query Frame = 2
Query:  626 SLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQII 1279
             LDPVE+L +RE R+Q RI  RI EL +   S     R K  IELKAL+LL+ Q+++R +++  M++D  LE+AL+ KAY++ KRQ+L+E+R TEKLEK+ K +QE+++RQKHQE+LN+ + H+K+FKE+HR++  K+ KL KAV  Y  N+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT+LV+ HK  Q +
Sbjct:  306 GLDPVEILQEREYRLQARIAHRIAELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALDAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSMTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRAHKAAQAL 523          
BLAST of Transcription activator BRG1 vs. Ensembl Medaka
Match: ENSORLT00000025786.2 (probable global transcription activator SNF2L2 [Source:NCBI gene;Acc:101161713])

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 479/730 (65.62%), Postives = 583/730 (79.86%), Query Frame = 2
Query: 1679 DDEYN--KDQT--QTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSK-KRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLNYRD 3853
            DDEY+   DQT  Q+YY +AH+V E++ +QS+LL+NG LK YQI+GLEW+VSLYNNNLNGILADEMGLGKTIQTI LITYLME KR+NGP+LIIVPLST+SNW  E +KWAPSV+K+ YKG+P  R+ +  QL++G FNVLLTTYEYIIKDK  L+K++WKYMI+DEGHRMKNHHCKLTQ+LNT+Y+AP RLLLTGTPLQNKLPELWALLNFLLP IF+S +TFEQWFNAPFA++GE+V+LN+EET+LIIRRLHKVLRPFLLRRLKKEVESQLP+KVEYVIKC+MSA+Q+ LY HMQ KG++LTDGSEKDKKGKGG +TLMNTIMQL+KICNHP+MFQHIE++ AE      H G  P G+     I G DLYR SGKFELLDRILPKL A  HR+L+FCQMTTLMT+M  YF YR F +LRLDGTTKS+DR  LL  FN+    YFIF+LSTRAGGLGLNLQAADTV+IFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRL + NSVEEKILAAA++KLNVD+KVIQAGMFDQKS+  ER  FLQA+L  +E  +  ++   DDET+NQMIAR+EDEFEL+ R D++R   D    K K RLM  DELPSWI+K+DA +ER  +  E      +  R R++VDY+D+ TE Q+LR  I+D + + +++ +  K +K+K+  +      E      +K+RGRP    +S     ++ +  +II+ ++NYRD
Sbjct:  638 DDEYSVPTDQTSLQSYYGVAHAVIEKVDKQSTLLINGMLKHYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSVVKIAYKGTPALRRGLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQ-KGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAE------HLG-YPNGI-----ISGPDLYRASGKFELLDRILPKLHATGHRVLLFCQMTTLMTIMEDYFGYRNFLYLRLDGTTKSEDRAALLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCSVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQNEEEDEVP-DDETLNQMIARNEDEFELFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTYEEEEEKMFGRGSRCRRDVDYSDALTEKQWLR-AIEDGNLEEMEEEIRLKKRKRKRRQDKDSSSREEGGGKARKRRGRPPAEKLSPNPPKLTKQMNTIIDTVINYRD 1352          

HSP 2 Score: 179.104 bits (453), Expect = 8.167e-45
Identity = 152/353 (43.06%), Postives = 214/353 (60.62%), Query Frame = 2
Query:  383 SFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINN---------------DNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHI---------------------------------------------KSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEH 1261
            +F   QL QLRAQI +YK+L++ QP+P++L  A +GK+ +                    S+  ++ +    G   ++++ K LTP + G P                                                + LDP+ +L +RE R+Q RI  RI EL S   S  P  R K  +ELKAL+LL+ Q+++R D++  M++D  LE+ALN KAYR+ KRQTL+E+R TEKLEK+ K +QEK++RQKHQE+LN+ + H+K+FKE+HR+V+ KI K+ ++V  + TN+ER ++KE ERIE+ERMRRLMAEDEEGYRKLID+KKD RL YLL QTDE++A LT LV EH
Sbjct:  182 AFSPVQLQQLRAQILAYKILARGQPLPENLQLAVQGKRSLPTMQQQPPQQPPQQQQQQASSVSPYRPS----GGENQAHVQKHLTPVSSGRPSPAPPQTSAVPPGPALSGSAAGLPPGQQVSPMLQMQQKQNRITPIQKPQGLDPMGILQEREFRLQARIAHRIQELESLPGSLPPDLRTKATVELKALRLLNFQRQLRQDVVACMRRDTTLETALNSKAYRRSKRQTLREARMTEKLEKQQKLEQEKKRRQKHQEYLNSILQHAKDFKEYHRSVSGKIQKITRSVATWHTNTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTALVYEH 530          
BLAST of Transcription activator BRG1 vs. Planmine SMEST
Match: SMESG000050888.1 (SMESG000050888.1)

HSP 1 Score: 1652.49 bits (4278), Expect = 0.000e+0
Identity = 935/938 (99.68%), Postives = 938/938 (100.00%), Query Frame = 2
