ATP-binding cassette sub-family A member 1

Overview
NameATP-binding cassette sub-family A member 1
Smed IDSMED30019931
Length (bp)5212
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019931

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 38

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019931h1SMcG0002123 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019931h1SMcG0012030 Contig3640GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019931h1SMcG0012029 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019931h1SMcG0012029 Contig3640GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019931h1SMcG0012028 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019931h1SMcG0012028 Contig3640GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019931h1SMcG0012030 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019931h1SMcG0012034 Contig3640GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019931h1SMcG0012034 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019931h1SMcG0012033 Contig3640GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019931h1SMcG0012033 Contig3771GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30019931h1SMcG0012029 SmedASXL_004745SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30019931h1SMcG0012029 SmedASXL_004744SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30019931h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019931h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019931h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019931h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30019931h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30019931h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019931h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019931h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019931h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019931h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019931h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30019931h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30019931h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019931h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30019931h1SMcG0012029 dd_Smed_v4_30574_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30019931h1SMcG0002123 Contig3771GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30019931h1SMcG0012029 Contig3771GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30019931h1SMcG0012028 Contig3771GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30019931h1SMcG0012029 Contig8654newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30019931h1SMcG0012029 Contig8654uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30019931h1SMcG0012030 Contig3771GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30019931h1SMcG0012034 Contig3771GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30019931h1SMcG0012033 Contig3771GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30019931h1SMcG0012028 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019931h1SMcG0012029 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:29])

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 571/1687 (33.85%), Postives = 898/1687 (53.23%), Query Frame = 1
Query:  514 YNELGEIICGSPEND-FKLFMRNFIKNQRRKRSLLT--CQLIFQSFFQNSIVKFE---------------MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWR---------------LHFQTFLLDYISNNVF-------INDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTF---LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDL-TEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQ----------NPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWL------MMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWS----PASILDI--------PMVSPECDCS----KTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF-----QRLSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIK--KTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 5121
            Y  +  I+CG PE    K+   N+ ++   K        +   ++F+ NS   +                ++  L PL+ GK+ Y P+    RQ++ + N TF+ L         W                +     LLD   N+ F       ++   +   A+ + +P+   + N   ++   +   +  ++    I R + C  L++  P+ +      L N+S      R F A I+F      +TP +      + Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ ++QA I ++T  E  + G  M  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W SWFIS+++ L++   ++ V L+L  +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+     LLS VAF    ++   +E+   GVQ+ NLF++P E   F +   + +M+ D+F+Y ++TWY+EAVFPGQYG+ +PW F C +SYW       +S P    +NQ   I+    E EP +LKLG+SI NLVK+Y       ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYIL +DIR+EM +IRQ +G+CPQ+NVLFD LTVE+HI+FY  LK + +  +++ + ++  DV L + K+ + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   ++ ++++AR++E+   + T VLP        F ELF  +D  ++++ I SYG+S+T+LEE+FLKVA++     ++ E S  +      +       +    F             +P+ +++  L   D    + +KG+ L QQQ +AL  KR   A+R  KGF A+++LP + +   ++F  I     K   +++ PW+       +S    E+  T        L L+N L      D G  G RCM  NP    + +  C    E   W+    P +I+D+           SP C CS    K    +C     G  P   R   ++D L +LTG NISDYL+K +     + L  KI      +GG+   + N  A         P    + D++ Q +      ++    RFL     F      T N  ++W N+KG+ ++ ++ N+++N +LR+ ++  +N  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   TD      N+ILK VFLIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+  ++  +++  +F      N K+     ED D+  E+ R+      +D+L++  LTKIY R
Sbjct:  301 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNGTEEDAETFYDNSTTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPKIWTFMENSQEMDLVRMLLDSRDNDHFWEQQLDGLDWTAQDIVAFLAKHPEDVQSSNG--SVYTWREAFNETNQAIRTISRFMECVNLNKLEPIATEV---WLINKSMELLDERKFWAGIVFTG----ITPGSIELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGTEK-KTGVYMQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFTLKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWFGEESDEKSHP---GSNQK-RISEICMEEEPTHLKLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYR-QGRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE---SGVDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQYTFVSNDAPEDTGT--------LELLNALT----KDPG-FGTRCMEGNP----IPDTPCQAGEEE--WTTAPVPQTIMDLFQNGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGL-PPPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNTQAL--------PPSQEVNDAIKQMKKHLKLAKDSSADRFLNSLGRFMT-GLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TDNKLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAV-------------EGVVFFLITVLIQYRFFIRPRPVNAKLSPLNDEDEDVRRERQRILDGGGQNDILEIKELTKIYRR 1923          

HSP 2 Score: 180.644 bits (457), Expect = 1.087e-44
Identity = 101/320 (31.56%), Postives = 169/320 (52.81%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + I  L K+Y   + P ++ + +     +    LG NGAGK++T  +LTG  + + G A++    I + +  + Q +G CPQ++ + + LT  +H+ F+ LL+ + + E+  V    I+ + L +     + + SGG KRKLS AMA IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           + SN + + +  F  +    + + E+ R      LP    +      +F  L Q    + I  Y +S T+L++VF+  A D
Sbjct: 1912 LEIKELTKIYRRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIVVRIAGSNPDLKPVQDFFGLAFPGSVLKEKHRNMLQYQLPS---SLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKD 2223          

HSP 3 Score: 65.855 bits (159), Expect = 8.724e-10
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            QLR LLWKN   +RR+   LL+E+  PL +  IL +VR S   Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    6 QLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA7 (ATP binding cassette subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:37])

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 508/1579 (32.17%), Postives = 825/1579 (52.25%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRL---HFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIF------NETFQYLTPK-NTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXX------------------------XXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCN---ILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD-----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIR--CMNPSIYRLDNYQCFYRNENNM----WSPASILDIPMVSPECDCSKTG-NQICNDLRSGGPPNSY--RIMTSSDKLNNLTGYNISDYLLKNFQRLSRKI-----------FGGYQFLLPNDFAQSSKLIAQ---------SPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLI-LLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYD------AFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 5118
            ++  L PLI GK+ + P+    R+++ + N TF+ L  LR     W +      TF+ D  +  +    ++   +      P   D +  L      +S++D  S  +SW             + R   C  LD+   L++      L +++ +      F A ++F      ++  ++ TP      +  +IR+ +  +  T K +  DRFW P P  +  TD +YV  GF++LQ+ +++A +  V +  +   G  +  MPYPCY+ D FL+ L+  LP  L +AW  SVT+ +K++V EKE+RL++ M+ MGL+  V W+ WF+S +   ++   ++ + L+L  I   S   VVF  +  + ++ + Q+F++S FFS+AN+A+  GG+ YF+ Y+ +V+ +     L      +  LLS VAF    + +   E+  EG Q+ N+   P   + F +     L+++D+ +Y L TWY+EAV PGQYG+ +PWNF   RSYW          P     +    +     E  P  L  G+S+ +L K +P +  P +  L+L+FY+  ITAFLGHNGAGKTTT+SIL+G+F PS G+A+IL  D+R+ M +IR  +G+CPQYNVLFD LTV++H++FYG LK +    +     R+++DV L  K +  + HLSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP +RRGIW+LL+KYR   RT+IL+THH+DEA+ L DRVA+++ G+L CCGS +FL+R  G GYYL+L+K +                             S      +L  V+ ++  AR++EE   +  +VLP    +   F  LF+ LD  +AE+ +  YG+SDTSLEE+FLKV ++       ++ S   + C     L + LR+     E  L        +   DQ         ++G+ L +QQ+ AL +KR+  A+R  +G  A+++LP L +   ++F  I         +++SP      M    ++ F        G    LE+     L E+G+    +  S +R    +        +    W+P S       SP C CS+ G  ++  D  +          +  S + + NLTG N+SD+L+K + RL R+            +GG+     +    S + + +         SP   G  D             R LK    + + S    +  +IW N+KG+ SM A+ N  SN +LR+ +        + I+  N+P+  ++ ++S+   +   ++V ++I V+ A+SF+ ASF + LI+ER++ +K  Q + G++P +YW+ NFLWD+  Y++P  I+++IF+AF  ++Y+   N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G   +M+TF+L++   +D+  +  + ILK+VFLIFP + LGRG+ID+  N     M D + +           WEV  + L ++++   L+ +  ++++       L    +V      +   ED D++ E+ R+       DVL + NLTK+Y 
Sbjct:  283 LWRRLKPLILGKLLFAPDTPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEAL------RSFLDPGSGGYSWQDAHADVGHLVGTLGRVTECLSLDK---LEAAPSEAALVSRALQLLAEHRFWAGVVFLGPEDSSDPTEHPTPDLGPGHVRIKIRMDIDVVTRTNKIR--DRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVR-VLSGANPRAGLYLQQMPYPCYVDDVFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCLGPFLLSAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACGGLAYFSLYLPYVLCVAWRDRLPAGGRVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVGTRPTADV-FSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPPKSPAPCPTPLDPKVLV-----EEAPPGLSPGVSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLKYR-EGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGSCGQHLCTGIAGLDVTLRLKMPPQETALENGEPAGSAPETDQGSGPDAVGRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSP-----TMYGAQVSFFSEDAPGDPGRARLLEAL----LQEAGLEEPPVQHSSHRFSAPEVPAEVAKVLASGNWTPES------PSPACQCSRPGARRLLPDCPAAAGGPPPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELWALLSPLPGGALD-------------RVLKNLTAWAH-SLDAQDSLKIWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHAHSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELF--SDQKLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQA---MADAFERLGDRQFQSPLRWEVVGKNLLAMVIQGPLFLLFTLLLQH---RSQLLPQPRVRSL--PLLGEEDEDVARERERVVQGATQGDVLVLRNLTKVYR 1803          

HSP 2 Score: 169.474 bits (428), Expect = 2.464e-41
Identity = 98/318 (30.82%), Postives = 157/318 (49.37%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + NL K+Y   ++P ++ L L     +    LG NGAGKT+T  ++TG    S G A +    +  E  +    +G CPQ + +F+ LT  +H+     L+ + + ++       +  + L+   +  +   SGG KRKL+ A+A +G+  VVFLDEPT G+DP ARR +W+ L+      R+++LT+H M+E + L  R+AI+  G+ +C GS   LK +F  G+ L+L         +         FV      A + E    +    LP     +     +F  L  H AE  +  + +S T LEEVFL  + D
Sbjct: 1795 LRNLTKVYRGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQPAA-------AFVAAEFPGAELREAHGGRLRFQLPPGGRCA--LARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKD 2103          

HSP 3 Score: 70.8626 bits (172), Expect = 2.771e-11
Identity = 34/80 (42.50%), Postives = 45/80 (56.25%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQ 264
             QL  LLWKNF  +RR+   LL+EL  PL + FIL AVR S    +   C F  K + S G +P+L   +C  N +C+ Q
Sbjct:    5 TQLMLLLWKNFMYRRRQPVQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLICNVNNTCFPQ 84          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA4 (ATP binding cassette subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:34])

HSP 1 Score: 725.317 bits (1871), Expect = 0.000e+0
Identity = 502/1681 (29.86%), Postives = 850/1681 (50.57%), Query Frame = 1
Query:  523 LGEIICGSPE--------------NDFKLFMRNFIKNQRR-------KRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLR--------LASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYN----------IKSSESIPLMRNNNQNCEINHQAF-ESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXX--------------------------------XILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLI-------NKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQK-----QSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMV-----------SPECDCSK----TGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSR-----------KIFGGYQF--LLPNDFAQSSKLIAQSPTWDGIRDSVNQ--SQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF--------NNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRT 5124
            L +++CG PE              N++K F+   I + R+       +R+   C  + QS   N + K   +    PL+ GK+ Y P+    R+I++ AN TF+ L+++R        +    W     +  ++ I + +    VK F            +A+         +S  D ++  F W             + + L C  LD+F   +S  D  +LT ++        F A ++F + + + T      + Y+IR+ +  ++ T K K  DR+W   PR +   DF+Y+  GF +LQ+ ++Q         E+  VG  +  MPYPC++ D F+  L    P  +V+AW  SV++ +KSIV EKE RLKE +K  G++N V W +WF+ +  ++ + + ++++ +   +I   S   ++F  +  +  + I   F++S FFSKA++A+   G++YFT Y+  ++    +  ++  +  +  LLS VAF    ++++ +E+   G+Q+SN+  +P E   F     + +M++D+ +Y L+ WY++ VFPG YG   PW FL   SYW+            ++ +E +     + ++ E  H +F E E      G+ + NLVK++     P ++ LN+ FYE+QITAFLGHNGAGKTTT+SILTG+  P+SGT  +   DI T +D++RQ +G+CPQ+N+LF  LTV +H+ FY  LK   + E +  +  +++D  L  K N  +  LSGGM+RKLS+A+AF+G+++VV LDEPT+GVDP++RR IWDLL+KYRS  RTII++THHMDEAD L DR+AII+QG+L C G+ +FLK  FG G YL+L++   N  +  +  E                                 ++  V  ++ +A+++E    +   +LP  +   R +  LF+ L++ +A++ + S+G+SDT LEE+FLKV +D  +  +        +E     + C   + K       + +     P          +       L  G  L+ Q + AL +KR+ +  R  K FLA+++LP   +   ++   +     +   + + PW+   +       TF+  +         L     +  G  G RC+      L  Y C   N     +P+   +I  +           SP C CS     T    C +  +GG P   R   S++ L +LT  NISD+L+K +  L R           + +GG      LP        L+        I +      ++  + E   FLK+ +        T +  ++W N+KG+ ++ ++ N+  N +LR+ +   ++   YGI+V + P+  ++ ++S+   L   ++  +AI VI ++SF+ ASFV++LI ER++ SK  QF+SG++P  YWV+NFLWDIM Y +   +++ IFI F  ++Y   +N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TFIL++ E+     R  N +L+K+ ++FP + LGRG+IDL+   +   +TD YA++      + F W++  + L ++++              GV+  +L  +++  +F          +    ED D++ E+ R+ +     D+L++  LTKIY  T
Sbjct:  319 LSDLLCGYPEGGGSRVLSFNWYEDNNYKAFLG--IDSTRKDPIYSYDRRTTSFCNALIQSLESNPLTKI-AWRAAKPLLMGKILYTPDSPAARRILKNANSTFEELEHVRKLVKAWEEVGPQIWYFFDNSTQMNMIRDTLGNPTVKDFLNRQLGEEGITAEAILNFLYKGPRESQADDMAN-FDWRDIFNITDRTLRLVNQYLECLVLDKF---ESYNDETQLTQRALSLLEENMFWAGVVFPDMYPW-TSSLPPHVKYKIRMDIDVVEKTNKIK--DRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGITRSQVQAEA-PVGIYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMSMSIFLLTIFIMHGRILHYSDPFILFLFLLAFSTATIMLCFLLSTFFSKASLAAACSGVIYFTLYLPHILCFAWQDRMTAELKKAVSLLSPVAFGFGTEYLVRFEEQGLGLQWSNIGNSPTEGDEFSFLLSMQMMLLDAAVYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEPLTEETEDPEHPEGIHDSFFEREHPGWVPGVCVKNLVKIFEPCGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLVGGRDIETSLDAVRQSLGMCPQHNILFHHLTVAEHMLFYAQLKGKSQEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLLKYRS-GRTIIMSTHHMDEADLLGDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVNPRHPCLGPREKAGQTPQDSNVCSPGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWIYGQQY------TFFSMDEPGSEQFTVLADVLLNKPG-FGNRCLKEGW--LPEYPC--GNSTPWKTPSVSPNITQLFQKQKWTQVNPSPSCRCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPVVPITGEALVGFLSDLGRIMNVSGGPITREASKEIPDFLKHLE--------TEDNIKVWFNNKGWHALVSFLNVAHNAILRASLPKDRSPEEYGITVISQPLNLTKEQLSEITVLTTSVDAVVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFENNRTLLR-FNAVLRKLLIVFPHFCLGRGLIDLA---LSQAVTDVYARFGEEHSANPFHWDLIGKNLFAMVV-------------EGVVYFLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQRIITGGNKTDILRLHELTKIYPGT 1950          

HSP 2 Score: 190.274 bits (482), Expect = 1.263e-47
Identity = 105/310 (33.87%), Postives = 164/310 (52.90%), Query Frame = 1
Query: 1966 VGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            +G  +  M+++  +Y L+T  V+  F           FL   S W   I      P++  ++   E   +       N    + +H L K+YP    P ++ L +     +    LG NGAGKTTT  +LTG  + +SG A +  + I T +  + Q +G CPQ++ + + LT  +H+Y Y  L+ +   EIE V    IK + LT   + L+   SGG KRKLS A+A IG   +V LDEPT G+DP ARR +W++++      R ++LT+H M+E + L  R+AI+ +G  +C G++  LK KFG+GY
Sbjct: 1875 IGKNLFAMVVEGVVYFLLTLLVQRHF-----------FL---SQW---IAEPTKEPIVDEDDDVAEERQRIITGG--NKTDILRLHELTKIYPGTSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTNISEVHQNMGYCPQFDAIDELLTGREHLYLYARLRGVPAEEIEKVANWSIKSLGLTVYADCLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNVIVSIIREGRAVVLTSHSMEECEALCTRLAIMVKGAFRCMGTIQHLKSKFGDGY 2165          

HSP 3 Score: 57.7658 bits (138), Expect = 2.641e-7
Identity = 26/77 (33.77%), Postives = 42/77 (54.55%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            Q++ LLWKN+ L++R+    ++EL  PL +  +L  +R++   Y    C F  K M S G +P+L    C  N  C+
Sbjct:    6 QIQLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNANPLYSHHECHFPNKAMPSAGMLPWLQGIFCNVNNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA12 (ATP binding cassette subfamily A member 12 [Source:HGNC Symbol;Acc:HGNC:14637])