Query:   83 MQSYHHSYSSQFPPXXXXXXXXXXXXXXXXXXXISLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHNIPSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMG 2896
            MQSYHHSYSSQFPPNSNMKNNNCNYSLKNNMNNISLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHN+PSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDREIRIQTRIQQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRS+IITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIKKKKENDLEKQKKKIEYLSKTLSKRCGLS+DEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKEFFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMG
Sbjct:    1 MQSYHHSYSSQFPPNSNMKNNNCNYSLKNNMNNISLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHNMPSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDREIRIQTRIQQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRSEIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIKKKKENDLEKQKKKIEYLSKTLSKRCGLSRDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKEFFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMG 938          
BLAST of Transcription activator BRG1 vs. Planmine SMEST
Match: SMESG000050880.1 (SMESG000050880.1)

HSP 1 Score: 1652.49 bits (4278), Expect = 0.000e+0
Identity = 935/938 (99.68%), Postives = 938/938 (100.00%), Query Frame = 2
Query:   83 MQSYHHSYSSQFPPXXXXXXXXXXXXXXXXXXXISLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHNIPSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMG 2896
            MQSYHHSYSSQFPPNSNMKNNNCNYSLKNNMNNISLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHN+PSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDREIRIQTRIQQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRS+IITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIKKKKENDLEKQKKKIEYLSKTLSKRCGLS+DEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKEFFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMG
Sbjct:    1 MQSYHHSYSSQFPPNSNMKNNNCNYSLKNNMNNISLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHNMPSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDREIRIQTRIQQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRSEIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIKKKKENDLEKQKKKIEYLSKTLSKRCGLSRDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKEFFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMG 938          
BLAST of Transcription activator BRG1 vs. Planmine SMEST
Match: SMESG000076666.1 (SMESG000076666.1)

HSP 1 Score: 1381.7 bits (3575), Expect = 0.000e+0
Identity = 803/1356 (59.22%), Postives = 977/1356 (72.05%), Query Frame = 2
Query:  185 SLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHNIPSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGK--QLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGI----PGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXXXXXXXIVDEEMNINDEI------EPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVNTFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLRLDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFDSDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVDEKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIARSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERNLFSNELTDSLSKKRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKS-----------VENXXXXXXXSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIINKLLN----YRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENKYKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSIILKSVWIELKDQF 4171
            S+   ++ N N N GN+          P   NLP  +    PS             A +P   N   F  NQL+QLRAQIN+YKLL+KS P+  ++I AAEGK  QL N  N+   D     N+N       + + +  S            ++LDP ELL +RE RI+ RI QRI ELT+KS        M   IELKAL+LL LQ+ +R +I+  MK+D  LE+ALNV+AYR+PK+QTL+E+RFTEKLEK++K++QEKR+RQKHQEFLNA + H+KEF+EFHRN N K  K+N+ ++NYF N+ER KRKEQER+ERERMRRLMAEDEEGYRKLIDEKKDMRLHYLL QTDEFIAGLTKLVK+HK++QI +KKKE + ++ + K + +   L++R   S++E+  I +++ AG     V  LP + HI I NP+T+++L +  +P   NL  W+KE++ W +   DE   E F            DEEM   DE+      + +H+GTEDDEYNK   Q+YY LAHS  EEI+EQ+S+L+NG LK+YQ+KGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLME+K+VNGPFLIIVPLSTMSNWA+EFEKW PSV K+LYKGSP  RK +Q+QLK   FNVLLTTYEYIIKDK SLSK+KWKYMIIDEGHRMKNHHCKLTQILNT+Y+APYRLLLTGTPLQNKLPELWALLNFLLP+IF+SVNTFEQWFNAPFA SGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVE+QLP+KVEYVIKCEMSALQR +Y+++QSK  IL    +  K      R   N +MQLRKICNHP+MF  +E   A+H FM  H G  PP VPIP EI+G DLYR SGKFELLDRILPKLK A HR+L+FCQMT LM LM  Y EYR FK+LRLDGTTKS+DRGDLL  FN    ++FIFMLSTRAGGLGLNLQ+ADTVIIFDSDWNPH DLQAQDRAHRIGQ+NEVRVLRLI  NS+EEKILAAARFKLNVDEKVIQAGMFDQKST  +R  +L+ALL+QDE ED  ++   DDETINQM+ARSE+EFE+YQR DIER +++ ++   K+RL+  DE+P  I  +D++ E      ++ D    KR RKEVDY+D+  E +FL+ I D   E+  D              E   + +      P PP       +K+ RGRP  +  S+    +S+K +  +  LLN    YRDKDGRILSEPF+KLPS+KDLPDYY+IIK+PMDF+RI+Q++K+NKY++I +L  DI +LC NAQ YNMDGSL                 IFEDSIIL+SVW   +++ 
Sbjct:   37 SMQIPNQINSNVNSGNY---------MPPVNNLPQNSMQPEPS------------PASQPPVPNKGIFDNNQLLQLRAQINAYKLLAKSNPVSNAVIMAAEGKLNQLQNISNRQA-DPATTTNSNNNDVLQRVQRDIKASCGKTLFKQARRPEALDPEELLRERENRIEARIIQRIDELTNKSAFLSNSQNMNLKIELKALRLLGLQRSLRQEILNVMKKDTSLETALNVRAYRRPKKQTLREARFTEKLEKQMKHEQEKRRRQKHQEFLNAVLLHAKEFREFHRNCNSKSNKVNRGIMNYFANTERDKRKEQERLERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLQQTDEFIAGLTKLVKDHKKEQIHRKKKEREEKRSQMKYDSIIAYLTQRFNKSQNELNNITRDIIAGKLESYVALLPQDEHIPIFNPTTRERLEE-ESPQAKNLIAWIKEHEEWRLSLKDEQGLEIFQE----------DEEMKGYDEVLEDDNDDDVHVGTEDDEYNKSHIQSYYALAHSHHEEIKEQASILINGTLKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTSKFNVLLTTYEYIIKDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVNTFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTE--RLWSNVLMQLRKICNHPYMFPEVEIEYAKHVFMKMHNGNPPPNVPIPKEIHGADLYRASGKFELLDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDEKVIQAGMFDQKSTDKDRKTYLKALLDQDESEDDEDECP-DDETINQMLARSEEEFEIYQRMDIERELAEKNKAVHKNRLLVADEIPENIDYHDSLDEE---VQQVQDDYIGKRNRKEVDYSDALMEHEFLKAIDDAEAEEDADNQRNRKIKRKRKINEGSSEDESSKPPAPTPP-------IKRGRGRPPGSLSSTPSAPISSKLMKRMQMLLNIVIDYRDKDGRILSEPFMKLPSRKDLPDYYDIIKKPMDFQRIRQRLKDNKYRSIDDLESDIFVLCKNAQTYNMDGSL-----------------IFEDSIILQSVWSNAREKL 1329          
BLAST of Transcription activator BRG1 vs. Planmine SMEST
Match: SMESG000050888.1 (SMESG000050888.1)

HSP 1 Score: 1152.12 bits (2979), Expect = 0.000e+0
Identity = 683/688 (99.27%), Postives = 688/688 (100.00%), Query Frame = 2
Query:   80 VMQSYHHSYSSQFPPXXXXXXXXXXXXXXXXXXXISLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHNIPSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLK 2143
            VMQSYHHSYSSQFPPNSNMKNNNCNYSLKNNMNNISLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHN+PSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDREIRIQTRIQQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRS+IITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIKKKKENDLEKQKKKIEYLSKTLSKRCGLS+DEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKEFFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSK++
Sbjct:   78 VMQSYHHSYSSQFPPNSNMKNNNCNYSLKNNMNNISLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHNMPSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDREIRIQTRIQQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRSEIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIKKKKENDLEKQKKKIEYLSKTLSKRCGLSRDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKEFFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKVE 765          

HSP 2 Score: 336.265 bits (861), Expect = 3.300e-97
Identity = 174/176 (98.86%), Postives = 174/176 (98.86%), Query Frame = 2
Query: 2369 SGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMG 2896