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 472/1547 (30.51%), Postives = 792/1547 (51.20%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---------RLHFQTFLLDYISN---NVFINDVKKFCKAYYSANP-KICDAVNTL-FNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIF----NETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP-----------LMRNNNQNCEINH---QAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLK--RMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXX--XXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDIN-SRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-NKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHL------LKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISL-GLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVS-PECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQ-NSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVG--SITTMS-TFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYA-KYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSY--FN-NKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIY 5115
            ++  L P++ G++ Y P   + + I+EK+N+T + L  LR  S EW           H     +  + N   N F+    KF     +    K  D ++ L   + N    ID ++ L S      +C   DR   + + K ID++  ++ R          +IF    N ++         FL     Y IR+ L    +T   +   + W P P  N+ +  +     FI+LQ++I++A IEL T   S E+   +  +PYPC++ D FL  ++  LP +L++AW   +   +K +VYEK+ RL EYMK+MG+N+  H+ +W I ++  L++ +VI+ + L+   I   ++  ++F     Y  S I  ++++SVFF+  N+A++ G ++Y   +  F+V + +E ELS  +     LLS  AFS A +++  +E+   G+Q+ N++ +P +      G    L++ DSFIY LI WYV  VFPG YG+A PW F    SYW      +E  P           +M+N N +    +      E EP++L +G+++H + K+Y S     ++NLNLNFYE  IT+ LG NGAGKTTTIS+LTG+F  S+GT ++  +DI+T++ ++R+ +G+C Q++VLF  LT ++H+  YG +K     K ++   + R +KD  L    +     LSGGMKRKLSI++A IG SRVV LDEP+ GVDP +RR IWD++ K ++  RTIIL+THH+DEA+ LSDR+A + QG L+CCGS  +LK  FG+GY+L+L K ++   ++N+  +   +   ++ ++ +A + E+   +   VLP      S  +  L + LD  M +++I  YG+SDT++EEVFL +  +   N  ++ E          L  K   N+    I    +     S F D+ D +      L GF LL ++I+A+ IKR+H+ +R++KG +A++ILP++ +   +    +         +QISP L     G      FY   + S   L++ +      D       C+N S     + QC  ++    W+ +     P+ +   C CS+   Q C       P   +R   SS  + NLTG  + +YL+       +K +GG+ F LP         + +   +D      N++                           +++W + +GY S+PAY N L+N LL  R+ +S+ ++  +GI + ++P    + +  Q     L+++ +A+ +++  S  +ASFV +++ E  + +K+ Q +SGI    YWV+NF++D++ Y++P+   I I   F   ++    N  A  LLL+ +G A    MY  +        AF+     NL  G  SI ++S  + L   +  D T    +E LK++FLIFPQ+  G G+I+LS      +    Y  +Y    +E+   KL ++ +  +    +   + R +IN  L + L++ +  FN + +++T  ED D+  E+ R+ S     D++Q+  LTK Y
Sbjct:  479 IWAFLKPMLLGRILYAPYNPVTKAIMEKSNVTLRQLAELREKSQEWMDKSPLFMNSFHLLNQAIPMLQNTLRNPFVQVFVKFSVGLDAVELLKQIDELDILRLKLENNIDIIDQLNTLSSLTVNISSCVLYDR---IQAAKTIDEMEREAKRLYKSNELFGSVIFKLPSNRSWHRGYDSGNVFLPPVIKYTIRMSLKTAQTTRSLRT--KIWAPGPH-NSPSHNQIYGRAFIYLQDSIERAIIELQTGRNSQEIAVQVQAIPYPCFMKDNFLTSVSYSLPIVLMVAWVVFIAAFVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLIESVGFLLVTIVILIIILKFGNILPKTNGFILFLYFSDYSFSVIAMSYLISVFFNNTNIAALIGSLIYIIAFFPFIVLVTVENELSYVLKVFMSLLSPTAFSYASQYIARYEEQGIGLQWENMYTSPVQDDTTSFGWLCCLILADSFIYFLIAWYVRNVFPGTYGMAAPWYFPILPSYWKERFGCAEVKPEKSNGLMFTNIMMQNTNPSASPEYMFSSNIEPEPKDLTVGVALHGVTKIYGSKV--AVDNLNLNFYEGHITSLLGPNGAGKTTTISMLTGLFGASAGTIFVYGKDIKTDLHTVRKNMGVCMQHDVLFSYLTTKEHLLLYGSIKVPHWTKKQLHEEVKRTLKDTGLYSHRHKRVGTLSGGMKRKLSISIALIGGSRVVILDEPSTGVDPCSRRSIWDVISKNKT-ARTIILSTHHLDEAEVLSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKKKSPNLNANAVCDTMAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDNGMGDLNIGCYGISDTTVEEVFLNLTKESQKNSAMSLEH---------LTQKKIGNSNANGISTPDDLSVSSSNFTDRDDKILTRGERLDGFGLLLKKIMAILIKRFHHTRRNWKGLIAQVILPIVFVTTAMGLGTLRNSSNSYPEIQISPSL----YGTSEQTAFYANYHPSTEALVSAMW-----DFPGIDNMCLNTS-----DLQCLNKDSLEKWNTSG---EPITNFGVCSCSEN-VQECPKFNYSPP---HRRTYSSQVIYNLTGQRVENYLISTANEFVQKRYGGWSFGLP---------LTKDLRFDITGVPANRT--------------------------LAKVWYDPEGYHSLPAYLNSLNNFLL--RVNMSKYDAARHGIIMYSHPYPGVQDQ-EQATISSLIDILVALSILMGYSVTTASFVTYVVREHQTKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAFSIGIIAIFKLPAFYSENNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELSQQQSVLDFLKAYGVEYPNETFEM--NKLGAMFVALVSQGTMFFSL-RLLINESLIKKLRLFFRKFNSSHVRETIDEDEDVRAERLRVESGAAEFDLVQLYCLTKTY 1945          

HSP 2 Score: 177.178 bits (448), Expect = 1.265e-43
Identity = 107/324 (33.02%), Postives = 177/324 (54.63%), Query Frame = 1
Query: 2212 ISIHNLVKLYP--SNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIR-TEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTE-KINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + ++ L K Y     KI  +NN+++     +    LG NGAGKTT   +LTG   PSSG   I N+      +DS    +G CPQ + L D +TVE+H+YFY  +  + + +I+  + ++++ + L   K  A SM  S G KRKLS A+A IG   ++ LDEP++G+DP ++R +W ++ +   +  ++ILT+H M+E + L  R+AI+  GK QC GSL  +K +FG G+ + +    N  +         L F K Y+ D  +   S L++ +      + +     +F  L+ +   ++I ++ +S T+LEEVF+  A D
Sbjct: 1936 VQLYCLTKTYQLIHKKIIAVNNISIGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKETVHKLLRRLHLMPFKDRATSM-CSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKRHLWKIISEEVQNKCSVILTSHSMEECEALCTRLAIMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTMETLTKFMQLHFPKTYLKDQHL---SMLEYHV-----PVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2250          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA12 (ATP binding cassette subfamily A member 12 [Source:HGNC Symbol;Acc:HGNC:14637])

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 472/1547 (30.51%), Postives = 792/1547 (51.20%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---------RLHFQTFLLDYISN---NVFINDVKKFCKAYYSANP-KICDAVNTL-FNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIF----NETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP-----------LMRNNNQNCEINH---QAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLK--RMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXX--XXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDIN-SRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-NKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHL------LKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISL-GLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVS-PECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQ-NSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVG--SITTMS-TFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYA-KYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSY--FN-NKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIY 5115
            ++  L P++ G++ Y P   + + I+EK+N+T + L  LR  S EW           H     +  + N   N F+    KF     +    K  D ++ L   + N    ID ++ L S      +C   DR   + + K ID++  ++ R          +IF    N ++         FL     Y IR+ L    +T   +   + W P P  N+ +  +     FI+LQ++I++A IEL T   S E+   +  +PYPC++ D FL  ++  LP +L++AW   +   +K +VYEK+ RL EYMK+MG+N+  H+ +W I ++  L++ +VI+ + L+   I   ++  ++F     Y  S I  ++++SVFF+  N+A++ G ++Y   +  F+V + +E ELS  +     LLS  AFS A +++  +E+   G+Q+ N++ +P +      G    L++ DSFIY LI WYV  VFPG YG+A PW F    SYW      +E  P           +M+N N +    +      E EP++L +G+++H + K+Y S     ++NLNLNFYE  IT+ LG NGAGKTTTIS+LTG+F  S+GT ++  +DI+T++ ++R+ +G+C Q++VLF  LT ++H+  YG +K     K ++   + R +KD  L    +     LSGGMKRKLSI++A IG SRVV LDEP+ GVDP +RR IWD++ K ++  RTIIL+THH+DEA+ LSDR+A + QG L+CCGS  +LK  FG+GY+L+L K ++   ++N+  +   +   ++ ++ +A + E+   +   VLP      S  +  L + LD  M +++I  YG+SDT++EEVFL +  +   N  ++ E          L  K   N+    I    +     S F D+ D +      L GF LL ++I+A+ IKR+H+ +R++KG +A++ILP++ +   +    +         +QISP L     G      FY   + S   L++ +      D       C+N S     + QC  ++    W+ +     P+ +   C CS+   Q C       P   +R   SS  + NLTG  + +YL+       +K +GG+ F LP         + +   +D      N++                           +++W + +GY S+PAY N L+N LL  R+ +S+ ++  +GI + ++P    + +  Q     L+++ +A+ +++  S  +ASFV +++ E  + +K+ Q +SGI    YWV+NF++D++ Y++P+   I I   F   ++    N  A  LLL+ +G A    MY  +        AF+     NL  G  SI ++S  + L   +  D T    +E LK++FLIFPQ+  G G+I+LS      +    Y  +Y    +E+   KL ++ +  +    +   + R +IN  L + L++ +  FN + +++T  ED D+  E+ R+ S     D++Q+  LTK Y
Sbjct:  797 IWAFLKPMLLGRILYAPYNPVTKAIMEKSNVTLRQLAELREKSQEWMDKSPLFMNSFHLLNQAIPMLQNTLRNPFVQVFVKFSVGLDAVELLKQIDELDILRLKLENNIDIIDQLNTLSSLTVNISSCVLYDR---IQAAKTIDEMEREAKRLYKSNELFGSVIFKLPSNRSWHRGYDSGNVFLPPVIKYTIRMSLKTAQTTRSLRT--KIWAPGPH-NSPSHNQIYGRAFIYLQDSIERAIIELQTGRNSQEIAVQVQAIPYPCFMKDNFLTSVSYSLPIVLMVAWVVFIAAFVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLIESVGFLLVTIVILIIILKFGNILPKTNGFILFLYFSDYSFSVIAMSYLISVFFNNTNIAALIGSLIYIIAFFPFIVLVTVENELSYVLKVFMSLLSPTAFSYASQYIARYEEQGIGLQWENMYTSPVQDDTTSFGWLCCLILADSFIYFLIAWYVRNVFPGTYGMAAPWYFPILPSYWKERFGCAEVKPEKSNGLMFTNIMMQNTNPSASPEYMFSSNIEPEPKDLTVGVALHGVTKIYGSKV--AVDNLNLNFYEGHITSLLGPNGAGKTTTISMLTGLFGASAGTIFVYGKDIKTDLHTVRKNMGVCMQHDVLFSYLTTKEHLLLYGSIKVPHWTKKQLHEEVKRTLKDTGLYSHRHKRVGTLSGGMKRKLSISIALIGGSRVVILDEPSTGVDPCSRRSIWDVISKNKTA-RTIILSTHHLDEAEVLSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKKKSPNLNANAVCDTMAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDNGMGDLNIGCYGISDTTVEEVFLNLTKESQKNSAMSLEH---------LTQKKIGNSNANGISTPDDLSVSSSNFTDRDDKILTRGERLDGFGLLLKKIMAILIKRFHHTRRNWKGLIAQVILPIVFVTTAMGLGTLRNSSNSYPEIQISPSL----YGTSEQTAFYANYHPSTEALVSAMW-----DFPGIDNMCLNTS-----DLQCLNKDSLEKWNTSG---EPITNFGVCSCSEN-VQECPKFNYSPP---HRRTYSSQVIYNLTGQRVENYLISTANEFVQKRYGGWSFGLP---------LTKDLRFDITGVPANRT--------------------------LAKVWYDPEGYHSLPAYLNSLNNFLL--RVNMSKYDAARHGIIMYSHPYPGVQDQ-EQATISSLIDILVALSILMGYSVTTASFVTYVVREHQTKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAFSIGIIAIFKLPAFYSENNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELSQQQSVLDFLKAYGVEYPNETFEM--NKLGAMFVALVSQGTMFFSL-RLLINESLIKKLRLFFRKFNSSHVRETIDEDEDVRAERLRVESGAAEFDLVQLYCLTKTY 2263          

HSP 2 Score: 177.563 bits (449), Expect = 1.111e-43
Identity = 107/324 (33.02%), Postives = 177/324 (54.63%), Query Frame = 1
Query: 2212 ISIHNLVKLYP--SNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIR-TEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTE-KINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + ++ L K Y     KI  +NN+++     +    LG NGAGKTT   +LTG   PSSG   I N+      +DS    +G CPQ + L D +TVE+H+YFY  +  + + +I+  + ++++ + L   K  A SM  S G KRKLS A+A IG   ++ LDEP++G+DP ++R +W ++ +   +  ++ILT+H M+E + L  R+AI+  GK QC GSL  +K +FG G+ + +    N  +         L F K Y+ D  +   S L++ +      + +     +F  L+ +   ++I ++ +S T+LEEVF+  A D
Sbjct: 2254 VQLYCLTKTYQLIHKKIIAVNNISIGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKETVHKLLRRLHLMPFKDRATSM-CSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKRHLWKIISEEVQNKCSVILTSHSMEECEALCTRLAIMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTMETLTKFMQLHFPKTYLKDQHL---SMLEYHV-----PVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2568          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 387.111 bits (993), Expect = 4.463e-109
Identity = 233/620 (37.58%), Postives = 361/620 (58.23%), Query Frame = 1
Query: 1006 NCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLT------PKNTT----FLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQ 2835
             C  LDRF  +   K+++  TN         +   +T QY T        N T    F +Y+IR     +DST  F  +D    P+ R     D KY+  GF FLQE+ID+A +  +TN     +G      PYPC + D F   +A  +P  L++++     +L+K+IVYEKE ++KE M+ MGL + VH++SW + ++V+  I V+I+S+  +++KI   +   ++  V+  ++ S I  +   S  F+ AN+A+ +  +L+F F++ F + ++ +   S T      +L   A  +  K +  +  + E   +S+L++     L   V  C+I++++D+ ++L++ WY+ AV PG +GV +P  F     YW   +  +  +  + + + +   N  +F+SEP NL L + I+++ K+Y  N    ++ LNL  YE QIT  LGHNGAGKTTT+SIL G+++PSSGTA I   DIRT++  +R  +G+CPQ+NVLF  LTV + +  +  LK +  +E+ S +  I+  V LTEK N L+  LSGGMKR+L I +AFIG SR V LDEPTAGVD  AR+ IW LL + +   RTI+L+THHMDEAD LSDR+AI+SQ
Sbjct:  497 GCFLLDRFRFVTDEKELE--TN--------AVCLMDTHQYFTGIVFNIDSNATEFDGFTTYKIRHYPEMVDSTTSF--MDSKSNPFSRDKPLIDLKYITFGFSFLQESIDRAIMSELTNQTDANLGVYAQQEPYPCTVKDTF--NVALFMPLFLLISFIFPSALLVKNIVYEKEQKIKEQMRAMGLGDAVHFISWGLISLVLNFISVLIISIISKVAKIFDYTDYTLLLFVLILFLFSSIAMSIFFSTLFTNANIATAATCVLWFVFFIPFQL-LRTDRISSPTFNRISLILPPTAMGHCFKLLESFNAM-ERATWSDLWEMNNPVLGISVELCMIMLVVDTAVFLILAWYISAVAPGDFGVRQPLWFPFTLKYWAPGLYKNR-VEFVDDEHFDTIPNSDSFDSEPTNLTLAVHINSMSKVY-ENGTKALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQRNK-EGRTILLSTHHMDEADVLSDRIAILSQ 1097          

HSP 2 Score: 149.443 bits (376), Expect = 1.477e-35
Identity = 73/228 (32.02%), Postives = 134/228 (58.77%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRT-EMDSIR--QKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEG 2892
            + NL K Y + ++  +  ++      +    LG NGAGKTTT ++LT    P  G+  + N  I T     +R  Q++G CPQ++ L   L+  +++ FY  ++ +   +I+S++ R++  + L    N  +  LSGG +RKLS+A+A +    ++FLDEP+AG+DP +++ +W ++ +     + ++LT+H M+E + L  R+AI+ +G+++C G    LK K+G+G
Sbjct: 1767 VRNLAKAY-NPELLAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSDVRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGKAVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKG 1993          

HSP 3 Score: 103.605 bits (257), Expect = 1.302e-21
Identity = 92/356 (25.84%), Postives = 176/356 (49.44%), Query Frame = 1
Query: 3835 MTSSDKLNNLTGYNISDY-LLKNFQRLSRKI----FGGYQFLLPNDFAQSSKLIAQSP-TW-DGIRD-------------SVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFS---RIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIY----VILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIG-SKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLG----RGMI 4806
            + ++D++ +LTG N++ + L+  F +L+        GG+     N  AQS   I  S   W + I+D              +  + P+ L+P        +  N   + ++     ++W N+K +   P  +NILSN LLR     + +  + GI   N+P+  + ++    N L   +  LA++    ++L LS I A F ++L+++RI  +   Q V G+    YWV+++L+D++ Y + II+I++I++ F    +        AF+LL   +G++ I + Y F    S  + +FV++   +  VG +  ++  +L+ +   D +  P + +   VFL+ PQY+LG    RG++
Sbjct: 1304 LNTTDRIFDLTGRNLTQFRLITRFAQLANTTAPFFLGGFSLGHVNQRAQSQADIDTSKRGWLETIKDIAQSMRIINLNTTGIEPATPKVLDPFAQNITLNQVVNDLLQNLDVRENVKVWFNNKIWPGFPIASNILSNALLRQE-DYAIDPEDLGILTMNHPMNKTISQTLDQNALKFTQA-LAVFRITILLLVLSMIPAGFTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLGIAIFRGLM 1657          

HSP 4 Score: 60.8474 bits (146), Expect = 1.011e-8
Identity = 42/144 (29.17%), Postives = 66/144 (45.83%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITE-------IYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYI 438
            QL  LLWK   ++RR+   L +EL VP I+  I+  VR+         C +  K M+S G +PF+  F C+F+  C      N   T  +E H    +  E       I +++   +L     ++WI +NP +F  L    + I
Sbjct:    7 QLNFLLWKCVLVRRRQKFWLAVELIVPCILFIIIALVRTKDFSEASPQCHYDSKGMLSAGVLPFIHSFFCSFSNRC------NAAPTTGDEKHFLFNDDGEHTRNESIIVDAIYYSSLQ----LRWIGNNPKKFEDLTKGAAEI 140          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 386.726 bits (992), Expect = 6.616e-109
Identity = 233/620 (37.58%), Postives = 361/620 (58.23%), Query Frame = 1
Query: 1006 NCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLT------PKNTT----FLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQ 2835
             C  LDRF  +   K+++  TN         +   +T QY T        N T    F +Y+IR     +DST  F  +D    P+ R     D KY+  GF FLQE+ID+A +  +TN     +G      PYPC + D F   +A  +P  L++++     +L+K+IVYEKE ++KE M+ MGL + VH++SW + ++V+  I V+I+S+  +++KI   +   ++  V+  ++ S I  +   S  F+ AN+A+ +  +L+F F++ F + ++ +   S T      +L   A  +  K +  +  + E   +S+L++     L   V  C+I++++D+ ++L++ WY+ AV PG +GV +P  F     YW   +  +  +  + + + +   N  +F+SEP NL L + I+++ K+Y  N    ++ LNL  YE QIT  LGHNGAGKTTT+SIL G+++PSSGTA I   DIRT++  +R  +G+CPQ+NVLF  LTV + +  +  LK +  +E+ S +  I+  V LTEK N L+  LSGGMKR+L I +AFIG SR V LDEPTAGVD  AR+ IW LL + +   RTI+L+THHMDEAD LSDR+AI+SQ
Sbjct:  534 GCFLLDRFRFVTDEKELE--TN--------AVCLMDTHQYFTGIVFNIDSNATEFDGFTTYKIRHYPEMVDSTTSF--MDSKSNPFSRDKPLIDLKYITFGFSFLQESIDRAIMSELTNQTDANLGVYAQQEPYPCTVKDTF--NVALFMPLFLLISFIFPSALLVKNIVYEKEQKIKEQMRAMGLGDAVHFISWGLISLVLNFISVLIISIISKVAKIFDYTDYTLLLFVLILFLFSSIAMSIFFSTLFTNANIATAATCVLWFVFFIPFQL-LRTDRISSPTFNRISLILPPTAMGHCFKLLESFNAM-ERATWSDLWEMNNPVLGISVELCMIMLVVDTAVFLILAWYISAVAPGDFGVRQPLWFPFTLKYWAPGLYKNR-VEFVDDEHFDTIPNSDSFDSEPTNLTLAVHINSMSKVY-ENGTKALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQRNK-EGRTILLSTHHMDEADVLSDRIAILSQ 1134          

HSP 2 Score: 149.058 bits (375), Expect = 1.704e-35
Identity = 73/228 (32.02%), Postives = 134/228 (58.77%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRT-EMDSIR--QKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEG 2892
            + NL K Y + ++  +  ++      +    LG NGAGKTTT ++LT    P  G+  + N  I T     +R  Q++G CPQ++ L   L+  +++ FY  ++ +   +I+S++ R++  + L    N  +  LSGG +RKLS+A+A +    ++FLDEP+AG+DP +++ +W ++ +     + ++LT+H M+E + L  R+AI+ +G+++C G    LK K+G+G
Sbjct: 1804 VRNLAKAY-NPELLAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSDVRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGKAVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKG 2030          

HSP 3 Score: 103.219 bits (256), Expect = 1.472e-21
Identity = 92/356 (25.84%), Postives = 176/356 (49.44%), Query Frame = 1
Query: 3835 MTSSDKLNNLTGYNISDY-LLKNFQRLSRKI----FGGYQFLLPNDFAQSSKLIAQSP-TW-DGIRD-------------SVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFS---RIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIY----VILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIG-SKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLG----RGMI 4806
            + ++D++ +LTG N++ + L+  F +L+        GG+     N  AQS   I  S   W + I+D              +  + P+ L+P        +  N   + ++     ++W N+K +   P  +NILSN LLR     + +  + GI   N+P+  + ++    N L   +  LA++    ++L LS I A F ++L+++RI  +   Q V G+    YWV+++L+D++ Y + II+I++I++ F    +        AF+LL   +G++ I + Y F    S  + +FV++   +  VG +  ++  +L+ +   D +  P + +   VFL+ PQY+LG    RG++
Sbjct: 1341 LNTTDRIFDLTGRNLTQFRLITRFAQLANTTAPFFLGGFSLGHVNQRAQSQADIDTSKRGWLETIKDIAQSMRIINLNTTGIEPATPKVLDPFAQNITLNQVVNDLLQNLDVRENVKVWFNNKIWPGFPIASNILSNALLRQE-DYAIDPEDLGILTMNHPMNKTISQTLDQNALKFTQA-LAVFRITILLLVLSMIPAGFTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLGIAIFRGLM 1694          

HSP 4 Score: 60.8474 bits (146), Expect = 1.039e-8
Identity = 42/144 (29.17%), Postives = 66/144 (45.83%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITE-------IYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYI 438
            QL  LLWK   ++RR+   L +EL VP I+  I+  VR+         C +  K M+S G +PF+  F C+F+  C      N   T  +E H    +  E       I +++   +L     ++WI +NP +F  L    + I
Sbjct:   44 QLNFLLWKCVLVRRRQKFWLAVELIVPCILFIIIALVRTKDFSEASPQCHYDSKGMLSAGVLPFIHSFFCSFSNRC------NAAPTTGDEKHFLFNDDGEHTRNESIIVDAIYYSSLQ----LRWIGNNPKKFEDLTKGAAEI 177          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-4 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q9TXV8])

HSP 1 Score: 379.793 bits (974), Expect = 4.862e-107
Identity = 234/668 (35.03%), Postives = 372/668 (55.69%), Query Frame = 1
Query: 1234 PRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNES--IEVGSSMHI--MPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYY---SCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVA-KPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLY--------------PSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRM--DKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            P  N      Y   GF+ +Q A+D A  E++T  ++    +  S  +   P+P Y   K ++  A  +P +++ ++  SV  +++++V EKE RLKEYM+VMGL+ F++WV+ FI     L   V+++++ +    +   S + ++F  +  Y    +   FM+S F + A  A++   + +   Y  +  F  ++      + Y   +C +   +A +  ++ +  +E   +G+++  LF  P        GH +I +I+D  I +++TWY+EAV PG  GV  KPW F    SYW  N   S+++       Q    +H   E EP +L   I++ NL K Y               S +   ++NLNL  Y  Q T  LGHNGAGK+TT S+LTG+ SPSSG+AY+ + DIRT +  IR+++GLCPQYN LF  +TV +H+ F+  LK    D  E   +L R+  D     K + ++  LSGG KRKLS+A+A IG S VV LDEPT+G+DP AR   W  LI+     RTI+LTTH M+EAD L DR+AI++ G+L+CCGS +FLK+++G+GY+L+++ +  +  + ++  + I    + YI +A +      + T +L     +   F +LFK L+ H  +  I S+G+S T++EEVFLKV 
Sbjct:  256 PDDNDGGSPGYWQEGFMTVQRAVDVAITEIITGEDAQLTPLLDSYQVSRFPFPGYST-KIIEIGAFFMPVIVIFSFMTSVIYIVRAVVVEKEDRLKEYMRVMGLSQFINWVAHFIINYAKLTFAVIVLTILMHF--VALKSDMTLMFVFLMIYAFDVVYFAFMISSFMNSATSATLISVVFWMLLYFWYAFFSSIDQTNPYPLGYRLINC-INPDIALNYGLQLLAAYETQADGLKWGELFTPPSPDNNLTFGHALIALIVDGIIMIILTWYIEAVIPGGEGVPQKPW-FFVLPSYWFPN-SGSKTVDSSDQFQQIQYADHVKLEKEPTDLIPTINVVNLTKTYGTSFFKKLFDCKFGKSGEKRAVSNLNLKMYPGQCTVLLGHNGAGKSTTFSMLTGVASPSSGSAYVNDFDIRTSLPKIRREMGLCPQYNTLFGFMTVMEHLEFFAKLKERTWDPEEAREILARLRIDF----KADFMAGALSGGQKRKLSLAIALIGGSEVVMLDEPTSGMDPGARHETWT-LIQREKERRTILLTTHFMEEADLLGDRIAIMAHGQLECCGSPMFLKQQYGDGYHLTIVYDTTSTPDVSKTTDII----REYIPEAHVFSYIGQEATYLLSAT--HRPIFPKLFKELEDHQTQCGITSFGVSITTMEEVFLKVG 906          

HSP 2 Score: 159.844 bits (403), Expect = 7.404e-39
Identity = 99/325 (30.46%), Postives = 166/325 (51.08%), Query Frame = 1
Query: 2197 NLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            N K  +  +NLVK Y       +  +N +         LG NGAGKT+T  +LTG  S SSG AY+    ++          G CPQY+ +   ++ E+ +Y +  ++ + + +I   +  +I  + +    +      SGG KR+LS+ +A +G   V+ LDEPT+GVDP ARR IW++L + R     ++LT+H MDE + L   +AI+  GK +C GS   +K ++G GY L +     N +   ++       +K     + + EE  LQ    +P+   +   ++ LF+ L+     ++   Y LS T+LE+VF++ + D
Sbjct: 1445 NNKTALVSNNLVKWY--GNFNAVKGVNFHVNSKDCFGLLGVNGAGKTSTFQMLTGENSISSGDAYVNGWSVKNNWREAGANTGYCPQYDAIIKEMSGEETLYMFARIRGIPEKDIPKKVNAVIHAIGIGMYASRQIKTYSGGNKRRLSLGIAIVGLPDVLLLDEPTSGVDPKARRIIWNILNRLRDLGTALVLTSHSMDECEALCTELAIMVYGKFRCYGSCQHIKSRYGSGYTLLIRLKNRNDAEKTKST------IKQTFRGSVIKEEHVLQLNFDIPR---DGDSWSRLFEKLETVSTSLNWDDYSLSQTTLEQVFIEFSRD 1758          

HSP 3 Score: 70.8626 bits (172), Expect = 9.643e-12
Identity = 60/249 (24.10%), Postives = 118/249 (47.39%), Query Frame = 1
Query: 4060 LKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADS-ETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILL-LIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFL-IFPQYDLGR 4797
            L +    FN S+ ++   + + N+ G  + PA A   ++ ++ S+ +  Q    Y  +  N+P+  S +  +   N        +A  +I++ +   A +  FLI ER   SK  Q +SGI P+++W++ F+WD   ++I I+    IF  F+  +Y      +  + L  + YG   +P  Y F FF  +    F+++  Y++L G I +++  I+      D  +     +   +F  +FP Y++ +
Sbjct: 1080 LGFVPSMFNFSTVSVPSLKTFFNNFGLYT-PALAITFTDSMILSQKQKKQ----YSFTAVNHPLPPSTQDTLKNTNRSDGAAFLIAYGLIVSFAVCVAGYSQFLITERKKKSKHMQLLSGIRPWMFWLTAFIWDAAWFVIRILCFDAIFYIFNITAYTHDFGVMLILTLSFLLYGWTALPFTYWFQFFFESAPKGFMMVTMYHILTGMIGSIAVPIISQTSSLDAGY-----LWSIIFAWLFPTYNISQ 1318          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 219.164 bits (557), Expect = 5.594e-57
Identity = 139/434 (32.03%), Postives = 226/434 (52.07%), Query Frame = 1
Query: 2194 ENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLD--------------------QHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLL---------KGFPLLQQQIIALHIKRYHYAKRDF 3408
            +  +  I + NLVK++ +     ++ L+L     Q +  LGHNGAGK+TT S + GI  P++G   I   D+  E    R+ IG+CPQYN L+D LTV +H+     LK   + + +  + R++ DV L  K N  +++LSGGMKRKL + MA IG+S VV LDEPTAG+DP AR+ +  L+ + ++ +RTI+LTTH+MDEA+ L D V I+S GKL   G+  +LK+KFG GY   L    +++ +  +    +      Y+ +A   E    Q  I+LP+     ++F  LF+ L+                      +A + + S+GLS  +LE+VF+ + D     + +++ S  S+           NA++  +       Q  +K  D    L+          G   +  Q I++  K++ Y++R++
Sbjct:  527 DTARADIIVRNLVKIWSTTGERAVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVEREKA-NRTILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYL--LTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPE--ARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSR--------NASEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEKSGVAKMVAQFISIMRKKFLYSRRNW 947          

HSP 2 Score: 148.673 bits (374), Expect = 2.151e-35
Identity = 102/325 (31.38%), Postives = 170/325 (52.31%), Query Frame = 1
Query: 2209 GISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSH-DRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEES-----RLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             + I +L K +   +   +N L L   + +    LG NGAGKTTT +ILTG    SSG A I   D+ TE+ SI    G CPQ++ L   LT  + +     +   +  + ++ L  I++ V +    + L    SGG KRK+S+ +A +  ++++ LDEPTAG+DP ARR +W+LL+  R H +  ++LT+H MDE + L  R+A++++G L   GS   LK  +G  Y                  + +++ V+  + ++ +   S      L+W I   + D  S KF E+ + L +   ++ +  + L+ +SLEE FL++A
Sbjct: 1365 ALVIKDLTKTF--GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRDV-TELISI----GYCPQFDALMLDLTGRESLEILAQMHGFENYKAKAEL--ILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNY------TMTLSLYEPNQRDMVVQLVQTRLPNSVLKTTSTNKTLNLKWQIPKEKEDCWSAKF-EMVQALAK---DLGVKDFILAQSSLEETFLRLA 1670          

HSP 3 Score: 76.2554 bits (186), Expect = 2.023e-13
Identity = 50/177 (28.25%), Postives = 102/177 (57.63%), Query Frame = 1
Query: 4294 LLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIF-YGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFL-IFPQYDLGRGMIDLSS 4818
            L++V LA  +IL  + ++++FV+FLI+ER      QQF++GI+P  ++ ++ ++D + Y +  +I + +F+AF +       + LA ++L  F Y  + +P +Y  SF   +PS A V+L  + +++     ++ F++ +I + DE  +    IL  +F+ + P Y  G  +I +++
Sbjct: 1108 LIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLK---SILVNIFMFLLPSYAFGSAIITINT 1276          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 219.164 bits (557), Expect = 6.053e-57
Identity = 139/434 (32.03%), Postives = 226/434 (52.07%), Query Frame = 1
Query: 2194 ENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLD--------------------QHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLL---------KGFPLLQQQIIALHIKRYHYAKRDF 3408
            +  +  I + NLVK++ +     ++ L+L     Q +  LGHNGAGK+TT S + GI  P++G   I   D+  E    R+ IG+CPQYN L+D LTV +H+     LK   + + +  + R++ DV L  K N  +++LSGGMKRKL + MA IG+S VV LDEPTAG+DP AR+ +  L+ + ++ +RTI+LTTH+MDEA+ L D V I+S GKL   G+  +LK+KFG GY   L    +++ +  +    +      Y+ +A   E    Q  I+LP+     ++F  LF+ L+                      +A + + S+GLS  +LE+VF+ + D     + +++ S  S+           NA++  +       Q  +K  D    L+          G   +  Q I++  K++ Y++R++
Sbjct:  540 DTARADIIVRNLVKIWSTTGERAVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVEREKA-NRTILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYL--LTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPE--ARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSR--------NASEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEKSGVAKMVAQFISIMRKKFLYSRRNW 960          

HSP 2 Score: 148.288 bits (373), Expect = 2.373e-35
Identity = 102/325 (31.38%), Postives = 170/325 (52.31%), Query Frame = 1
Query: 2209 GISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSH-DRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEES-----RLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             + I +L K +   +   +N L L   + +    LG NGAGKTTT +ILTG    SSG A I   D+ TE+ SI    G CPQ++ L   LT  + +     +   +  + ++ L  I++ V +    + L    SGG KRK+S+ +A +  ++++ LDEPTAG+DP ARR +W+LL+  R H +  ++LT+H MDE + L  R+A++++G L   GS   LK  +G  Y                  + +++ V+  + ++ +   S      L+W I   + D  S KF E+ + L +   ++ +  + L+ +SLEE FL++A
Sbjct: 1378 ALVIKDLTKTF--GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRDV-TELISI----GYCPQFDALMLDLTGRESLEILAQMHGFENYKAKAEL--ILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNY------TMTLSLYEPNQRDMVVQLVQTRLPNSVLKTTSTNKTLNLKWQIPKEKEDCWSAKF-EMVQALAK---DLGVKDFILAQSSLEETFLRLA 1683          

HSP 3 Score: 76.2554 bits (186), Expect = 2.026e-13
Identity = 50/177 (28.25%), Postives = 102/177 (57.63%), Query Frame = 1
Query: 4294 LLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIF-YGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFL-IFPQYDLGRGMIDLSS 4818
            L++V LA  +IL  + ++++FV+FLI+ER      QQF++GI+P  ++ ++ ++D + Y +  +I + +F+AF +       + LA ++L  F Y  + +P +Y  SF   +PS A V+L  + +++     ++ F++ +I + DE  +    IL  +F+ + P Y  G  +I +++
Sbjct: 1121 LIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLK---SILVNIFMFLLPSYAFGSAIITINT 1289          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0306679)

HSP 1 Score: 422.55 bits (1085), Expect = 2.505e-121
Identity = 227/646 (35.14%), Postives = 380/646 (58.82%), Query Frame = 1
Query: 1264 YVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLS-----KITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSS--ESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMN 3180
            Y+  GF+ LQ ++  A++   +  + +     M   P+P Y+ D  L+ +++++  ++++++    T + K I  EKE +LKE MK+MGL+N++HW +WF+ + ++L I  +++++ ++++      +   ++   +   +  Y++S IC  FM++ FFS+A+ A+   G+++F  Y+ +   I    +LSL+      L+S  A    +K ++ +E   EG+Q+SN F          +G  +I+M++   IY++I  YVE V PG +GV +PWNF   R +W    + +  E IP    N    + + +AFE+EPE   +G+ + +L K +  NK+ V+  L++N +E +IT  LGHNGAGKTTTIS+LTG+F P+SGTA I   DIRT ++  R  +G+CPQ+NVLFD ++V +HI F+  +K +    +E  + + +K ++L +K N  S  LSGGMKRKLS+  A  G+++VV  DEP++G+DP ARR +WDLL + +   RT++LTTH MDEAD L DR+AI+  G+L+C G+  FLK+++G GY              +     +   +  YI   +   +   + +  LP  D  S KF E+F  L++   E+ +  YG+  TS+EEVF+KV  +  N
Sbjct:  220 YLREGFLPLQHSLSMAYLRQKSGEQDLP-NVVMKRYPFPAYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTGLIWFIAYIPYSFTINSYDDLSLSSKLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIP----NGHVEQRDPKAFETEPEGKHIGLQMRHLKKRF-GNKM-VVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQQEKV-GRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGY------RLICVKRDDCETNEVTALLNKYIPGLKPECDIGAELSYQLP--DSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDN 849          

HSP 2 Score: 176.792 bits (447), Expect = 7.466e-44
Identity = 101/324 (31.17%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGE----------------------GYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             +N ++L   E +    LG NGAGKTTT  ++TG    SSG AY+    + + M+SI + IG CPQ++ L D LT  + +  + +L+ + ++ I  +   + K     + I+  +   SGG KRKLS A+A IG+  V++LDEPT G+DP ARR +W+++ + R   ++I+LT+H M+E + L  R+AI+  G+ +C GS   LK KF +                      GY  +  +       S R+ + + +FV+    ++ + EE +   T  +P   +   K++ +F  ++ +  ++++  Y +S T+LEE+FL+ A
Sbjct: 1383 AVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGV---KWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1703          

HSP 3 Score: 81.2629 bits (199), Expect = 7.727e-15
Identity = 73/257 (28.40%), Postives = 127/257 (49.42%), Query Frame = 1
Query: 4093 SKTMNFSRI--WINSKGYASMPAYANILSNL----LLRSRIKLSQNSWNYGISVTNYPIA-DSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETF--RPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYN 4836
            + T+  S+I  W+N++   + P   N++ N     L  S +K         I VTN P+   + T +SQ +    L   LA  +   + F+S+ +++FLI ER S +K  QFV G+  + +W+S F+ D   YI+  +I++I  + F             + LLL+ +G A++P +Y  S F   P+T F  ++  N+  G    M+ FI+ ++  + E F  + T +IL  +F IFP + L   +  + +N    N
Sbjct: 1020 AATITESKITAWLNNQALHTAPLTVNMVHNAIADKLFGSSVK---------IQVTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCG----MALFIVVVVM-SSELFDTKDTADILGWIFRIFPHFSLAMSLNKVYTNTATRN 1262          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332489)