            S  KVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMG
Sbjct:  760 SLSKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMG 935          
BLAST of Transcription activator BRG1 vs. Planmine SMEST
Match: SMESG000050888.1 (SMESG000050888.1)

HSP 1 Score: 1148.27 bits (2969), Expect = 0.000e+0
Identity = 682/687 (99.27%), Postives = 687/687 (100.00%), Query Frame = 2
Query:   83 MQSYHHSYSSQFPPXXXXXXXXXXXXXXXXXXXISLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHNIPSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDXXXXXXXXXXXXXVELTSKSLSFVPGHRMXXXXXXXXXXXXXXXXXIRSDIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSXXXXXXXXXXXXXXXXXXXXXXXXXGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIXXXXXXXXXXXXXXIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDXXXXXXXXXXXXXXXXXIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLK 2143
            MQSYHHSYSSQFPPNSNMKNNNCNYSLKNNMNNISLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHN+PSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDREIRIQTRIQQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRS+IITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIKKKKENDLEKQKKKIEYLSKTLSKRCGLS+DEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKEFFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSK++
Sbjct:    1 MQSYHHSYSSQFPPNSNMKNNNCNYSLKNNMNNISLAYSSKSNENSNYGNFPSLNSNSKSYPGYFNLPPITNHNMPSLNQTYHNYDQQKSALKPGENNDKSFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDFKANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDREIRIQTRIQQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRSEIITNMKQDCYLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNAAIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMRRLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIKKKKENDLEKQKKKIEYLSKTLSKRCGLSRDEVCKIVKNLFAGDFNLAVQRLPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKEFFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHSVQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKVE 687          

HSP 2 Score: 336.265 bits (861), Expect = 6.663e-98
Identity = 174/176 (98.86%), Postives = 174/176 (98.86%), Query Frame = 2
Query: 2369 SGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTXXXXXXXXXXXXTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMG 2896
            S  KVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMG
Sbjct:  682 SLSKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMNTIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDLYRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMG 857          
The following BLAST results are available for this feature:
BLAST of Transcription activator BRG1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCA40.000e+054.83SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA40.000e+054.83SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA40.000e+054.94SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA40.000e+055.89SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA40.000e+055.89SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
swsn-40.000e+046.41SWI/SNF nucleosome remodeling complex component; S... [more]
pqn-155.224e-1158.61Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
isw-11.244e-12745.74Chromatin-remodeling complex ATPase chain isw-1 [... [more]
let-4188.995e-10741.31pep chromosome:WBcel235:V:5826833:5832866:1 gene:W... [more]
chd-31.100e-10438.55Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brm0.000e+056.42gene:FBgn0000212 transcript:FBtr0075524[more]
brm0.000e+056.42gene:FBgn0000212 transcript:FBtr0075523[more]
brm0.000e+056.42gene:FBgn0000212 transcript:FBtr0333580[more]
brm0.000e+056.42gene:FBgn0000212 transcript:FBtr0075526[more]
brm0.000e+056.42gene:FBgn0000212 transcript:FBtr0075525[more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarca20.000e+056.63SWI/SNF related, matrix associated, actin dependen... [more]