HSP 1 Score: 421.779 bits (1083), Expect = 3.187e-121
Identity = 227/646 (35.14%), Postives = 380/646 (58.82%), Query Frame = 1
Query: 1264 YVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLS-----KITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSS--ESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMN 3180
            Y+  GF+ LQ ++  A++   +  + +     M   P+P Y+ D  L+ +++++  ++++++    T + K I  EKE +LKE MK+MGL+N++HW +WF+ + ++L I  +++++ ++++      +   ++   +   +  Y++S IC  FM++ FFS+A+ A+   G+++F  Y+ +   I    +LSL+      L+S  A    +K ++ +E   EG+Q+SN F          +G  +I+M++   IY++I  YVE V PG +GV +PWNF   R +W    + +  E IP    N    + + +AFE+EPE   +G+ + +L K +  NK+ V+  L++N +E +IT  LGHNGAGKTTTIS+LTG+F P+SGTA I   DIRT ++  R  +G+CPQ+NVLFD ++V +HI F+  +K +    +E  + + +K ++L +K N  S  LSGGMKRKLS+  A  G+++VV  DEP++G+DP ARR +WDLL + +   RT++LTTH MDEAD L DR+AI+  G+L+C G+  FLK+++G GY              +     +   +  YI   +   +   + +  LP  D  S KF E+F  L++   E+ +  YG+  TS+EEVF+KV  +  N
Sbjct:  198 YLREGFLPLQHSLSMAYLRQKSGEQDLP-NVVMKRYPFPAYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTGLIWFIAYIPYSFTINSYDDLSLSSKLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIP----NGHVEQRDPKAFETEPEGKHIGLQMRHLKKRF-GNKM-VVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQQEKV-GRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGY------RLICVKRDDCETNEVTALLNKYIPGLKPECDIGAELSYQLP--DSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDN 827          

HSP 2 Score: 176.407 bits (446), Expect = 8.596e-44
Identity = 101/324 (31.17%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGE----------------------GYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             +N ++L   E +    LG NGAGKTTT  ++TG    SSG AY+    + + M+SI + IG CPQ++ L D LT  + +  + +L+ + ++ I  +   + K     + I+  +   SGG KRKLS A+A IG+  V++LDEPT G+DP ARR +W+++ + R   ++I+LT+H M+E + L  R+AI+  G+ +C GS   LK KF +                      GY  +  +       S R+ + + +FV+    ++ + EE +   T  +P   +   K++ +F  ++ +  ++++  Y +S T+LEE+FL+ A
Sbjct: 1361 AVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGV---KWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1681          

HSP 3 Score: 81.6481 bits (200), Expect = 7.384e-15
Identity = 73/257 (28.40%), Postives = 127/257 (49.42%), Query Frame = 1
Query: 4093 SKTMNFSRI--WINSKGYASMPAYANILSNL----LLRSRIKLSQNSWNYGISVTNYPIA-DSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETF--RPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYN 4836
            + T+  S+I  W+N++   + P   N++ N     L  S +K         I VTN P+   + T +SQ +    L   LA  +   + F+S+ +++FLI ER S +K  QFV G+  + +W+S F+ D   YI+  +I++I  + F             + LLL+ +G A++P +Y  S F   P+T F  ++  N+  G    M+ FI+ ++  + E F  + T +IL  +F IFP + L   +  + +N    N
Sbjct:  998 AATITESKITAWLNNQALHTAPLTVNMVHNAIADKLFGSSVK---------IQVTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCG----MALFIVVVVM-SSELFDTKDTADILGWIFRIFPHFSLAMSLNKVYTNTATRN 1240          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332488)

HSP 1 Score: 422.165 bits (1084), Expect = 3.448e-121
Identity = 227/646 (35.14%), Postives = 380/646 (58.82%), Query Frame = 1
Query: 1264 YVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLS-----KITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSS--ESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMN 3180
            Y+  GF+ LQ ++  A++   +  + +     M   P+P Y+ D  L+ +++++  ++++++    T + K I  EKE +LKE MK+MGL+N++HW +WF+ + ++L I  +++++ ++++      +   ++   +   +  Y++S IC  FM++ FFS+A+ A+   G+++F  Y+ +   I    +LSL+      L+S  A    +K ++ +E   EG+Q+SN F          +G  +I+M++   IY++I  YVE V PG +GV +PWNF   R +W    + +  E IP    N    + + +AFE+EPE   +G+ + +L K +  NK+ V+  L++N +E +IT  LGHNGAGKTTTIS+LTG+F P+SGTA I   DIRT ++  R  +G+CPQ+NVLFD ++V +HI F+  +K +    +E  + + +K ++L +K N  S  LSGGMKRKLS+  A  G+++VV  DEP++G+DP ARR +WDLL + +   RT++LTTH MDEAD L DR+AI+  G+L+C G+  FLK+++G GY              +     +   +  YI   +   +   + +  LP  D  S KF E+F  L++   E+ +  YG+  TS+EEVF+KV  +  N
Sbjct:  198 YLREGFLPLQHSLSMAYLRQKSGEQDLP-NVVMKRYPFPAYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTGLIWFIAYIPYSFTINSYDDLSLSSKLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIP----NGHVEQRDPKAFETEPEGKHIGLQMRHLKKRF-GNKM-VVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQQEKV-GRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGY------RLICVKRDDCETNEVTALLNKYIPGLKPECDIGAELSYQLP--DSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDN 827          

HSP 2 Score: 176.407 bits (446), Expect = 8.673e-44
Identity = 101/324 (31.17%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGE----------------------GYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             +N ++L   E +    LG NGAGKTTT  ++TG    SSG AY+    + + M+SI + IG CPQ++ L D LT  + +  + +L+ + ++ I  +   + K     + I+  +   SGG KRKLS A+A IG+  V++LDEPT G+DP ARR +W+++ + R   ++I+LT+H M+E + L  R+AI+  G+ +C GS   LK KF +                      GY  +  +       S R+ + + +FV+    ++ + EE +   T  +P   +   K++ +F  ++ +  ++++  Y +S T+LEE+FL+ A
Sbjct: 1361 AVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGV---KWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1681          

HSP 3 Score: 81.6481 bits (200), Expect = 6.691e-15
Identity = 73/257 (28.40%), Postives = 127/257 (49.42%), Query Frame = 1
Query: 4093 SKTMNFSRI--WINSKGYASMPAYANILSNL----LLRSRIKLSQNSWNYGISVTNYPIA-DSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETF--RPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYN 4836
            + T+  S+I  W+N++   + P   N++ N     L  S +K         I VTN P+   + T +SQ +    L   LA  +   + F+S+ +++FLI ER S +K  QFV G+  + +W+S F+ D   YI+  +I++I  + F             + LLL+ +G A++P +Y  S F   P+T F  ++  N+  G    M+ FI+ ++  + E F  + T +IL  +F IFP + L   +  + +N    N
Sbjct:  998 AATITESKITAWLNNQALHTAPLTVNMVHNAIADKLFGSSVK---------IQVTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCG----MALFIVVVVM-SSELFDTKDTADILGWIFRIFPHFSLAMSLNKVYTNTATRN 1240          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: CG6052 (gene:FBgn0036747 transcript:FBtr0075195)

HSP 1 Score: 384.03 bits (985), Expect = 1.387e-108
Identity = 224/648 (34.57%), Postives = 369/648 (56.94%), Query Frame = 1
Query: 1264 YVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIM--PYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITA------MSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLL-SQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEP--ENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNE-IESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            Y+  GF+ +Q A+  +++ L +      +  ++H+   PY  Y  D+ L  L  LLPF++++++    + + K +  EKE +LKE MK++G++N++HWV+WF+ + ++L++ VV + ++L + K  A       SS   V   +  YV++ +C  FM++V FSKA+ AS    I +F  Y+ +         LSL       L+ S  A    +  ++ WE   EG+ + N+F          + + I+ M   S +++ I  YVE VFPG+YGV + WNF+C ++YW   + S   +P  +       I H + +++      ++GI + NL K Y   K+  +  ++L  + ++IT  LGHNGAGKTTTI+++TGI  P+SGTA +   DIRT +   R+ +G+CPQ N+LF  ++V DHI F+  LK +   + +E+ + + +  + L +K    + +LSGGMKRKLS+  A  GN++VV  DEP++G+D   RR +WDLL +     RTI+LTTH+MDEAD L DR+AI+S+GKLQC G+  +LK++FG GY             S  +   + + ++ Y+   +       + T  LP     S+KF EL ++LD+  A++ ++ YGLS  +LE+VF+ V  D
Sbjct:  196 YIREGFLPIQHALTMSWLALASGVTDTGI-PAIHLQRFPYRAYTYDQLLSGLRQLLPFVILLSFIYPASTVTKYVTSEKELQLKEIMKLIGVHNWLHWVAWFVKSYIMLML-VVFLIMSLIMVKFYASVAVLTFSSWVPVLLFLHTYVVTSVCLCFMLAVLFSKASTASAVAAIFWFLTYIPYSFGYYYYERLSLMSKLLISLIFSNSALGFGIHVIVMWEGTGEGITWRNMFHPVSTDDSLTLFYIIMTMSFGSIMFISICLYVEQVFPGEYGVPRRWNFMCHKNYWRQYVPSLNIVPSFQT------ILHGSAKAKSCRRAREVGIQLFNLQKNY--GKLKAVKGISLKMHRNEITVLLGHNGAGKTTTINMITGIVKPTSGTAIVNGYDIRTHLAKARESLGICPQNNILFKEMSVRDHIIFFSKLKGIRGTKAVENEVGKYMTMLKLQDKSYVAAKNLSGGMKRKLSLCCALCGNAKVVLCDEPSSGIDAAGRRSLWDLL-QSEKDGRTILLTTHYMDEADVLGDRIAILSEGKLQCQGTSFYLKKRFGTGY------LLVCIMQSGCDVGAVTQLIRKYVPPIKPERVLGTELTYRLPTE--YSKKFAELLQDLDEKCAQLQLVGYGLSGATLEDVFMAVNTD 824          

HSP 2 Score: 157.147 bits (396), Expect = 6.260e-38
Identity = 100/335 (29.85%), Postives = 170/335 (50.75%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------XXXXXXXXXXXXXXILK---FVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             +  ++ +   ++    LG NGAGKT+T  +L G    +SG AYI   +I T    + +KIG CPQ++ LF+ LT  + +  Y LL+ + +  +  +   +       + ++  + H SGG +RKLS A++ +GN  V++LDEPT+G+DP ARR +W ++   R+  ++I+LT+H MDE + L  R+AI+  G+ +C GS+  LK +F +G  L +                                 Q      +   + ILK   F+   I DA + EE     T  +P    +S+  +++F+ L+ +  +++I  Y +  T LEE+FL  A
Sbjct: 1350 AVKAISFHVPHAECFGLLGINGAGKTSTFKMLAGDEKITSGEAYIDGTNISTH--KVYRKIGYCPQFDALFEDLTGRETLNIYCLLRGVQRRHVTPICWGLAISFGFAKHMDKQTKHYSGGNRRKLSTAISVLGNPSVLYLDEPTSGMDPAARRQLWQIIGLIRTAGKSIVLTSHSMDECEALCSRLAIMVDGEFKCLGSVQSLKNQFSKGLILKVKVKHKKKTFQRVVEDSSSSNDKKSISETDLKFLQMASVMESSQADRILKVNRFISKEIPDAELKEEYNGLITYYIP----HSKTLSKIFQLLETNSHKLNIEDYLIMQTRLEEIFLDFA 1678          

HSP 3 Score: 77.0258 bits (188), Expect = 1.866e-13
Identity = 70/248 (28.23%), Postives = 118/248 (47.58%), Query Frame = 1
Query: 4117 IWINSKGYASMPAYANILSNLLLRSRIKL-SQNSWNYGISVTNYPIADSE-TKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETF--RPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDG 4848
            +W+N+K   + P   N+L N L    IKL  Q++  Y   VTN P+  S+ T+  + N   +L   ++I + L + FI+A + I +I ER + +K  QF+SG++   YW S+ +WD + +++  +  I+   AF    YI   +   +  +L+ +G   I   Y  S   S  +T F  ++  N L+G+   +    L+      E F  +   E L   F + P Y L        S +I YN+  G
Sbjct:  994 VWLNNKPLHTAPLTLNLLHNAL---AIKLLGQDASTY---VTNEPLPYSDDTRTLRLNKGQVLGAEISINLSLTMCFITAFYAIPIIRERETRAKLLQFLSGVDVCAYWTSHIVWDYLVFVLSALSSILTIAAFKEIGYITPLDLSRYFYMLLIFGFPGIMLSYAASGCFSDAATGFTRISIINTLMGTGLFLMFMTLNF-----EAFQLKDVAEKLAWYFRLSPHYSLASST---HSIHIGYNIRRG 1227          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: CG42816 (gene:FBgn0261998 transcript:FBtr0307890)

HSP 1 Score: 276.944 bits (707), Expect = 6.248e-75
Identity = 196/593 (33.05%), Postives = 316/593 (53.29%), Query Frame = 1
Query: 1468 LIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRL----SKITAM--SSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKL---EGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQN--PGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESI-PLMRNNNQNCEINHQAFESEPENLKL----------GISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMN 3180
            L KSIV EKE +LK  + +MG+ + + WV+W+I T ++ +I   I+++  +L    S+I+ M  +  ++   V+       IC +F++S   S     S+   +     Y+ F++       EG L++ +        QV     V  +  WE   EG+Q+ NLF+   PG +L   VG+ +++MI+ SF+ LL+  Y+E + PG YGV +PW+F C R        S+ES+ P  R  N+   I   A + E  +L+L          G+ I  L K +   K+ V+ N++ + +E QIT  +GHNGAGKTT IS+L G  SP+SGTA I   DIR E    ++ IGLCPQ NVLF  L+   HI  +  L+ +   E++S +   +K ++L EK    + +LSGG +R+LS+A +  G  +V+  DEP+ G+DP ARR +W L+++ +    TI+LTTH +D+ + L DRV IIS G+L+C GSL FLK++                +    + E +   +  ++   +            LP +   S+ F+ LF++L+  M  + +  + LS  SLEE+F+    + +N
Sbjct:   82 LTKSIVEEKELQLKVTLNLMGVGSCLQWVAWYIQTFIIFLIGSSIITLFWKLVLPNSEISFMPFTHWSMALFVLLVLSHCTICFSFLMSSLISTTYRISLVTFLALIATYLPFLILHSKGCSEG-LNVFLSLFLLSGLQVL----VVGICMWEDYGEGLQWGNLFETSWPGGTL--SVGYILLVMILASFLSLLLCLYLEKIRPGPYGVPQPWHFPCTRCC------STESLLPYSRLFNRIFGIYSAAPDEERPDLQLIEPDPVDKIAGVQIRGLSKTF--GKMEVVKNVSFDMFEGQITVLMGHNGAGKTTLISMLAGFISPTSGTALINGFDIRQERRQAQRCIGLCPQQNVLFKHLSSVSHIQLFSRLRGLRGAEVKSEVQNYLKKLNLQEKKRLAARNLSGGTQRRLSVACSLCGGVKVLICDEPSTGLDPSARRELWRLILEAK-EGCTILLTTHQLDDGEVLGDRVVIISDGQLRCIGSLPFLKKQV------DASCLITCEARKRCDLEKLTSLISRHVGTIQPFSIKGRDVCYKLPLS--KSKYFSSLFRDLESQMNILGVRGFSLSSVSLEEIFMSFGAEDLN 650          

HSP 2 Score: 126.331 bits (316), Expect = 1.341e-28
Identity = 84/326 (25.77%), Postives = 158/326 (48.47%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINK 3195
            ++ + K Y  +++ V NN++     S     LG NGAGKTTT  ++ G  S   G  YI    +R + +   +++G CPQ +  F+ LT    +  + L+      ++     ++       + ++    + SGG KRK++ A+A   NS ++ LDEP+AGVDP +RR +W ++ +     + ++LT+H+MDE + L  +  I+  G +   GS+  +K K  +G     L       N       I   + +   +A + E+      +    +   S  ++E+F+ ++ + +   +  Y LS  SLE+ F ++A++   K  N+
Sbjct: 1138 VNGVSKKYGCDQLAV-NNISFALKPSHCVGLLGPNGAGKTTTFKMIVGEHSIDKGNIYISGYSMRMKRNKAMKELGYCPQSDSFFEFLTGRQLLKVFLLIWGFPSKDLNKRCEKLADQFGFRKHLDKKITYYSGGTKRKINAAVACGANS-LICLDEPSAGVDPASRRHVWTIINEVAQQGKAVLLTSHNMDEINALCSKSVILVDGSIYAMGSVQHVKNKIAKG-MTLKLVVNVQPDNMVAMLTKIEDDIYMTYPNAELKEKYEFSGRLTFQISKDTS--WSEIFEYVEGNRSSWHLEDYSLSQPSLEDAFEEIAEERRKKKSNQ 1458          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 853.203 bits (2203), Expect = 0.000e+0
Identity = 567/1727 (32.83%), Postives = 923/1727 (53.45%), Query Frame = 1
Query:  481 MSENETTIES-GYNELGEIICGSPE--------------NDFKLFMRNFIKNQRRKRSLLT------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSK-------LFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXX--------------------------------------XXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD-------------PMNKLINKEKSYYSYYCNILKMKLR---INATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPMV--------SPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQR-----LSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDG----IRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIK--------KTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLC 5208
            ++EN T   S  Y  +  I+CG PE              ++F+    N   +  +   +        C  + ++   + I +  ++  L PL+ GK+ Y P+    ++II + N TF+ L  LR     W    +  + +++ N+  ++ ++       +AN        T +++ +V S++   S+        F+W             I R + C  LD+  P+ +    +KL N+S      R F A I+F +      P N++ L    +Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ ++ + I  VT ++  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV ++IK +VYEKE+RLKE M++MGL+N + W SWFIS+++ L+I   ++ + L++  +   S   VVF  +  + +  I Q F++S  F++AN+A+  GGI+YFT Y+ +V+ +  +  +         LLS VAF    ++   +E+   G+Q++NLF +P E   + +  C+ILM  D+F+Y ++TWY+E VFPGQYG+ +PW F   +SYW     ++ +    + +N          E EP +LKLG+ I NLVK+Y   K   ++ L L F+E QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYI+ +DIR+E+ SIRQ +G+CPQ+NVLF  LTVE+HI+FY  LK + + E+++ + +I+ D  L  K  + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP+ARRGIWDLL+KYR+  RTI+L+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+                                          ++  + +  +   I + +  ++  ARM+E+   + T VLP     +  F ELF +LD  +A++ I SYG+SDT+LEE+FLKVA+D             P+ +   +  ++ + + + LK        +  ++E     +P+ K++ +L  SD    + +KG+ L +QQ +AL  KR  YA+R  KGF A+++LP + +   ++F  I     K   + ++PW+       E    F+ ++       +KL      D G  G RCM      + +  C   +E   WS    P SI++I           SP C+CS  G +     C     G PP   +I + ++ L NLTG NISDYL+K + +     L  KI      +GG+        A+S++++  +   D     +R+     +       RFLK    F N    T N  +IW N+KG+ S+ A+ N+++N +LR+ +   ++   +GI+  N+P+  ++ ++SQ   +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ PY+YW++NFLWD+  Y++P  ++I+IF+ F  ++Y+ + N     LLL+ YG +I P MYP SF    PSTA+VVL + N+L+G   ++STF++++  + +      N+ILK V LIFP + LGRG+ID+  N    +  + + +       +W++  + L ++ +              GV+  ++  +++  +F               ED D++ E+ R+ S     D+L++  LTK+Y R                    QK AV+ LC
Sbjct:  292 LTENATGSPSLMYQAVSRIVCGHPEGGGLKIKSLNWYEDSNFQALFGNHNDSDDQPVPVYDNTTTPYCNSMMRNMEASPISRM-IWRALKPLLMGKILYTPHSPATQKIIHEVNKTFQELGILRDLGGMWE-EARPKVWNFMENSNEMDLMRTLLLNNLTANFFSAQLAGTQWSVEDVISFLSKHSEDTRPQGTAFTWRDVFNETDQAIMSISRFMECVNLDKLEPVSTE---EKLVNESMSLLDNRKFWAGIVFLDI-----PSNSSELPPNVNYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDLRYIWGGFSYLQDVVEHSIIRAVTGSKE-KTGVYIQQMPYPCYVDDIFLRIMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLISAGLLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTAFARANLAAACGGIIYFTLYLPYVLCVAWQDYVGFAAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWNNLFSSPVEEDDYNLTTCLILMYFDAFLYGVMTWYIETVFPGQYGIPRPWYFPFTKSYWFGENSTNNTAIHGKKSNAGA----VCIEEEPTHLKLGVYIENLVKVYRHGKKLAVDGLTLGFHEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSSIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLSEEEVKAEMEQILSDTGLPHKRKSRTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRA-GRTILLSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEMLSDGTLPVRR--QRRHAFGADHQSCLKPLTEDDSFDCNESE----GDPESKETDYLSGSDGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALNPWMY------EEQFMFFSEDAPYDVSTHKLLRALFDDPG-FGTRCMKGE--SIPDAPCTMGDEE--WSTPEVPESIIEILTTRNWTMNDPSPACECSCNGKKKMLPECPAGAGGLPPPQIKI-SETETLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSL-----GARSTQVLPPAEEIDDAISRVREIFQLGKDSGSAADRFLKSLSAFIN-GLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRANLPPGKDPSEFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPYLYWLANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPSTAYVVLTSVNILIGINGSISTFVMELFGNHE--IGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLEWDMVGKNLFAMAV-------------EGVVFFIITVLIQYRFFFEPKSLCPKLSPIGEEDEDVARERQRIMSGAGQGDILELRQLTKVYKR-------------------KQKPAVDRLC 1942          

HSP 2 Score: 187.578 bits (475), Expect = 5.068e-47
Identity = 101/318 (31.76%), Postives = 176/318 (55.35%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            + +  L K+Y   + P ++ L +     +    LG NGAGKT+T  +LTG    + G A+I  + I  E+D + Q +G CPQ++ + D LT  +H+ FY +L+ + +NE+ +V    I+ + L + ++  +   SGG  RKLS A++ IG   VVFLDEPT G+DP ARR +W+ +       R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           +  + + + ++KF++  +  + + E+ R      LP +  +      +F  L ++   + I  Y +S T+L++VF+  A
Sbjct: 1921 LELRQLTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTKGEAFIAGKSILREIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPENEVCAVAEWGIRKLGLVKYVDKNAGSYSGGNMRKLSTAISLIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIILRVAGPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLPSSLTS---LAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFA 2230          

HSP 3 Score: 68.1662 bits (165), Expect = 1.221e-10
Identity = 34/80 (42.50%), Postives = 44/80 (55.00%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            IS QL  LLWKNF  +RR+   LL E+  PL + FIL AVR     Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    3 ISTQLGLLLWKNFTYRRRQTLQLLTEIVWPLFIFFILIAVRLYYPPYEQHECHFPNKAMPSAGTLPWIQGIVCNANNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca4a (ATP-binding cassette, sub-family A (ABC1), member 4a [Source:ZFIN;Acc:ZDB-GENE-050517-3])

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 535/1658 (32.27%), Postives = 848/1658 (51.15%), Query Frame = 1
Query:  619 CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWR---LHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTL-----------------------------FNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFP--GQYGVAKPW--NFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQA---------------------------FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXX-------------XXILKFVKIYIADARMME-------------------ESRL------QWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGES-------GIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMV------------------SPECDCSKTGNQ-----ICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQ-----NLEPLRFLKY-FQEF--FNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKT----EDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTF 5127
            C  + +    N + +  ++  + P + GK+ Y P+    RQII+ AN TF+ L+ LR     W        +F  D +  N+  + ++         NP + D +N                               F+  N+ +  D V +L   I R   C  LD+F    S+ D D+LT+++        F A ++F + + + T K    +  +IR+ +  ++ T K K  DR+W P PR +   D +Y+  GF +LQ+ I+   I+  T  E   +G  +  MPYPCY+ D F+  L    P  +V+AW  SV++ +KSIV EKE RLKE +K MG+ N V W +WFI T  ++     ++++ +   K+   S+  ++F  +  +  + I Q F++SVFF+KAN+A+   GI+YFT Y+  VV    +  ++  M     L+SQVAF    +++  +E+   G+Q+ N+  +  E   F   + II+M +D+ +Y ++ WY+++VFP  G+  V KP   N +        N  + E  P    + ++ +I  +                            FE EP  L  G+ + NL K++  +  P ++ L+L FYE QITAFLGHNGAGKTTT+S+LTG+F P+SGTAYI  +DIRT+MD+IR+ +G+CPQ+N++F  +TV +HI FY LLK     E +  +  +++D+ L  K N  + +LSGGM+RKLS+AMAF+G ++VVFLDEPT+GVDP++RR IWDLL+KYR   RT+IL+THHMDEAD LSDRVAIISQG+L CCGS +FLK   G G+YL+L++         R                   KF        R+ E                   E+RL      + T +LP      R +  LF+ L++ +A+M + S+G+SDTSLEEVFLKV  D     IN        + N         +    +   +    +Q          +KGF L+ +Q  AL IKR+H+  R  K FLA+++LP   +   ++F  I     +   + +SPW+   +       TF+  E        +++S      GE        G RCM      L+ Y C   N    W      ++P+V                  SP C CS T N+     +C +  +GG P   RI ++ D L +LTG NISDYL+K +  L R       ++    +   S +  + P  +    S+  +  Q     N+   R+ K    EF  F +  +T N  ++W N+KG+ +M A+ N+ +N +LR+ +    +   YGI+  N+P+  ++ ++S+   L   ++  +AI VI A+SF+ A FV++LI ER++ +K  QFVSG++P VYW +NF WD++ Y +   +++ IFIAFD + Y    N  A I LL+ YG ++ P MYP S+  + PSTA+V L+  NL +G  ++  TFILD+ + T+  ++  N++LKK  L+FP + LGRG+ID++ N     + D YA++      D F W+   E L  + +   +++         ++N ++     + ++ +  KK     ED D++ E+ R+      +D+LQ+ +L+K Y  TF
Sbjct:  370 CNDLMKDLESNPVTRI-VWRSVKPFLMGKILYAPDSPAARQIIKNANTTFEELERLRNMGRAWEEVGPQIWSFFQDSVQINMLRDSIR---------NPTVMDHINKGLRNAAFTGQHILNFLYSGPEEDREQDMPNFDWRNIFNLTDQVIRL---INRYGECLVLDKF---SSISDEDQLTHRALNLLEEGKFWAGLVFVDMYSWTT-KVPPHVKVKIRMDIDVVERTNKIK--DRYWDPGPRADPMDDLRYIWGGFAYLQDMIEHGIIKTHTGKE-WPLGVYLQQMPYPCYVDDLFMLTLNRCFPIFMVLAWVYSVSMTVKSIVLEKEMRLKETLKAMGVTNRVLWCTWFIDTFFMMASSTALLTLIIMGGKVLNYSNPIILFLFLLTFTTATIMQCFLMSVFFNKANLAAACSGIIYFTLYLPHVVCFAWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIQTSLLEGDEFSFLNSIIMMAVDTVLYGVLAWYLDSVFPVPGKPTVEKPAFDNLVNNTDDQAKNHTAPEKPPEPPGSCKHGDIREKLEREKLQKRIVEEEINRSMSTDSSGKVFFEPEPSGLVAGVCVENLYKVFSGSSRPAVDGLSLTFYEGQITAFLGHNGAGKTTTMSVLTGMFPPTSGTAYIYGKDIRTDMDAIRKSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLPEAQLEVENMLEDLGLPHKRNEEAQNLSGGMQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYR---RTLILSTHHMDEADLLSDRVAIISQGRLYCCGSPLFLKNCLGAGFYLTLVRRIKEQPAPVRKEGQCDCTDDCSCKCSLCTKFKASDTEKPRVSERQMEGNIESITALVHHHVPEARLIEVIGQELTFLLPSRAFKHRSYASLFRELEETLADMGLSSFGVSDTSLEEVFLKVTADGEAAHINTASDTDRSHAN-------GQSNSANVISKEGRGSQQ----------VKGFFLVVKQFFALLIKRFHHTTRSGKDFLAQIVLPASFVFISLMFTLIVPPFGEYPSLTLSPWMYGRQF------TFFSNE--------QMQSPDMRYFGEVLLNRPGFGTRCMVDE--PLEEYPC--NNITTEW------EMPLVNPMLIEMLSNSEWTDISPSPSCQCS-TPNKLTMLPVCPE-GAGGLPPPQRIQSTGDMLMDLTGRNISDYLVKTYPNLIRTSLKSKYWVNEQRYGGIS-VGGRLPVLNLDPKSIQNAAAQIGRLLNVTGGRYSKLALDEFATFLRYMETENNVKVWFNNKGWHAMVAFMNVANNAILRANLPPGVDLNEYGITAINHPLNLTKEQLSEVTVLTTSVDAVVAINVIFAMSFVPAGFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFFWDMINYSVSAAMVVGIFIAFDKKCYTSPGNLQALIALLMLYGWSVTPMMYPMSYIFNVPSTAYVSLSCINLFIGINSSAITFILDLFDSTEALYK-CNQVLKKALLVFPHFCLGRGLIDMAMNQA---VMDVYARFGEDFSLDPFSWDFVGENLTFMAVEGFVYF---------ILNILIQYRFFLDHWMSDFKKPPITDEDVDVAKERERIYKGGSSNDILQIKDLSKTYTGTF 1947          

HSP 2 Score: 168.318 bits (425), Expect = 3.669e-41
Identity = 114/406 (28.08%), Postives = 193/406 (47.54%), Query Frame = 1
Query: 1966 VGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLP------QNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            VG  +  M ++ F+Y ++   ++  F           FL    +W+ + K     P+   +    +   + ++    N  L   I +L K Y     P ++ + +     +    LG NGAGKTTT  +LTG    +SG A +    I T +  + Q +G CPQ++ + D LT  +H++ Y  L+ + ++EI  V    I+ + L+E     +   SGG KRKLS A+A IG   ++ LDEPT G+DP +RR +W+ ++      R ++LT+H M+E + L  R+AI+  G  +C G++  LK KFG+GY                    +     +  A+A M  ES     I         Q +I S    ++F+ +  +   ++I  Y +S T+L++VF+  A
Sbjct: 1871 VGENLTFMAVEGFVYFILNILIQYRF-----------FL---DHWMSDFKKP---PITDEDVDVAKERERIYKGGSSNDIL--QIKDLSKTYTGTFRPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVTSGEADVAGYSILTNILDVHQNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSEYAGCTAGTYSGGNKRKLSTAIAMIGCPALLLLDEPTTGMDPHSRRFLWNSIMSVIQGGRAVVLTSHSMEECEALCTRLAIMVNGTFKCLGTIQHLKYKFGDGY----------VVTMKIRAAKVGAVPDLNPAEAFM--ESTFPGCIQREKHYNTLQYEIASSSLAKIFQVVLANKEMLNIEDYSVSQTTLDQVFVNFA 2245          

HSP 3 Score: 58.9214 bits (141), Expect = 8.291e-8
Identity = 25/82 (30.49%), Postives = 46/82 (56.10%), Query Frame = 1
Query:   22 SNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQT 267
            ++Q+R LLWKN+ +++R+   L +E+  P+++   L  +R +   Y+   C F  K M S G +P++   +C  N  C+  T
Sbjct:    4 NSQVRLLLWKNWTVRKRQKTRLFMEIMWPVVLFIGLVWLRKANPLYRQHECHFPNKAMPSSGVLPWIQGIVCNANNPCFQHT 85          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:ZFIN;Acc:ZDB-GENE-030131-9790])

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 458/1574 (29.10%), Postives = 772/1574 (49.05%), Query Frame = 1
Query:  673 YNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---------RLHFQTFLLDYISNNVFINDVKKFCKAYYSAN-PKICDAVNTLFNITNV----KSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQ--SFRNFLAVIIFN---ETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTF---TDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP-------LMRNNNQNCEINHQA---------FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLK--RMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILK-FVKIYIADARMMEESRLQWTIVLPQ-NDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNEN--------NMWSPASILDIPMVSPECDCSK----TGNQI---------------CNDLRSGGPPNSY----RIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQF--LLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYP----IADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMST---FILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYA--------KYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVL--YRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 5118
            +  L P++ G++ Y P+  + R+I+ K+N +     +L+L + EW           +  T  L  + N++    V+ F +     +   +   +N   N+T +    K  +D ++ L   +    +C   DR+   +S  ++DK   +    R   A IIF    E    L P     + Y IR+ +  +  T      DR   P+  ++ +   T  +    GF++LQE+I++A IE+ T N        M   PYPCY  D++L  +A   P  L+++W   +   +K +V+E+E RL EYMK+MG+N   H+ +W I +   L++ V+I+++ L+   I   S   V+F  +  Y  S +  +F+VS FF K N+A +SG ++Y   +  F+V I LE  LS ++  +  L S   FS A +++  +E+  EG+Q+SN++ +P        G    L++IDS +Y +I  Y+  VFPG+YG+A PW F   +S+W          P       L  N  Q+    +++          E +   L +G+S++ L K Y   K   ++NLNL+FYE  +T+ LGHNGAGKTTT+S+LTG+F+P+ GT  +   D++  +D +R+++G+C QY+VLFD LT ++H+  Y  +K     K E++  + +I+ + D+    +     LSGGMKRKLSI++AFIG SR+V LDEPT GVDP +RR IWD++I+++  +RTIIL+THH+DEA+ LSDR+A + +G L+CCGS  +LK K  +GY L+L K      +  +     L+ F+  ++ DAR  +         LP     N+ ++  L  +LDQ++ ++ +  YG+SDT+LEEVFL++  D +     KE   +S   ++++  +   A++  +  + N      K     +  ++GF L  Q++IA+ +KR H+++RD+KG  ++++                      +P+      +++ MG              LG I       +SDL       ++P++Y +D    F+ N+N         M S   I  + M  P     K    TG+Q                C++     P   Y    +   SS  + NLTG NI +YLL       R  +GG++F   LP D              D +    N++                           S++W NS+G+ SMPAY N L+N  LRS +   +  + Y IS++++P    + D +  +       L+ + +A+ V+   S ++ASFVI+ + E  +GSKR Q +SGI+   YW+ NF +D+  Y+IP+++ +++  AF   ++   +N  A  LLL+ +G +  P MY  S        AF+     NL +   T +ST   + L  +   D++ +   + +  +FL+FPQ+  G G+++L+   ++  +  G+           D   W   S  L   I   L   +   ++    + R+    R    SY  N     ED D+  E+ R+       D+LQV +LTK+Y 
Sbjct:   21 WAFLKPMLLGQILYSPDTPMTREIMRKSNSSLHQFGDLKLYASEWIESSSYVLQSANILTQTLPILKNSLNSPFVQNFIRTQTGIDVSGMSATLNQFSNMTVLLEKNKFIMDQITTLSVLMMNLSSCVNFDRYRGFNSTDELDKQAEKLAQNRELYASIIFKLPKENSSSLPPN----IDYTIRMNIENVMRT------DRARNPFWVKDAYISATRTQRYSRGFVYLQESIERAIIEMQTGNAMDGPAVQMQAFPYPCYYKDEYLNSIAFAFPMALMISWVLFIAHFVKKLVHERELRLHEYMKMMGVNPISHFFAWLIESGAFLLVTVIILTIILKAGGILPRSDGFVLFLYLCDYGFSVLAVSFLVSSFFDKTNIAGLSGSLIYVISFFPFIVLIHLEDNLSFSVKSALSLFSPTCFSYASQYIARYEKQEEGIQWSNMYISPLAGDTSSFGWLCWLLLIDSLVYFIIGIYIRMVFPGKYGIAVPWYFPVTKSFWTDMFSCCSKTPKKIGRGLLFTNMMQDQSSMNKSKGKGSLVAKGEEDFSGLPVGVSLYGLTKTY--GKRNAVDNLNLSFYEGHVTSLLGHNGAGKTTTMSLLTGLFAPTVGTIEVYGMDMQMFIDDVRKEMGVCMQYDVLFDHLTTKEHLLLYAQIKAPHWTKQEVKEQVHKILMETDMHAHRHKRVGTLSGGMKRKLSISIAFIGGSRLVVLDEPTTGVDPCSRRSIWDIIIQHK-QERTIILSTHHLDEAEVLSDRIAFLERGGLKCCGSPFYLKDKLAKGYNLTLTKKVETADSKEKFDYEKLRDFIHSHLPDARQKDREMGDLVYALPPYTPQNASEYHSLLNSLDQNLDKLHLGCYGISDTTLEEVFLQLTRDDLEP---KESETWSVSESVIENDMF--ASRDSLSEDCNSMYLGEKASLTGNSTVRGFALGVQRVIAMLLKRVHHSRRDWKGLFSQVL----------------------LPV----LFVIAAMG--------------LGSI-------KSDLQHFPEIVLSPALYHVDEQYAFFSNQNPNTSRLVDTMMSYPGIDHVCMTDPTDPVCKGRPSTGSQTWVSGGNSSATFTTCKCSNQVQSCPAQGYDPPRKRCPSSQIVYNLTGVNIENYLLATANNFIRDRYGGWEFGKPLPIDLKM-----------DMLDVPANRT--------------------------LSKVWYNSEGHHSMPAYLNSLNNFFLRSSLP-PEKRYQYAISISSHPYPGQVQDEDLMVGG-----LVSILVALCVLTGYSIMTASFVIYEVQEHHTGSKRLQQISGISEPFYWIINFFYDMALYMIPVVLSVVMVAAFQLPAFTERQNLAAVTLLLVLFGFSTFPWMYLLSAMFKDTEMAFIGYVCINLFISVNTIISTSIIYFLGQLNQNDQSIQNIYQTMSNIFLVFPQFSFGNGLMELARVDMQVQILSGFGVDAYKNPFSMDVLGWMFISMFLQGFICFTLRLLLNKTLLR--KVRRLFCWKRNAVQSYSPN-----EDEDVLDERLRVGRGDASSDILQVNHLTKVYQ 1479          

HSP 2 Score: 169.474 bits (428), Expect = 1.478e-41
Identity = 103/338 (30.47%), Postives = 182/338 (53.85%), Query Frame = 1
Query: 2194 ENLKLG--------ISIHNLVKLYP--SNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTE--MDSIRQ--KIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            E L++G        + +++L K+Y   S ++  + +L++     +    LG NGAGKTTT  +LTG  SPS G+A I + D R    +D  R+   IG CPQ + L D LT E+H+YFY  ++ + K +I  V+  ++K + L    N  S   S G +RKLS A+A IGN +++ LDEP++G+DP ++R +W ++ +       ++LT+H M+E + L  R+AI+ +G+ +C GSL  +K +FG G+ + +     ++     +      F    + D      + +++ + +    + S     +F  L+ +   + I  + +S T+L+EVF+  A
Sbjct: 1455 ERLRVGRGDASSDILQVNHLTKVYQNFSKRVQAVKSLSVGIPAGECFGLLGVNGAGKTTTFKMLTGDISPSGGSAKIRDIDGRMVDIIDCRREGINIGYCPQVDALDDLLTGEEHLYFYARIRGISKRDISQVVNYLLKKLQLNYHRNNTSESYSCGTRRKLSTALALIGNPQILLLDEPSSGMDPRSKRHLWKIISEQVMGKCAVVLTSHSMEECEALCTRLAIMVKGQFRCLGSLQHIKNRFGSGFTVKMYLTGASYDVDMISNFMQQNFPGTCLKDN---HSNMVEYHVPVAPGGVAS-----IFSLLESNKTVLQIKHFSVSQTTLDEVFINFA 1784          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1a (ATP-binding cassette, sub-family A (ABC1), member 1A [Source:ZFIN;Acc:ZDB-GENE-031006-12])