smarca20.000e+056.63SWI/SNF related, matrix associated, actin dependen... [more]
smarca20.000e+056.63SWI/SNF related, matrix associated, actin dependen... [more]
smarca4a0.000e+056.49SWI/SNF related, matrix associated, actin dependen... [more]
smarca4a0.000e+056.49SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCA40.000e+056.56SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA40.000e+057.59SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA40.000e+056.86SWI/SNF related, matrix associated, actin dependen... [more]
gtf3c20.000e+054.70general transcription factor IIIC subunit 2 [Sourc... [more]
SMARCA40.000e+057.59SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smarca20.000e+055.84SWI/SNF related, matrix associated, actin dependen... [more]
Smarca40.000e+055.65SWI/SNF related, matrix associated, actin dependen... [more]
Smarca40.000e+055.60SWI/SNF related, matrix associated, actin dependen... [more]
Smarca40.000e+055.79SWI/SNF related, matrix associated, actin dependen... [more]
Smarca20.000e+055.03SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Transcription activator BRG1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51532|SMCA4_HUMAN0.000e+054.83Transcription activator BRG1 OS=Homo sapiens OX=96... [more]
sp|A7Z019|SMCA4_BOVIN0.000e+056.24Transcription activator BRG1 OS=Bos taurus OX=9913... [more]
sp|Q6DIC0|SMCA2_MOUSE0.000e+055.84Probable global transcription activator SNF2L2 OS=... [more]
sp|Q8K1P7|SMCA4_RAT0.000e+055.65Transcription activator BRG1 OS=Rattus norvegicus ... [more]
sp|Q3TKT4|SMCA4_MOUSE0.000e+055.65Transcription activator BRG1 OS=Mus musculus OX=10... [more]
back to top
BLAST of Transcription activator BRG1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RV459.028e-760.33Global transcription activator snf2l2 OS=Fasciola ... [more]
H2KT901.130e-661.38Putative global transcription activator SNF2L2 OS=... [more]
A0A4S2MEU96.757e-761.46Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4V3SH696.735e-760.86Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S8X2Z71.638e-660.80Protein, SNF2 family OS=Opisthorchis viverrini OX=... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarca20.000e+054.15probable global transcription activator SNF2L2 [So... [more]
smarca20.000e+057.48probable global transcription activator SNF2L2 [So... [more]
smarca20.000e+057.48probable global transcription activator SNF2L2 [So... [more]
smarca4a0.000e+050.07SWI/SNF related, matrix associated, actin dependen... [more]
ENSAMXT00000045183.10.000e+056.94pep primary_assembly:Astyanax_mexicanus-2.0:13:200... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCA22.310e-3860.78SWI/SNF related, matrix associated, actin dependen... [more]
ENSPMAT00000001164.10.000e+059.54pep scaffold:Pmarinus_7.0:GL482256:352:18794:-1 ge... [more]
ENSPMAT00000001160.10.000e+059.62pep scaffold:Pmarinus_7.0:GL482256:352:18794:-1 ge... [more]
SMARCA53.292e-13642.73SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA52.432e-13141.18SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SNF22.340e-1152.20Catalytic subunit of the SWI/SNF chromatin remodel... [more]
STH12.185e-855.85ATPase component of the RSC chromatin remodeling c... [more]
ISW23.444e-13245.24ATP-dependent DNA translocase involved in chromati... [more]
ISW17.531e-12445.17ATPase subunit of imitation-switch (ISWI) class ch... [more]
CHD14.013e-11942.37Chromatin remodeler that regulates various aspects... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481160.000e+055.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407614.350e-13245.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395857.412e-11137.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472987.001e-10540.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410596.471e-9536.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription activator BRG1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarca4a0.000e+056.72SWI/SNF related, matrix associated, actin dependen... [more]