HSP 1 Score: 583.563 bits (1503), Expect = 1.768e-174
Identity = 321/841 (38.17%), Postives = 492/841 (58.50%), Query Frame = 1
Query:  514 YNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSK-------LFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYY 2898
            Y  +  I+CG PE              N++K LF  N   +     S+        C  + +    + I +  ++  L PL+ GK+ Y P+    ++II + N TF+ L  LR     W    +  + +++ N+  ++ V+   +   SA         T + + +V  ++   S+        ++W             I R + C  LD+  P+    + ++L N+S R      F A I+F +  Q  T      ++Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ I+   I  +T ++  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV ++IK +VYEKE+RLKE M++MGL+N + W+SWFIS+++ L+I   ++ + L++  +   S   V++  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +         LLS VAF    ++   +E+   G+Q+SNL  +P +   + +   I LM+ DS +Y ++TWY+EAVFPGQYG+ +PW F   +SYW    K   +  +  N  +N E      E EP ++  G+ I NL+K+Y + K+ V + L L FYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYI  +DIRT++++IRQ +G+CPQ+NVLF  LTVE+HI+FY  LK +   +++S + +I+ D+ L  K  + S  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP+ARRGIWDLL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYY
Sbjct:  304 YQAVSRIVCGHPEGGGLKIKSLNWFEDNNYKALFGNNGNDSDSEPASVYDNSSTPYCNNLMKGLESSPISRM-IWRALKPLLMGKILYTPDTPATQRIIHEVNKTFQELGVLRDLGGMWE-EMRPKIWNFMENSEEMDLVRTLLQNNASARFFNAKLSGTEWRVEDVSRFLSKSSEDTRPHGTAYTWREVFNETDQAIQTISRFMECVNLDKLEPV---ANEERLVNKSMRLLDDRKFWAGIVFPD-MQSNTSDLPLNVNYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDLRYIWGGFTYLQDVIEHGIIRALTGSKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLISAALLVLILKMGNLLPYSDPGVIYLFLSSFAVVTIMQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQNYVGFGAKIVVSLLSPVAFGFGCEYFALFEEQGVGIQWSNLLSSPMQEDSYNLTTSICLMLFDSVLYAVMTWYIEAVFPGQYGIPRPWYFPFTKSYWCGE-KCGWTTSVPSNRKENAEA--VCIEEEPAHIDPGVYIENLMKIYSNGKVAV-DGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIQGKDIRTDLNAIRQNLGVCPQHNVLFSMLTVEEHIWFYARLKGLSAEKVKSEMEQIVMDLGLPHKRTSRSNQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYY 1130          

HSP 2 Score: 264.233 bits (674), Expect = 2.201e-70
Identity = 230/799 (28.79%), Postives = 388/799 (48.56%), Query Frame = 1
Query: 2977 YIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD------------PMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQ---NPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKL-----ESEYRSDLGESGIRCMNPSIYRLD----------NYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDK-LNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLP---NDFAQSSKLIAQSPTWDGIRDSVNQ-----SQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVI-----NRVLYRM-LKVSYFNNKIK--KTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLC 5208
            ++  AR++E+   + T VLP        F ELF  +D  + ++SI SYG+SDT+LEE+FLKVA+D            P  +  N+  ++  +   +         T+ +   N    +P+ +++ +LD +D    + +KG+ L +QQ +AL  KR  YA+R  KGF A+++LP + +   ++F  I        P    P L +     E   TF   +       N+L     +S   +D    G    + S    D          + +  + N N  WS    ++ P    EC C      +       G     +I  + D+ L NL+G NISDYL+K + ++  K      ++       F+  ++     P  D + D+++      S        RFL     F  +   T N  +IW N+KG+ S+ ++ N+++N +LR+ +    +   +GI+  N+P+  ++ ++S    +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P++YW++NF+WD+  YI+P  ++IIIF+ F  ++Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   ++STF+L++    +      N+ILK VFLIFP + LGRG+ID+  N    +  + + +        W++  + L ++ +              GVI       + YR  +K    + K+K    ED D++ E+ R+       D+L++  LTK+Y R                    QK AV+ LC
Sbjct: 1197 HVPTARLVEDLGHEITYVLPYESAKDGAFVELFHEIDDRLTDLSISSYGISDTTLEEIFLKVAEDCGVDAETSDGTLPARR--NRRHAFGDHQSCLKPF------TEDDFDFNDSEGDPESRETDWLDGADGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVP------PFGKYPSLALEPSMYEEQFTFISNDAPEDRHTNRLLDALKDSPAYTDQCTDGKNTASRSCPIKDGEWLVPEVTESIEAIFLNGN--WS----MENPSPLCECSCEGRKKMLPECPPGAGGLPPPQIKVTHDETLQNLSGRNISDYLVKTYAQIIGKSLKNKLWVNEFRYGGFSLGARNTQALPPGDELTDAISHIRSRFSLESGTAADRFLGSLSTFI-RGLDTNNNVKIWFNNKGWHSIGSFLNVMNNAVLRANLPPGLDRSKFGINAFNHPLNLTKEQLSHVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAI-------------EGVIFFSITVLIQYRFCIKARSLSTKLKPIGEEDEDVARERQRILGGGGQTDILELRQLTKVYKR-------------------KQKPAVDRLC 1940          

HSP 3 Score: 196.823 bits (499), Expect = 8.271e-50
Identity = 109/322 (33.85%), Postives = 181/322 (56.21%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESR--LQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + +  L K+Y   + P ++ L +     +    LG NGAGKT+T  +LTG    +SG AY+    + TE+D + Q +G CPQ++ + D LT  +H+ FY +L+ + + E+  V    I+ + L + ++  +   SGG  RKLS AMA IG   VVFLDEPT G+DP ARR +W+ ++      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK KFG+GY           + ++   E +++F++  +  + + E+ R  LQ+ +      + +R F  L KN +Q    + I  Y +S T+L++VF+  A D
Sbjct: 1919 LELRQLTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTSGEAYLAGNSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCKVADWGIRKLGLMKYVDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNKFGDGY-----TIILRVAGADPRLEPVMEFIERELPGSTLKEKHRNMLQYQLSSSLTSL-ARIFNILSKNKEQ----LHIEDYSVSQTTLDQVFVNFAKD 2230          

HSP 4 Score: 67.0106 bits (162), Expect = 2.905e-10
Identity = 32/80 (40.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            +S QL  LLWKNF  +RR+   LL+E+  PL + FIL +VR     Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    3 VSTQLGLLLWKNFTYRRRQTIQLLVEIIWPLFIFFILISVRLYYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1a (ATP-binding cassette, sub-family A (ABC1), member 1A [Source:ZFIN;Acc:ZDB-GENE-031006-12])

HSP 1 Score: 583.563 bits (1503), Expect = 1.768e-174
Identity = 321/841 (38.17%), Postives = 492/841 (58.50%), Query Frame = 1
Query:  514 YNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSK-------LFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYY 2898
            Y  +  I+CG PE              N++K LF  N   +     S+        C  + +    + I +  ++  L PL+ GK+ Y P+    ++II + N TF+ L  LR     W    +  + +++ N+  ++ V+   +   SA         T + + +V  ++   S+        ++W             I R + C  LD+  P+    + ++L N+S R      F A I+F +  Q  T      ++Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ I+   I  +T ++  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV ++IK +VYEKE+RLKE M++MGL+N + W+SWFIS+++ L+I   ++ + L++  +   S   V++  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +         LLS VAF    ++   +E+   G+Q+SNL  +P +   + +   I LM+ DS +Y ++TWY+EAVFPGQYG+ +PW F   +SYW    K   +  +  N  +N E      E EP ++  G+ I NL+K+Y + K+ V + L L FYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYI  +DIRT++++IRQ +G+CPQ+NVLF  LTVE+HI+FY  LK +   +++S + +I+ D+ L  K  + S  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP+ARRGIWDLL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYY
Sbjct:  304 YQAVSRIVCGHPEGGGLKIKSLNWFEDNNYKALFGNNGNDSDSEPASVYDNSSTPYCNNLMKGLESSPISRM-IWRALKPLLMGKILYTPDTPATQRIIHEVNKTFQELGVLRDLGGMWE-EMRPKIWNFMENSEEMDLVRTLLQNNASARFFNAKLSGTEWRVEDVSRFLSKSSEDTRPHGTAYTWREVFNETDQAIQTISRFMECVNLDKLEPV---ANEERLVNKSMRLLDDRKFWAGIVFPD-MQSNTSDLPLNVNYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDLRYIWGGFTYLQDVIEHGIIRALTGSKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLISAALLVLILKMGNLLPYSDPGVIYLFLSSFAVVTIMQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQNYVGFGAKIVVSLLSPVAFGFGCEYFALFEEQGVGIQWSNLLSSPMQEDSYNLTTSICLMLFDSVLYAVMTWYIEAVFPGQYGIPRPWYFPFTKSYWCGE-KCGWTTSVPSNRKENAEA--VCIEEEPAHIDPGVYIENLMKIYSNGKVAV-DGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIQGKDIRTDLNAIRQNLGVCPQHNVLFSMLTVEEHIWFYARLKGLSAEKVKSEMEQIVMDLGLPHKRTSRSNQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYY 1130          

HSP 2 Score: 264.233 bits (674), Expect = 2.201e-70
Identity = 230/799 (28.79%), Postives = 388/799 (48.56%), Query Frame = 1
Query: 2977 YIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD------------PMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQ---NPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKL-----ESEYRSDLGESGIRCMNPSIYRLD----------NYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDK-LNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLP---NDFAQSSKLIAQSPTWDGIRDSVNQ-----SQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVI-----NRVLYRM-LKVSYFNNKIK--KTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLC 5208
            ++  AR++E+   + T VLP        F ELF  +D  + ++SI SYG+SDT+LEE+FLKVA+D            P  +  N+  ++  +   +         T+ +   N    +P+ +++ +LD +D    + +KG+ L +QQ +AL  KR  YA+R  KGF A+++LP + +   ++F  I        P    P L +     E   TF   +       N+L     +S   +D    G    + S    D          + +  + N N  WS    ++ P    EC C      +       G     +I  + D+ L NL+G NISDYL+K + ++  K      ++       F+  ++     P  D + D+++      S        RFL     F  +   T N  +IW N+KG+ S+ ++ N+++N +LR+ +    +   +GI+  N+P+  ++ ++S    +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P++YW++NF+WD+  YI+P  ++IIIF+ F  ++Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   ++STF+L++    +      N+ILK VFLIFP + LGRG+ID+  N    +  + + +        W++  + L ++ +              GVI       + YR  +K    + K+K    ED D++ E+ R+       D+L++  LTK+Y R                    QK AV+ LC
Sbjct: 1197 HVPTARLVEDLGHEITYVLPYESAKDGAFVELFHEIDDRLTDLSISSYGISDTTLEEIFLKVAEDCGVDAETSDGTLPARR--NRRHAFGDHQSCLKPF------TEDDFDFNDSEGDPESRETDWLDGADGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVP------PFGKYPSLALEPSMYEEQFTFISNDAPEDRHTNRLLDALKDSPAYTDQCTDGKNTASRSCPIKDGEWLVPEVTESIEAIFLNGN--WS----MENPSPLCECSCEGRKKMLPECPPGAGGLPPPQIKVTHDETLQNLSGRNISDYLVKTYAQIIGKSLKNKLWVNEFRYGGFSLGARNTQALPPGDELTDAISHIRSRFSLESGTAADRFLGSLSTFI-RGLDTNNNVKIWFNNKGWHSIGSFLNVMNNAVLRANLPPGLDRSKFGINAFNHPLNLTKEQLSHVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAI-------------EGVIFFSITVLIQYRFCIKARSLSTKLKPIGEEDEDVARERQRILGGGGQTDILELRQLTKVYKR-------------------KQKPAVDRLC 1940          

HSP 3 Score: 196.823 bits (499), Expect = 8.271e-50
Identity = 109/322 (33.85%), Postives = 181/322 (56.21%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESR--LQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + +  L K+Y   + P ++ L +     +    LG NGAGKT+T  +LTG    +SG AY+    + TE+D + Q +G CPQ++ + D LT  +H+ FY +L+ + + E+  V    I+ + L + ++  +   SGG  RKLS AMA IG   VVFLDEPT G+DP ARR +W+ ++      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK KFG+GY           + ++   E +++F++  +  + + E+ R  LQ+ +      + +R F  L KN +Q    + I  Y +S T+L++VF+  A D
Sbjct: 1919 LELRQLTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTSGEAYLAGNSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCKVADWGIRKLGLMKYVDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNKFGDGY-----TIILRVAGADPRLEPVMEFIERELPGSTLKEKHRNMLQYQLSSSLTSL-ARIFNILSKNKEQ----LHIEDYSVSQTTLDQVFVNFAKD 2230          

HSP 4 Score: 67.0106 bits (162), Expect = 2.905e-10
Identity = 32/80 (40.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            +S QL  LLWKNF  +RR+   LL+E+  PL + FIL +VR     Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    3 VSTQLGLLLWKNFTYRRRQTIQLLVEIIWPLFIFFILISVRLYYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 862.833 bits (2228), Expect = 0.000e+0
Identity = 615/1916 (32.10%), Postives = 965/1916 (50.37%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY---------------DQTQINWL-------------GTNLNEFHVFIGNI------------------------------------TEIYNSLPSGALNVPK--------FMKWITSNPNEFIR-----LQNSFSYISKRIVPLISTV---NKVM---SENETTIESG-YNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT--------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---RLHFQTFL-----LDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKD-IDK---LTNQSFRNFLAVIIFNETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGS-------------LVFLKRK------------------------------FGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-------NKLINKEKSY-YSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPM--------VSPECDCSKTGNQ----ICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIY 5115
             QL  LLWKNF  +RR+   L++E+  PL + FIL +VR S   Y+   C F  K M S G +P++   +C  N  C+               +++ ++ L              T++ + H F+GN+                                     +I  +LP   LN+ +         +K ITS P  F++     L +S + ++K ++ + S      +VM   S N T   S  Y  +  I+CG PE              N++K LF      N   + S +         C  + Q+   + + +  ++  L PL+ GK+ Y P+    + ++ + N TF+ L   R     W   R   + F+     +D I   +     K F     ++     + ++            +     +SW E             R + C  LD+  P+ + +  IDK   L N+  R F A I+F +      P+  T L     Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ ++QA I + T  E    G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W+SWFIS+++ L++   ++ + L+   +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+      LS VAF    +     E+   GVQ+ NL ++P E   + +     +M+ D+ +Y ++TWY+EAVFPGQYG+ +PW F   +SYW        + P      +         E EP +L LG+SI NLVK+Y + K   ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P++GTAYI+ +DIRTE++SIRQ +G+CPQ+NVLFD+LTVE+HI+FY  LK + + ++++ + +++ DV L  K    +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LLIKYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS             L  +KR                                G G              S  +   I   +  ++ +AR++E+   + T VLP        F ELF  +D  ++++ I SYG++DT+LEE+FLKVADD           L  + K Y +  + + L+     +A  T    + +P+ +++ +L   D    + LK + L++QQ  AL  KR  YAKR  KGF A+++LP + +L  ++F  I     K   +++ PW     M  E    F        G    L++    D    G  CM    + +    C    E   WS      S++D+ +         SP C+CS    +    IC     G PP   R   +SD L NLTG NISDYL+K + ++  K +GG+     N           SP           + P N E +  + + ++          +S +W N+KG+ ++ A+ N+++N +LRS+++  ++  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   T+      NEILK V LIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+   +  M++  +F      N K+     ED D++ E+ R+N E   +D+L++  LTKIY
Sbjct:    5 TQLGLLLWKNFTYRRRQTLQLVVEVAWPLFIFFILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCFRYPTPGESPGVVGNFNRSIVSRLFTDARKLLLYSHKDTSVKDMHKFLGNLHNYRGTGFQIHLKDLCNSTRLAEYVTIHNEVVANLSQKIICALPEEKLNLLEQEFRSNVDLLKPITSFP--FLKDITDSLLHSLADLAKEVMTMKSWAEMRQEVMFLTSGNATASPSTLYQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGGEGDNSTDEDSQVAYDNSTTPYCNDLMQNLESSPLYRM-IWRALKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWEEVRPQIKNFMESSQEMDLIRTLLTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETEN-GPFYSWREALNETDRVVLTLSRFMECVNLDKLEPVATEEMLIDKSMELLNE--RKFWAGIVFMDM-----PEEETELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIRVQTGVEK-RTGIYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPLEENGYNITTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWCGEECKEYNQP--HTVQKGSSEGMFCMEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLKGLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIGKYKSLTDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDS-DMDPESRETDYLSGIDGKGSYQLKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPW-----MYDEQYTFFSNDAPDDQGTQALLKALI--DKPGFGTACMEG--HSVMKVSC--SGEEEEWSTQFVSQSVMDLFLNGNWTMENPSPSCECSSDKRKKMLPICPPGAGGLPPFQRR-QNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFSLGASN-----------SP-----------ALPPNEEVVASINHIKKRLELPQVEYLYSVVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TNNKLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWDLVGRNLFAMAV-------------EGVVFFAITLMIQYRFFIKPRPVNAKLPPVVDEDEDVARERQRIN-EGGRNDILELKGLTKIY 1852          

HSP 2 Score: 174.866 bits (442), Expect = 5.820e-43
Identity = 84/228 (36.84%), Postives = 133/228 (58.33%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    ++G A++ N  I   +  + Q +G CPQ++ + + LT  +H+  Y LL+ + + E+  V    I+ + L +     + + SGG KRKLS A+A IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY
Sbjct: 1843 LELKGLTKIYRMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEWAIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGY 2070          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 570/1669 (34.15%), Postives = 890/1669 (53.33%), Query Frame = 1
Query:  514 YNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT--------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---RLHFQTFL-----LDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKD-IDK---LTNQSFRNFLAVIIFNETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP--LMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-------NKLINKEKSY-YSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPM--------VSPECDCSKTGNQ----ICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIY 5115
            Y  +  I+CG PE              N++K LF      N   + S +         C  + Q+   + + +  ++  L PL+ GK+ Y P+    + ++ + N TF+ L   R     W   R   + F+     +D I   +     K F     ++     + ++            +     +SW E             R + C  LD+  P+ + +  IDK   L N+  R F A I+F +      P+  T L     Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ ++QA I + T  E    G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W+SWFIS+++ L++   ++ + L+   +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+      LS VAF    +     E+   GVQ+ NL ++P E   + +     +M+ D+ +Y ++TWY+EAVFPGQYG+ +PW F   +SYW        + P  + + +++ C       E EP +L LG+SI NLVK+Y + K   ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P++GTAYI+ +DIRTE++SIRQ +G+CPQ+NVLFD+LTVE+HI+FY  LK + + ++++ + +++ DV L  K    +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LLIKYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   +  ++ +AR++E+   + T VLP        F ELF  +D  ++++ I SYG++DT+LEE+FLKVADD           L  + K Y +  + + L+     +A  T    + +P+ +++ +L   D    + LK + L++QQ  AL  KR  YAKR  KGF A+++LP + +L  ++F  I     K   +++ PW     M  E    F        G    L++    D    G  CM    + +    C    E   WS      S++D+ +         SP C+CS    +    IC     G PP   R   +SD L NLTG NISDYL+K + ++  K +GG+     N  A         P  + +  S+N  +     PQN    RFL  F  F  K   T +  ++W N+KG+ ++ A+ N+++N +LRS+++  ++  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   T+      NEILK V LIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+   +  M++  +F      N K+     ED D++ E+ R+N E   +D+L++  LTKIY
Sbjct:  297 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGGEGDNSTDEDSQVAYDNSTTPYCNDLMQNLESSPLYRM-IWRALKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWEEVRPQIKNFMESSQEMDLIRTLLTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETEN-GPFYSWREALNETDRVVLTLSRFMECVNLDKLEPVATEEMLIDKSMELLNE--RKFWAGIVFMDM-----PEEETELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIRVQTGVEK-RTGIYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPLEENGYNITTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWCGEECKEYNQPHTVQKGSSEVC------MEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLKGLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDS-DMDPESRETDYLSGIDGKGSYQLKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPW-----MYDEQYTFFSNDAPDDQGTQALLKALI--DKPGFGTACMEG--HSVMKVSC--SGEEEEWSTQFVSQSVMDLFLNGNWTMENPSPSCECSSDKRKKMLPICPPGAGGLPPFQRR-QNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFSLGASNSPAL--------PPNEEVVASINHIKKRLELPQNGAANRFLDSFGAFM-KGLDTKDNVKVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TNNKLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWDLVGRNLFAMAV-------------EGVVFFAITLMIQYRFFIKPRPVNAKLPPVVDEDEDVARERQRIN-EGGRNDILELKGLTKIY 1908          

HSP 2 Score: 177.948 bits (450), Expect = 6.039e-44
Identity = 106/324 (32.72%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADA------RMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    ++G A++ N  I   +  + Q +G CPQ++ + + LT  +H+  Y LL+ + + E+  V    I+ + L +     + + SGG KRKLS A+A IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY + +    +N           LK V+ + + A      +    S LQ+ +   Q+ + +R F+ L KN  +    + I  Y +S T+L++VF+  A
Sbjct: 1899 LELKGLTKIYRMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEWAIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRIAGSNPD---------LKPVEEFFSHAFPGSVLKEKHRSMLQYQLRSSQSSL-ARIFSILSKNKKR----LHIEDYSVSQTTLDQVFVNFA 2208          

HSP 3 Score: 66.2402 bits (160), Expect = 7.083e-10
Identity = 31/77 (40.26%), Postives = 44/77 (57.14%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            QL  LLWKNF  +RR+   L++E+  PL + FIL +VR S   Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    6 QLGLLLWKNFTYRRRQTLQLVVEVAWPLFIFFILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 840.491 bits (2170), Expect = 0.000e+0
Identity = 557/1666 (33.43%), Postives = 882/1666 (52.94%), Query Frame = 1
Query:  514 YNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT--------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---RLHFQTFL-----LDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKD-IDK---LTNQSFRNFLAVIIFNETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP--LMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-------NKLINKEKSY-YSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFY--RNENNMWS----PASILDIPM--------VSPECDCSKTGNQ----ICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIY 5115
            Y  +  I+CG PE              N++K LF      N   + S +         C  + Q+   + + +  ++  L PL+ GK+ Y P+    + ++ + N TF+ L   R     W   R   + F+     +D I   +     K F     ++     + ++            +     +SW E             R + C  LD+  P+ + +  IDK   L N+  R F A I+F +      P+  T L     Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ ++QA I + T  E    G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W+SWFIS+++ L++   ++ + L+   +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+      LS VAF    +     E+   GVQ+ NL ++P E   + +     +M+ D+ +Y ++TWY+EAVFPGQYG+ +PW F   +SYW        + P  + + +++ C       E EP +L LG+SI NLVK+Y + K   ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P++GTAYI+ +DIRTE++SIRQ +G+CPQ+NVLFD+LTVE+HI+FY  LK + + ++++ + +++ DV L  K    +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LLIKYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   +  ++ +AR++E+   + T VLP        F ELF  +D  ++++ I SYG++DT+LEE+FLKVADD           L  + K Y +  + + L+     +A  T    + +P+ +++ +L   D    + LK + L++QQ  AL  KR  YAKR  KGF A+++LP + +L  ++F  I     K   +++ PW+       +   TF+  +                   + G + +  ++     +   +    E   WS      S++D+ +         SP C+CS    +    IC     G PP   R   +SD L NLTG NISDYL+K + ++  K +GG+     N  A  S +                         + LK F  F  K   T +  ++W N+KG+ ++ A+ N+++N +LRS+++  ++  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   T+      NEILK V LIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+   +  M++  +F      N K+     ED D++ E+ R+N E   +D+L++  LTKIY
Sbjct:  264 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGGEGDNSTDEDSQVAYDNSTTPYCNDLMQNLESSPLYRM-IWRALKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWEEVRPQIKNFMESSQEMDLIRTLLTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETEN-GPFYSWREALNETDRVVLTLSRFMECVNLDKLEPVATEEMLIDKSMELLNE--RKFWAGIVFMDM-----PEEETELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIRVQTGVEK-RTGIYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPLEENGYNITTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWCGEECKEYNQPHTVQKGSSEVC------MEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLKGLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDS-DMDPESRETDYLSGIDGKGSYQLKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMY------DEQYTFFSNDAPD----------------DQGTQALLKALIDKPGFGTAFSCSGEEEEWSTQFVSQSVMDLFLNGNWTMENPSPSCECSSDKRKKMLPICPPGAGGLPPFQRR-QNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFSLGASNSPALPSVV------------------------GKLLKIFGAFM-KGLDTKDNVKVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TNNKLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWDLVGRNLFAMAV-------------EGVVFFAITLMIQYRFFIKPRPVNAKLPPVVDEDEDVARERQRIN-EGGRNDILELKGLTKIY 1845          

HSP 2 Score: 175.252 bits (443), Expect = 4.906e-43
Identity = 84/228 (36.84%), Postives = 133/228 (58.33%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    ++G A++ N  I   +  + Q +G CPQ++ + + LT  +H+  Y LL+ + + E+  V    I+ + L +     + + SGG KRKLS A+A IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY
Sbjct: 1836 LELKGLTKIYRMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEWAIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGY 2063          

HSP 3 Score: 65.855 bits (159), Expect = 7.218e-10
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
             QL  LLWKNF  +RR+   L++E+  PL + FIL +VR S   Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    5 TQLGLLLWKNFTYRRRQTLQLVVEVAWPLFIFFILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 557/1671 (33.33%), Postives = 873/1671 (52.24%), Query Frame = 1
Query:  514 YNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT--------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---RLHFQTFL-----LDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKD-IDK---LTNQSFRNFLAVIIFNETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP--LMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXX---------------------------XXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-------NKLINKEKSY-YSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPM--------VSPECDCSKTGNQ----ICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKI-----------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIY 5115
            Y  +  I+CG PE              N++K LF      N   + S +         C  + Q+   + + +  ++  L PL+ GK+ Y P+    + ++ + N TF+ L   R     W   R   + F+     +D I   +     K F     ++     + ++            +     +SW E             R + C  LD+  P+ + +  IDK   L N+  R F A I+F +      P+  T L     Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ ++QA I + T  E    G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W+SWFIS+++ L++   ++ + L+   +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+      LS VAF    +     E+   GVQ+ NL ++P E   + +     +M+ D+ +Y ++TWY+EAVFPGQYG+ +PW F   +SYW        + P  + + +++ C       E EP +L LG+SI NLVK+Y + K   ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P++GTAYI+ +DIRTE++SIRQ +G+CPQ+NVLFD+LTVE+HI+FY  LK + + ++++ + +++ DV L  K    +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LLIKYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K  N+ S                               +   I   +  ++ +AR++E+   + T VLP        F ELF  +D  ++++ I SYG++DT+LEE+FLKVADD           L  + K Y +  + + L+     +A  T    + +P+ +++ +L   D    + LK + L++QQ  AL  KR  YAKR  KGF A+++LP + +L  ++F  I     K   +++ PW     M  E    F        G    L++    D    G  CM    + +    C    E   WS      S++D+ +         SP C+CS    +    IC     G PP   R   +SD L NLTG NISDYL+K + ++  K            +GG+     N  A         P  + +  S+N  +     PQN    RFL  F  F  K   T +  ++W N+KG+ ++ A+ N+++N +LRS+++  ++  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  Q +SG+ P +YW++NF+WD++             +          +N L           +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   T+      NEILK V LIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+   +  M++  +F      N K+     ED D++ E+ R+N E   +D+L++  LTKIY
Sbjct:  292 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGGEGDNSTDEDSQVAYDNSTTPYCNDLMQNLESSPLYRM-IWRALKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWEEVRPQIKNFMESSQEMDLIRTLLTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETEN-GPFYSWREALNETDRVVLTLSRFMECVNLDKLEPVATEEMLIDKSMELLNE--RKFWAGIVFMDM-----PEEETELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIRVQTGVEK-RTGIYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPLEENGYNITTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWCGEECKEYNQPHTVQKGSSEVC------MEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLKGLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKKFMTGFLLLCFAGLTDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDS-DMDPESRETDYLSGIDGKGSYQLKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPW-----MYDEQYTFFSNDAPDDQGTQALLKALI--DKPGFGTACMEG--HSVMKVSC--SGEEEEWSTQFVSQSVMDLFLNGNWTMENPSPSCECSSDKRKKMLPICPPGAGGLPPFQRR-QNTSDILQNLTGRNISDYLVKTYSQIIEKSLKNKIWVNEFRYGGFSLGASNSPAL--------PPNEEVVASINHIKKRLELPQNGAANRFLDSFGAFM-KGLDTKDNVKVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMVSLSNIKNTKQPHRL----------QNKL----------WSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TNNKLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWDLVGRNLFAMAV-------------EGVVFFAITLMIQYRFFIKPRPVNAKLPPVVDEDEDVARERQRIN-EGGRNDILELKGLTKIY 1885          

HSP 2 Score: 178.333 bits (451), Expect = 4.699e-44
Identity = 106/324 (32.72%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADA------RMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    ++G A++ N  I   +  + Q +G CPQ++ + + LT  +H+  Y LL+ + + E+  V    I+ + L +     + + SGG KRKLS A+A IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY + +    +N           LK V+ + + A      +    S LQ+ +   Q+ + +R F+ L KN  +    + I  Y +S T+L++VF+  A
Sbjct: 1876 LELKGLTKIYRMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEWAIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRIAGSNPD---------LKPVEEFFSHAFPGSVLKEKHRSMLQYQLRSSQSSL-ARIFSILSKNKKR----LHIEDYSVSQTTLDQVFVNFA 2185          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 822.002 bits (2122), Expect = 0.000e+0
Identity = 555/1680 (33.04%), Postives = 872/1680 (51.90%), Query Frame = 1
Query:  514 YNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT--------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---RLHFQTFL-----LDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKD-IDK---LTNQSFRNFLAVIIFNETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP--LMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-------NKLINKEKSY-YSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPM--------VSPECDCSKTGNQ----ICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKI-----------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIY 5115
            Y  +  I+CG PE              N++K LF      N   + S +         C  + Q+   + + +  ++  L PL+ GK+ Y P+    + ++ + N TF+ L   R     W   R   + F+     +D I   +     K F     ++     + ++            +     +SW E             R + C  LD+  P+ + +  IDK   L N+  R F A I+F +      P+  T L     Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ ++QA I + T  E    G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W+SWFIS+++ L++   ++ + L+   +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+      LS VAF    +     E+   GVQ+ NL ++P E   + +     +M+ D+ +Y ++TWY+EAVFPGQYG+ +PW F   +SYW        + P  + + +++ C       E EP +L LG+SI NLVK+Y + K   ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P++GTAYI+ +DIRTE++SIRQ +G+CPQ+NVLFD+LTVE+HI+FY  LK + + ++++ + +++ DV L  K    +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LLIKYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   +  ++ +AR++E+   + T VLP        F ELF  +D  ++++ I SYG++DT+LEE+FLKVADD           L  + K Y +  + + L+     +A  T    + +P+ +++ +L   D    + LK + L++QQ  AL  KR  YAKR  KGF A+++LP + +L  ++F  I     K   +++ PW     M  E    F        G    L++    D    G  CM    + +    C    E   WS      S++D+ +         SP C+CS    +    IC     G PP   R   +SD L NLTG NISDYL+K + ++  K            +GG+     N  A         P  + +  S+N  +     PQN    RFL  F  F  K   T +  ++W N+KG+ ++ A+ N+++N +LRS+++  ++  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  Q +SG+ P +YW++NF+WD++             +          +N L           +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   T+      NEILK V LIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+   +  M++  +F      N K+     ED D++ E+ R+N E   +D+L++  LTKIY
Sbjct:  238 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGGEGDNSTDEDSQVAYDNSTTPYCNDLMQNLESSPLYRM-IWRALKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWEEVRPQIKNFMESSQEMDLIRTLLTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETEN-GPFYSWREALNETDRVVLTLSRFMECVNLDKLEPVATEEMLIDKSMELLNE--RKFWAGIVFMDM-----PEEETELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIRVQTGVEK-RTGIYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPLEENGYNITTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWCGEECKEYNQPHTVQKGSSEVC------MEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLKGLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDS-DMDPESRETDYLSGIDGKGSYQLKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPW-----MYDEQYTFFSNDAPDDQGTQALLKALI--DKPGFGTACMEG--HSVMKVSC--SGEEEEWSTQFVSQSVMDLFLNGNWTMENPSPSCECSSDKRKKMLPICPPGAGGLPPFQRR-QNTSDILQNLTGRNISDYLVKTYSQIIEKSLKNKIWVNEFRYGGFSLGASNSPAL--------PPNEEVVASINHIKKRLELPQNGAANRFLDSFGAFM-KGLDTKDNVKVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMVSLSNIKNTKQPHRL----------QNKL----------WSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TNNKLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWDLVGRNLFAMAV-------------EGVVFFAITLMIQYRFFIKPRPVNAKLPPVVDEDEDVARERQRIN-EGGRNDILELKGLTKIY 1840          

HSP 2 Score: 178.333 bits (451), Expect = 5.639e-44
Identity = 106/324 (32.72%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADA------RMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    ++G A++ N  I   +  + Q +G CPQ++ + + LT  +H+  Y LL+ + + E+  V    I+ + L +     + + SGG KRKLS A+A IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY + +    +N           LK V+ + + A      +    S LQ+ +   Q+ + +R F+ L KN  +    + I  Y +S T+L++VF+  A
Sbjct: 1831 LELKGLTKIYRMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEWAIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRIAGSNPD---------LKPVEEFFSHAFPGSVLKEKHRSMLQYQLRSSQSSL-ARIFSILSKNKKR----LHIEDYSVSQTTLDQVFVNFA 2140          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca1 (ATP-binding cassette, sub-family A (ABC1), member 1 [Source:MGI Symbol;Acc:MGI:99607])

HSP 1 Score: 850.892 bits (2197), Expect = 0.000e+0
Identity = 568/1679 (33.83%), Postives = 901/1679 (53.66%), Query Frame = 1
Query:  514 YNELGEIICGSPEND-FKLFMRNFIKNQRRKRSLL--TCQLIFQSFFQNSIVKFE---------------MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFK---ILDNLRLASVEWRLHFQTF------------LLDYISNNVF-------INDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTF---LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDL-TEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQ----------NPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWL------MMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWS----PASILDI--------PMVSPECDCS----KTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF-----QRLSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQP-----QNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 5121
            Y  +  I+CG PE    K+   N+ ++   K        +    +F+ NS   +                ++  L PL+ GK+ Y P+    RQ++ + N TF+   +  +L     E      TF            LLD   N+ F       ++   +   A+ + NP+   + N   ++   +   +  ++    I R + C  L++  P+ +     +L N+S      R F A I+F      +TP +      + Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ ++QA I ++T +E  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IKSIVYEKE+RLKE M++MGL+N + W SWF+S+++ L++   ++ V L+L  +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  ++     LLS VAF    ++   +E+   GVQ+ NLF++P E   F +   + +M+ D+F+Y ++TWY+EAVFPGQYG+ +PW F C +SYW       +S P     +    ++    E EP +L+LG+SI NLVK+Y       ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYIL +DIR+EM SIRQ +G+CPQ+NVLFD LTVE+HI+FY  LK + +  +++ + ++  DV L   K+ + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   ++ ++++AR++E+   + T VLP        F ELF  +D  ++++ I SYG+S+T+LEE+FLKVA++     ++ E S  +      +       +    F             +P+ +++  L   D    + LKG+ L QQQ +AL  KR   A+R  KGF A+++LP + +   ++F  I     K   +++ PW+       +S    E++ T             +L +    D G  G RCM  NP    + +  C    E+  W+    P SI+D+           SP C CS    K    +C     G  P   R   ++D L NLTG NISDYL+K +     + L  KI      +GG+   + N  A         P    + D++ Q +      ++    RFL     F      T N  ++W N+KG+ ++ ++ N+++N +LR+ ++  +N   YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   T+      N+ILK VFLIFP + LGRG+ID+  N    +  + + +        W++    L ++ +  +++++I ++I+     R      K+   N+     ED D+  E+ R+      +D+L++  LTKIY R
Sbjct:  301 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNNTEEDVDTFYDNSTTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPQIWTFMENSQEMDLVRTLLDSRGNDQFWEQKLDGLDWTAQDIMAFLAKNPEDVQSPNG--SVYTWREAFNETNQAIQTISRFMECVNLNKLEPIPTEV---RLINKSMELLDERKFWAGIVFTG----ITPDSVELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGSEK-KTGVYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKSIVYEKEARLKETMRIMGLDNGILWFSWFVSSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAMVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFSIKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTAVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWFGEEIDEKSHP----GSSQKGVSEICMEEEPTHLRLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE---SGVDAETSDGTLPARRNRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQYTFVSNDAPEDMGT------------QELLNALTKDPG-FGTRCMEGNP----IPDTPCLAGEED--WTISPVPQSIVDLFQNGNWTMKNPSPACQCSSDKIKKMLPVCPPGAGGL-PPPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNSQAL--------PPSHEVNDAIKQMKKLLKLTKDSSADRFLSSLGRFM-AGLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQKGENPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TNNKLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVKAKLPPLND-----EDEDVRRERQRILDGGGQNDILEIKELTKIYRR 1923          