ENSORLT00000036279.10.000e+056.11transcription activator BRG1 [Source:NCBI gene;Acc... [more]
ENSORLT00000039803.10.000e+056.94probable global transcription activator SNF2L2 [So... [more]
ENSORLT00000004949.24.267e-3964.60transcription activator BRG1 [Source:NCBI gene;Acc... [more]
ENSORLT00000025786.28.167e-4565.62probable global transcription activator SNF2L2 [So... [more]
back to top
BLAST of Transcription activator BRG1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050888.10.000e+099.68SMESG000050888.1[more]
SMESG000050880.10.000e+099.68SMESG000050880.1[more]
SMESG000076666.10.000e+059.22SMESG000076666.1[more]
SMESG000050888.13.300e-9799.27SMESG000050888.1[more]
SMESG000050888.16.663e-9899.27SMESG000050888.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019938 ID=SMED30019938|Name=Transcription activator BRG1|organism=Schmidtea mediterranea sexual|type=transcript|length=4565bp
CAGGGTTTTAAGTTCTATGGTTAATAAACAAAATTTTATTTTTTATATAT
CTGTAGAATAAAATCAGATCTATAAAATTGTAATGCAATCCTATCATCAT
TCCTATTCGTCACAATTCCCACCTAATTCTAATATGAAGAACAATAACTG
TAATTATTCACTCAAAAATAACATGAACAATATTTCATTAGCATATTCCT
CGAAATCAAATGAAAATTCTAACTATGGAAATTTCCCATCTTTAAATTCA
AATTCCAAATCGTACCCCGGATATTTTAATCTGCCACCAATTACAAATCA
TAATATACCATCATTAAATCAAACATATCATAATTATGATCAACAAAAAT
CTGCATTGAAACCTGGTGAAAATAATGACAAATCATTTTTAAAAAATCAA
TTGATTCAGTTACGAGCCCAAATTAATTCTTATAAATTATTGTCAAAATC
ACAGCCCATTCCTCAATCACTTATTAATGCAGCGGAAGGAAAGCAGCTTA
TAAATAATGACAACAAATCAATTTATGATTTCAAAGCAAATGAAAATACT
AATGGAAAAAGTAAAAGATCGAATATTTCTAAAATTCTAACTCCGTCTAA
CCACGGAATTCCTGGACATATAAAGAGCCTAGATCCAGTTGAGTTACTCA
ATGACAGAGAAATTAGAATACAAACAAGAATTCAACAAAGAATTGTTGAA
TTGACATCAAAAAGTTTAAGTTTTGTTCCTGGACATAGAATGAAGTTCCT
TATTGAATTGAAGGCTTTAAAACTATTGTCATTGCAAAAGAAAATTCGAA
GCGACATCATTACTAACATGAAACAGGACTGCTATTTGGAAAGTGCTCTT
AATGTCAAAGCATATAGAAAACCAAAACGGCAAACATTAAAAGAGTCTCG
GTTTACTGAGAAATTGGAAAAGAAAATCAAGTATGATCAAGAAAAACGAA
AGCGCCAAAAACATCAAGAATTTCTAAATGCAGCAATTTTTCATTCTAAA
GAATTCAAAGAATTCCATCGAAATGTTAATTTTAAAATTATTAAATTAAA
TAAAGCAGTTTTGAATTATTTCACCAACAGCGAACGATACAAAAGAAAGG
AACAAGAACGAATCGAAAGAGAAAGAATGCGTCGCTTAATGGCAGAAGAT
GAGGAAGGTTATAGGAAACTTATTGACGAGAAGAAAGATATGAGATTACA
TTATTTATTGTCGCAAACCGATGAATTTATAGCCGGTCTCACAAAACTTG
TCAAAGAACATAAACGGGATCAAATTATTAAAAAGAAAAAGGAAAATGAT
CTTGAAAAACAAAAGAAAAAAATCGAATATCTTTCAAAAACTCTCAGTAA
ACGTTGTGGATTATCCAAAGATGAGGTGTGTAAAATTGTGAAAAATCTTT
TTGCTGGAGATTTCAATCTAGCTGTTCAAAGGTTACCACCTGAAATCCAT
ATTGATATTCACAATCCAAGTACTCAACAAAAATTGATAGATATAGGTGC
ACCTCTTATTGGAAATCTTGAACAATGGCTCAAGGAAAACAAGGGTTGGG
AAATTTATGCAGTAGATGAAAATAATAAAGAATTTTTTTTCAACGAGTTT
GAAATGAACGAAATGGAAATAGTTGATGAAGAAATGAATATAAATGATGA
AATTGAACCTATACACATTGGCACAGAAGATGATGAATATAATAAAGATC
AAACTCAAACGTATTATACTCTCGCTCACTCTGTGCAGGAAGAAATACGA
GAACAGTCGTCATTGCTCGTAAACGGACAATTAAAAGAATATCAAATCAA
AGGTCTAGAATGGCTTGTATCTTTGTATAATAATAATTTAAATGGAATCC
TGGCAGATGAAATGGGTCTAGGAAAAACAATTCAAACGATAGGGCTAATA
ACTTATTTAATGGAAAAGAAACGCGTAAATGGACCGTTTTTGATTATAGT
CCCATTATCAACAATGTCCAATTGGGCATTAGAATTTGAGAAATGGGCTC
CAAGTGTTATTAAGGTCTTGTACAAAGGATCACCAACCACTAGAAAAAGT
ATTCAAAGTCAACTTAAAAATGGAAATTTCAATGTACTTTTAACAACATA
TGAATACATTATTAAAGACAAATGCAGTTTATCCAAGCTTAAATGGAAAT
ATATGATAATTGATGAAGGTCATCGGATGAAAAACCACCACTGCAAGTTG
ACTCAAATCCTTAATACGTATTATCTAGCCCCATATAGGTTGCTACTTAC
AGGTACACCATTGCAGAACAAACTGCCAGAACTTTGGGCTCTTTTGAATT
TTCTTTTACCTGACATTTTTCAGAGCGTTAATACCTTTGAACAATGGTTC
AATGCTCCTTTCGCAATAAGTGGGGAAAAGGTTGAATTGAATCAAGAAGA
AACATTACTAATTATTAGGCGGTTGCACAAAGTTTTAAGACCATTTTTAC
TTCGTAGATTGAAAAAAGAAGTAGAAAGTCAACTGCCAGATAAAGTTGAA
TATGTAATTAAATGCGAGATGTCAGCATTACAGCGAACATTATACAATCA
TATGCAGAGTAAAGGAGTTATTCTTACTGATGGATCAGAAAAAGATAAAA
AAGGTAAAGGAGGAACAAGAACTTTGATGAACACTATAATGCAACTGAGA
AAAATTTGCAACCACCCATTCATGTTTCAACACATTGAACAGGCTATTGC
TGAACACAATTTTATGTTACAACATTTTGGCAAAGCTCCCCCAGGTGTTC
CGATTCCAACTGAAATATATGGACAGGATCTTTATCGGGTGTCAGGGAAA
TTTGAATTGCTGGACAGAATTTTACCAAAACTTAAAGCAGCCAATCATCG
AATTCTTATTTTTTGTCAAATGACAACTTTAATGACATTAATGGGGTTCT
ATTTTGAATATCGAGGATTCAAATTTCTTAGGTTAGATGGGACAACAAAA
TCGGATGATCGAGGAGATTTATTATCTATGTTCAACGATGCTCAGCATGA
CTATTTCATTTTTATGTTATCTACAAGAGCTGGAGGTTTAGGACTAAATC
TTCAAGCTGCAGATACAGTTATCATATTTGATTCCGACTGGAATCCTCAT
TTAGACTTACAAGCTCAAGATCGTGCTCATAGAATTGGCCAGAAAAATGA
AGTTAGGGTTCTGAGATTGATAACGAATAATTCGGTGGAAGAAAAGATTC
TAGCAGCCGCTAGATTCAAACTAAATGTAGATGAAAAAGTTATCCAAGCT
GGAATGTTTGACCAAAAATCGACAGGAACAGAACGCCATCAATTTTTACA
AGCATTGTTGAATCAAGATGAGATGGAAGACTATTCCGAAGATGAATGCC
CCGATGATGAAACCATAAATCAAATGATTGCAAGATCTGAAGATGAATTT
GAACTTTATCAAAGATTCGACATTGAGAGAATGATGAGTGATAATTCACG
AGGCAAATTGAAATCAAGACTAATGAGCCATGATGAACTGCCATCATGGA
TTGTAAAAAATGACGCCATAATAGAACGAAATTTATTTTCTAATGAACTG
ACAGACAGCTTATCCAAAAAACGTATCCGCAAAGAAGTCGACTATACAGA
TTCCTTTACAGAAGCACAATTTTTGCGACATATTATTGATGATGCTGACG
AAGATGTCATTGATAAGTCGGTTGAAAATAAAGGCAAAAAGAAAAAAAAG
TCAATGGAAGTCCCATGCCCACCATCAGAACTTGATTCCCTAAATTTGAA
AAAGAAGAGAGGGAGACCTTTTAATAACTCTGTTTCTAGCAAAGACAATC
TAATGTCCGCAAAATATCTCAGTATAATTAATAAATTATTAAATTATCGT
GACAAGGACGGGCGTATTCTCAGCGAACCATTTATAAAGTTGCCATCTAA
AAAAGACCTACCCGACTACTATGAAATTATAAAGCAACCAATGGATTTTA
AAAGAATAAAACAAAAAATCAAAGAAAACAAATATAAAACAATCTATGAA
CTTAATCATGATATTAATCTGTTATGCTCGAATGCACAAGTCTATAATAT
GGATGGAAGTTTAGTAAGTTTGACTGATTCTAACTATAATTCGCTTTCTT
TCTGTGACATTCAGATATTTGAGGATTCCATAATTCTGAAGTCGGTATGG
ATAGAATTGAAAGACCAATTTTTACGCGAGAATCCAAACTTTTCTGACAC
CAGCACAACTAATGAACATCATCAATTGAGTTCGTCGGAAAAATCTGATA
ATAATAATATTGTTGTTGTTGTTGACAAGCGGTTAACTCATGAAAAATTG
AAAGATTTCAAAATTTCCACAAATAACTCTGAACTGAAAATCCCCGTGCT
GAAAACGAATCCCTCTCGTAAAATCTCTGCAAAAATAAAAGAAGAAAACG
ATTAAAATGTTGTTTTTCATTCCAATAATTCAATTTTAGGTGTCATTATG
TTTGTATTAGTTCTATTGAGAATAATTTTAATGTTTTCATGTTTCTGAGA
TTTTTGTCAATTACATATTTTGTTGTTTTTTATTATGAAAAAATATTTTA
ATAAATTTTTTGAAA
back to top

protein sequence of SMED30019938-orf-1

>SMED30019938-orf-1 ID=SMED30019938-orf-1|Name=SMED30019938-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1441bp
MQSYHHSYSSQFPPNSNMKNNNCNYSLKNNMNNISLAYSSKSNENSNYGN
FPSLNSNSKSYPGYFNLPPITNHNIPSLNQTYHNYDQQKSALKPGENNDK
SFLKNQLIQLRAQINSYKLLSKSQPIPQSLINAAEGKQLINNDNKSIYDF
KANENTNGKSKRSNISKILTPSNHGIPGHIKSLDPVELLNDREIRIQTRI
QQRIVELTSKSLSFVPGHRMKFLIELKALKLLSLQKKIRSDIITNMKQDC
YLESALNVKAYRKPKRQTLKESRFTEKLEKKIKYDQEKRKRQKHQEFLNA
AIFHSKEFKEFHRNVNFKIIKLNKAVLNYFTNSERYKRKEQERIERERMR
RLMAEDEEGYRKLIDEKKDMRLHYLLSQTDEFIAGLTKLVKEHKRDQIIK
KKKENDLEKQKKKIEYLSKTLSKRCGLSKDEVCKIVKNLFAGDFNLAVQR
LPPEIHIDIHNPSTQQKLIDIGAPLIGNLEQWLKENKGWEIYAVDENNKE
FFFNEFEMNEMEIVDEEMNINDEIEPIHIGTEDDEYNKDQTQTYYTLAHS
VQEEIREQSSLLVNGQLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTI
QTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGS
PTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMK
NHHCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSVN
TFEQWFNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQ
LPDKVEYVIKCEMSALQRTLYNHMQSKGVILTDGSEKDKKGKGGTRTLMN
TIMQLRKICNHPFMFQHIEQAIAEHNFMLQHFGKAPPGVPIPTEIYGQDL
YRVSGKFELLDRILPKLKAANHRILIFCQMTTLMTLMGFYFEYRGFKFLR
LDGTTKSDDRGDLLSMFNDAQHDYFIFMLSTRAGGLGLNLQAADTVIIFD
SDWNPHLDLQAQDRAHRIGQKNEVRVLRLITNNSVEEKILAAARFKLNVD
EKVIQAGMFDQKSTGTERHQFLQALLNQDEMEDYSEDECPDDETINQMIA
RSEDEFELYQRFDIERMMSDNSRGKLKSRLMSHDELPSWIVKNDAIIERN
LFSNELTDSLSKKRIRKEVDYTDSFTEAQFLRHIIDDADEDVIDKSVENK
GKKKKKSMEVPCPPSELDSLNLKKKRGRPFNNSVSSKDNLMSAKYLSIIN
KLLNYRDKDGRILSEPFIKLPSKKDLPDYYEIIKQPMDFKRIKQKIKENK
YKTIYELNHDINLLCSNAQVYNMDGSLVSLTDSNYNSLSFCDIQIFEDSI
ILKSVWIELKDQFLRENPNFSDTSTTNEHHQLSSSEKSDNNNIVVVVDKR
LTHEKLKDFKISTNNSELKIPVLKTNPSRKISAKIKEEND*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0043044ATP-dependent chromatin remodeling
GO:0006355regulation of transcription, DNA-templated
GO:0006338chromatin remodeling
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR038718SNF2-like_sf
IPR036427Bromodomain-like_sf
IPR030088SMARCA2
IPR037259BRK_sf
IPR001487Bromodomain
IPR014001Helicase_ATP-bd
IPR014978Gln-Leu-Gln_QLQ
IPR014012HSA_dom
IPR029295SnAC
IPR001650Helicase_C
IPR027417P-loop_NTPase
IPR000330SNF2_N
IPR018359Bromodomain_CS
IPR000299FERM_domain
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
GO:0042393histone binding
GO:0016817hydrolase activity, acting on acid anhydrides
GO:0016887ATPase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005856cytoskeleton
GO:0016514SWI/SNF complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 400..420
NoneNo IPR availableCOILSCoilCoilcoord: 337..357
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 802..1050
e-value: 5.8E-175
score: 584.1
NoneNo IPR availablePANTHERPTHR10799SWI/SNF-RELATED MATRIX-ASSOCIATED ACTIN-DEPENDENT REGULATOR OF CHROMATIN SUBFAMILY-RELATEDcoord: 183..1403
NoneNo IPR availableCDDcd17996DEXHc_SMARCA2_SMARCA4coord: 564..794
e-value: 1.69514E-155
score: 467.231
NoneNo IPR availableCDDcd18793SF2_C_SNFcoord: 903..1030
e-value: 5.86671E-55
score: 185.373
IPR001487BromodomainPRINTSPR00503BROMODOMAINcoord: 1292..1310
score: 28.83
coord: 1276..1292
score: 56.78
coord: 1310..1329
score: 36.96
IPR001487BromodomainSMARTSM00297bromo_6coord: 1234..1365
e-value: 4.5E-28
score: 109.3
IPR001487BromodomainPFAMPF00439Bromodomaincoord: 1262..1327
e-value: 3.9E-19
score: 68.5
IPR001487BromodomainPROSITEPS50014BROMODOMAIN_2coord: 1259..1329
score: 21.276
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 935..1019
e-value: 7.0E-20
score: 82.1
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 906..1019
e-value: 1.2E-18
score: 67.4
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 909..1070
score: 16.185
IPR014978Glutamine-Leucine-Glutamine, QLQSMARTSM00951QLQ_2coord: 100..136
e-value: 3.8E-5
score: 33.1
IPR014978Glutamine-Leucine-Glutamine, QLQPFAMPF08880QLQcoord: 101..133
e-value: 8.8E-9
score: 35.0
IPR014978Glutamine-Leucine-Glutamine, QLQPROSITEPS51666QLQcoord: 101..136
score: 17.329
IPR014012Helicase/SANT-associated domainSMARTSM00573bromneu2coord: 282..354
e-value: 1.9E-18
score: 77.3
IPR014012Helicase/SANT-associated domainPFAMPF07529HSAcoord: 284..353
e-value: 1.6E-15
score: 57.2
IPR014012Helicase/SANT-associated domainPROSITEPS51204HSAcoord: 282..354
score: 17.105
IPR029295Snf2, ATP coupling domainSMARTSM01314SnAC_2coord: 1114..1181
e-value: 2.9E-17
score: 73.4
IPR029295Snf2, ATP coupling domainPFAMPF14619SnACcoord: 1101..1181
e-value: 4.5E-12
score: 46.4
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 563..755
e-value: 1.7E-39
score: 147.2
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 579..744
score: 26.14
IPR038718SNF2-like, N-terminal domain superfamilyGENE3DG3DSA:3.40.50.10810coord: 560..801
e-value: 5.8E-175
score: 584.1
IPR036427Bromodomain-like superfamilyGENE3DG3DSA:1.20.920.10coord: 1239..1394
e-value: 2.0E-30
score: 107.4
IPR036427Bromodomain-like superfamilySUPERFAMILYSSF47370Bromodomaincoord: 1224..1328
IPR000330SNF2-related, N-terminal domainPFAMPF00176SNF2_Ncoord: 579..864
e-value: 5.8E-73
score: 245.6
IPR030088SWI/SNF complex subunit SMARCA2PANTHERPTHR10799:SF541GLOBAL TRANSCRIPTION ACTIVATOR SNF2L2-RELATEDcoord: 183..1403
IPR018359Bromodomain, conserved sitePROSITEPS00633BROMODOMAIN_1coord: 1264..1321
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 534..792
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 794..1120
IPR037259BRK domain superfamilySUPERFAMILYSSF160481BRK domain-likecoord: 449..493