HSP 2 Score: 182.185 bits (461), Expect = 2.730e-45
Identity = 102/320 (31.87%), Postives = 169/320 (52.81%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + I  L K+Y   + P ++ + +     +    LG NGAGK+TT  +LTG    + G A++    I + +  + Q +G CPQ++ + + LT  +H+ F+ LL+ + + E+  V    I+ + L +     + + SGG KRKLS AMA IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           + SN + + + +F  +    + + E+ R      LP    +      +F  L Q    + I  Y +S T+L++VF+  A D
Sbjct: 1912 LEIKELTKIYRRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIVVRIAGSNPDLKPVQEFFGLAFPGSVLKEKHRNMLQYQLPS---SLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKD 2223          

HSP 3 Score: 65.855 bits (159), Expect = 5.791e-10
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            QLR LLWKN   +RR+   LL+E+  PL +  IL +VR S   Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    6 QLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca4 (ATP-binding cassette, sub-family A (ABC1), member 4 [Source:MGI Symbol;Acc:MGI:109424])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 514/1681 (30.58%), Postives = 862/1681 (51.28%), Query Frame = 1
Query:  523 LGEIICGSPE--------------NDFKLFMRNFIKNQRR-------KRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLR--------LASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSS--------ESIPL---MRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXI--------------------------------LKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLI-------NKEKSYYSYYCNILKMKLRINA----TKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWL--------MMSKMGKENLNTFYRKENISLGLINK-LESEYRSDLGESGIRCMNPSIYRLDNYQCFYRN--ENNMWSPASILDIPMVSPECDCSK----TGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSR-----------KIFGGYQF--LLPNDFAQSSKLIAQSPTWDGIRDSVNQS-----QPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNK-IKKT-------EDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 5118
            L +++CG PE              N++K F+   I + R+       KR+   C  + QS   N + K   +    PL+ GK+ + P+    R+I++ AN TF+ LD +R        +    W    ++  +  I + +    VK F            +AV   F+    +   D ++  F W +             + L C  LD+F   +S  D  +LT ++        F A ++F   + + +      + Y+IR+ +  ++ T K K  DR+W   PR +   DF+Y+  GF +LQ+ ++Q  ++     E   +G  +  MPYPC++ D F+  L    P  +V+AW  SV++ +K IV EKE RLKE +K  G++N V W +WF+ +  ++ + + ++++ +   +I   S   ++F  +  +  + I Q+F++S  FSKA++A+   G++YFT Y+  V+    +  ++  +  +  LLS VAF    ++++ +E+   G+Q+SN+ ++P E   F     + +M++D+ +Y L+ WY++ VFPG YG   PW FL   SYW+     S        ++ PL   M +      +N   FE E   L  G+ + NLVK++  +  P ++ LN+ FYE+QITAFLGHNGAGKTTT+SILTG+  P+SGT  I  +DI T +D +RQ +G+CPQ+N+LF  LTV +HI FY  LK     E +  +  +++D  L  K N  +  LSGGM+RKLS+A+AF+G+S+VV LDEPT+GVDP++RR IWDLL+KYRS  RTII++THHMDEAD L DR+AIISQG+L C G+ +FLK  FG G+YL+L++   N  +     E +                                +  V  ++ +A+++E    +   +LP  +   R +  LF+ L++ +A++ + S+G+SDT LEE+FLKV +D     +        +E++   + C+    KLR  A    T +   ++    Q   +  D       G  L+ Q + AL +KR+H+  R  K F+A+++LP   +   ++   I     +   + + PW+         M +   E+L           G  N+ L+ E+  +       C+N + ++  +      +  +   W+ A        SP C CS     T    C +  +GG P   R   S++ L +LT  NISDYL+K +  L R           + +GG      LP        L+       G+   +N S     +  + E L FLK+ +        T +  ++W N+KG+ ++ ++ N+  N +LR+ +   ++   YGI+V + P+  ++ ++S    L   ++  +AI VI A+SF+ ASFV++LI ER++ +K  QF+SG++P  YW++NFLWDIM Y +   +++ IFI F  ++Y    N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TF+L++ E+     R  N +L+K+ ++FP + LGRG+IDL+   +   +TD YA++      + F W++  + L ++ +              GV+  +L  +++  +F  + I +        ED D++ E+ R+ S     D+L++  LTK+Y+
Sbjct:  319 LSDLLCGYPEGGGSRVFSFNWYEDNNYKAFLG--IDSTRKDPAYSYDKRTTSFCNSLIQSLESNPLTKI-AWRAAKPLLMGKILFTPDSPAARRIMKNANSTFEELDRVRKLVKAWEEVGPQIWYFFEKSTQMTVIRDTLQHPTVKDFINRQLGEEGITTEAVLNFFSNGPQEKQADDMTS-FDWRDIFNITDRFLRLANQYLECLVLDKF---ESYDDEVQLTQRALSLLEENRFWAGVVFPGMYPWAS-SLPPHVKYKIRMDIDVVEKTNKIK--DRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGIVKSQMQAEP-PIGVYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKGIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMALSIFLLTLFIMHGRILHYSDPFILFLFLLAFATATIMQSFLLSTLFSKASLAAACSGVIYFTLYLPHVLCFAWQDRMTADLKTTVSLLSSVAFGFGTEYLVRFEEQGLGLQWSNIGKSPLEGDEFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEPLTEEMEDPEHPEGMNDSFFERELPGLVPGVCVKNLVKVFEPSGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLIGGKDIETNLDVVRQSLGMCPQHNILFHHLTVAEHILFYAQLKGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDSKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDPPKGQPSPEPEDPGVPFNTGARLILQHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMYGHQYTFFSMDEPNNEHLEVLADVLLNRPGFGNRCLKEEWLPE-----YPCINATSWKTPSVSPNITHLFQKQKWTAAH------PSPSCKCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPISGEALVG---FLSGLGQMMNVSGGPVTREASKEMLDFLKHLE--------TTDNIKVWFNNKGWHALVSFLNVAHNAILRASLPRDRDPEEYGITVISQPLNLTKEQLSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFENNRTLLR-FNAMLRKLLIVFPHFCLGRGLIDLA---LSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAI-------------EGVVYFLLTLLIQHHFFLTRWIAEPAREPVFDEDDDVAEERQRVMSGGNKTDILKLNELTKVYS 1947          

HSP 2 Score: 180.644 bits (457), Expect = 7.616e-45
Identity = 116/401 (28.93%), Postives = 193/401 (48.13%), Query Frame = 1
Query: 1966 VGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADA-RMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            +G  ++ M I+  +Y L+T  ++  F     +A+P     AR             P+   ++   E   +       N    + ++ L K+Y  +  P ++ L +     +    LG NGAGKTTT  +LTG  + +SG A +  + I T +  + Q +G CPQ++ + D LT  +H+Y Y  L+ +   EIE V    I+ + L+   + L+   SGG KRKLS A+A  G   ++ LDEPT G+DP ARR +W+ ++      R ++LT+H M+E + L  R+AI+ +G  QC G++  LK KFG+GY +++                   F   +     R    S LQ+        + S     +F+ L  H   + I  Y ++ T+L++VF+  A
Sbjct: 1874 IGKNLVAMAIEGVVYFLLTLLIQHHFFLTRWIAEP-----ARE------------PVFDEDDDVAEERQRVMSGG--NKTDILKLNELTKVYSGSSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTSISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKLSTAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGRAVVLTSHSMEECEALCTRLAIMVKGTFQCLGTIQHLKYKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQRERHHSMLQF-------QVPSSSLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVNFA 2248          

HSP 3 Score: 57.7658 bits (138), Expect = 1.656e-7
Identity = 26/77 (33.77%), Postives = 42/77 (54.55%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            Q++ LLWKN+ L++R+    ++EL  PL +  +L  +R++   Y    C F  K M S G +P+L    C  N  C+
Sbjct:    6 QIQLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNANPLYSQHECHFPNKAMPSAGLLPWLQGIFCNMNNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:MGI Symbol;Acc:MGI:2676312])

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 480/1557 (30.83%), Postives = 799/1557 (51.32%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW-----------RLHFQTF-LLDYISNNVFINDVKKFCKAYYSANP-KICDAVNTL-FNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRN--FLAVIIF-----NETFQYLTPKNTTF---LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYW-----VYNIKSSESIPLMRNNNQNCEINHQA------------FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLK--RMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXX--XXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDIN-SRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKL---RINATKTEIFLNQNPDQ---KQSKFLDQSDHL------LKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISL-GLINKLESEYRSDLGESGIR--CMNPSIYRLDNYQCFYRNENNMW-SPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQF--LLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQ-NSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVG--SITTMS-TFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYA-KYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKV---SYFNNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 5118
            ++  L P++ GK+ Y P     + I+EK+N+T + L  LR  S EW            L  QT  +L     N F+    KF     +    K  D ++ L   + N    ID ++ L S      +C   DR    D++++++ +  Q +++      +IF         +   P+  +    + Y IR+ L    +T   +   + W P P  N+ +  +     FI+LQ++I++A IEL T   S EV   +  +PYPC++ D FL  ++  LP +L++AW   +   +K +VYEK+ RL EYMK+MG+N+  H+ +W I +I  L++ + I+ V L+   I   ++  ++F     Y  S I  ++++SVFF+  N+A++ G ++Y   +  F+V + +E ELS  +     LLS  AFS A +++  +E+   G+Q+ N++++P +      G    L++ DSFIY  I WYV  VFPG YG+A PW F    SYW        +K  +S  LM  N      N  A             E EP++L++G+++H + K+Y S     + NLNLNFYE  IT+ LG NGAGKTTTIS+LTG+F  ++GT ++  +DI+T+++++R+ +G+C Q++VLF  LT ++H+  YG +K     K ++   + R +KD  L    +     LSGGMKRKLSI++A IG SRVV LDEP+ GVDP +RR IWD++ K ++  RTIIL+THH+DEA+ LSDR+A + QG L+CCGS  +LK  FG+GY+L+L K ++    +N+  +   +   ++ ++ +A + E+   +   VLP      S  +  L + LD+ M +++I  YG+SDT++EEVFL +  D        +KS      ++ + K+     N T T       PD      S F D+ D +      L+GF LL ++I+A+ IKR+H+ +R++KG +A++ILP++ +   +    +         + ISP    S  G      FY   + S  GL++ L           GI   C+N S     + QC  +++   W +    +D   V   C CS    Q C       P   +R   SS  + NLTG ++ +YL+       +K +GG+ F   L ND                +R  V  + P N                       +++W + +GY S+PAY N L+N LL  R+ +S+ ++  +GI + ++P    + +  Q     L+++ +A+ +++  S  +ASFV +++ E  + +K+ Q +SGI    YWV+NF++D++ Y++P+   I +   F   ++    N  A  LLL+ +G A    MY  +        AF+     NL  G  SI ++S  + L   +  D T    +E LK++FLIFPQ+  G G+I+LS      +    Y  +Y +  +E+  +KL ++ +  +    +  ++ R +IN  L + L++    + ++ I +T  ED D+  E+ R+ S     D++Q+  LTK Y 
Sbjct:  794 IWAFLKPMLLGKILYSPYNPTTKAIMEKSNVTLRQLAELREKSQEWMDKSPIFMNSFHLLNQTIPMLQNTLRNPFVQVFVKFSVGLDAVELLKQIDDLDVLRLKLVNNIDIIDQLNTLSSLTVNISSCVLYDRIQASDTVEEMETVAEQLYKSNELFGSVIFKLPSNGSLHRGFDPEKVSLPPIVRYTIRMSLKTAQTTRSIRT--KIWAPGPH-NSPSHNQIYGRAFIYLQDSIERAIIELQTGRNSQEVAVQVQAVPYPCFMKDNFLTSVSYSLPIVLMVAWVVFIAAFVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLIESIGFLLVTIAILIVILKFGNILPKTNGFILFLYFSDYSFSVIAMSYLISVFFNNTNIAALIGSLIYVIAFFPFIVLVTVEDELSYVIKVFMSLLSPTAFSYASQYIARYEEQGVGLQWENMYKSPVQDDTTSFGWLCCLILADSFIYFFIAWYVRNVFPGTYGMAAPWYFPILPSYWKERFGCAEVKHEKSNGLMFTNIMMQNTNPSASKTSPDCAFPSNIEPEPKDLQVGVALHGVTKIYGSKT--AVENLNLNFYEGHITSLLGPNGAGKTTTISMLTGLFGATAGTIFVYGKDIKTDLNTVRKNMGVCMQHDVLFSYLTTKEHLLLYGSIKVPHWTKTQLHEEVKRTLKDTGLYSHRHKRVGTLSGGMKRKLSISIALIGGSRVVILDEPSTGVDPCSRRSIWDVISKNKT-ARTIILSTHHLDEAEVLSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKKKSPNLDTNAICDTVAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDKGMGKLNIGCYGISDTTVEEVFLNLTKD-------SQKSSNMSLEHLTQRKVGNPSANGTST-------PDDLSVSSSNFTDRDDKVLTRSEKLEGFGLLLKKIMAILIKRFHHTRRNWKGLIAQVILPIVFVATAMGLGTLRDSSNSYPEIMISP----SIYGTSEQTAFYANFDPSTSGLVSAL-------WNFPGIDNVCLNTS-----DLQCLKKDDLGKWNTSGEAIDNFGV---CSCSDN-VQECPKFNYHPP---HRRTYSSQVIYNLTGKHMENYLITTANHFVQKRYGGWSFGMKLTND----------------LRFDVT-AVPDN--------------------RTLAKVWYDPEGYHSLPAYLNSLNNFLL--RVNMSEYDAARHGIIMYSHPYPGVQDQ-EQATISSLIDILVALSILMGYSVTTASFVTYIVREHQTKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAFSIGVIAIFKLPAFYSGNNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELSQQQAVLDFLKAYGVEYPSETFEM--DKLGAMFVALVSQGTMFFLL-RLLINEWLIKKLRLFFRKFTSSPIMETVDEDEDVRAERFRVESGAAEFDLVQLHRLTKTYQ 2264          

HSP 2 Score: 184.496 bits (467), Expect = 4.939e-46
Identity = 110/353 (31.16%), Postives = 188/353 (53.26%), Query Frame = 1
Query: 2125 SIPLMRNNNQNCEINHQAFESEPENLKLG-ISIHNLVKLYP--SNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIR-TEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            S P+M   +++ ++  + F  E    +   + +H L K Y     KI  +NN++L     +    LG NGAGKTT   +LTG   PSSG   I N+      +DS    +G CPQ + L D +TVE+H+YFY  +  + + +I+  + ++++ + L    +  +   S G KRKLS A+A IG   ++ LDEP++G+DP ++R +W ++ +   +  ++ILT+H M+E + L  R+AI+  G+ QC GSL  +K +FG G+ + +    N  S         L F K Y+ D  +   S L++ +      + +     +F  L+ +   ++I ++ +S T+LEEVF+  A D
Sbjct: 2224 SSPIMETVDEDEDVRAERFRVESGAAEFDLVQLHRLTKTYQLIHKKIIAVNNISLGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRNKSGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKDTVHKLLRRLHLMAYKDRSTSMCSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKRHLWRIISEEVQNKCSVILTSHSMEECEALCTRLAIMVNGRFQCIGSLQHIKSRFGRGFTVKVHLKNNKVSMETLTKFMQLHFPKTYLKDQHL---SMLEYHV-----PVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2568          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca13 (ATP-binding cassette, sub-family A (ABC1), member 13 [Source:MGI Symbol;Acc:MGI:2388707])

HSP 1 Score: 553.132 bits (1424), Expect = 2.440e-162
Identity = 442/1564 (28.26%), Postives = 772/1564 (49.36%), Query Frame = 1
Query:  619 CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFL-----LDYISNNVFINDVK-----KFCKAYYSANPKI-CDAVNTLFNITNVKSYIDGVSKLFSWIERGL------------NCTELDRFIPLDSLKDIDKLTNQSFR--NFLAVIIFNETFQYLTPKNTTF-----LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIF--LQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYW------VYNIKSSESIPLMRNNNQ--NCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKR--MDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXX-XXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNT-FYRKENISLGLINKLESEYRSD--LGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLL--KNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSW-NYGISVTNYPIADS---ETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTF---ILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVC 5145
            C  ++Q   Q+      +++ L P++ GK+ Y PN   I ++I+KAN TF  +D +++ S       +TFL          N    N ++     KF + +  +   I  D +       ++++Y   + K+F+ +E G             +C  LDRF  ++++  ++   ++  +  +FLA IIFN + ++   ++        ++Y IR  +  + S     + +  W  +P+      FKY    +IF  LQ+ I++A I + T  ES+E  +     PYPC+  D FL  +    P ++++ W  +V  +++ +VYE+E +++EYM++MGL+  +H++SWF+  +  L +    ++V L++S I   S   ++F  +  + +S +  ++ +SVFF++AN A++   + Y   ++ +VV + L  +LS  +     LLS  AF   V F+ + E   EG+Q+ N+++ P E      G    +++ D+ +Y L  WY   + PG +G+ KPW F    SYW      +   + S S  L   N    N  ++ Q    E E    G+++ ++ K Y  +K+ V   L L F+  QITA LG NGAGKTT IS+L G+F P+SGT  I  ++++T++  +R+++G+CPQ +VL D+LTV +H+  +  +K       E++  + + + +V+LT+  +  +  LSGGMKRKLSI +AF+G S+ V LDEP++GVDP +RR +WD+L+KYR   RTII TTHH+DEA+ LSD VA++ QG+L+C      LK  +G+G  L+L K      +   ++   +   ++IYI  A + +    + T  +P+ D +   F  L + LDQ++  + +  YG+SDT+LEEVFL +  D        +KSY +    +     R     +   ++      +    +     + G  LL  Q +AL  KR  +  R +K   ++L+LPVL +   +    +  L     P++++P         E   T F+   N    L + L  ++R    +     R MN S +  D Y                   P     C C K  N      +S G P+    +  +  L NL+GY++ +YLL      RL    FGG    +PND A+  K               N S+P+ L                      +++W N KG+ S+P+Y N L+NL+L   +  +   W  YGI++ ++P   +   E +I +     + +  +A+ ++L  S +SAS    ++ +R++G+KR Q +SG+    YW+ NFL+D++ Y++ + + + +  AF   ++   +N  A  LLL  +G A+IP MY  S   S+   AF+   + N + G  T + T    +L II    +  +    +LK  F IFPQ+ LG+G+I+L  N IKY++T  +   D++        L  + +   L    L+++   +   +L      S   + +K  +D D+  E+ R+   +   D++ + NL+K Y   F  ++  
Sbjct: 3258 CLKLYQEILQSPNGAL-VWSFLKPVLHGKILYTPNSPEINEVIQKANYTFYFVDKIKVLS-------ETFLKISKLFQGSGNGQMFNQLQDALRNKFIRNFVESQLHIDMDKLTE-----DLQTYGRMLDKMFNHVEAGHFRFLGGMLANLSSCVVLDRFQAVETVDTLETKAHELMQQNSFLASIIFNSSLRHRHIRSAPHKLPPHVTYTIRTNV--LYSMRTDMIKNPSWKFHPQNLPAGGFKY---NYIFVPLQDMIERAIIVVQTGQESLEPTTQAQAAPYPCHTSDLFLNNVGFFFPLIMMLTWMVAVASMVRKLVYEREIQIEEYMRMMGLHPTIHFLSWFLENMATLALSSAALAVILKMSGIFMHSDAFIIFLYLLDFGVSAVMMSYFLSVFFNQANTAALCTSLGYMISFLPYVVLLVLHNQLSFAIQTLLCLLSTTAFGQGVFFITFLEGQEEGIQWGNMYRAP-EPGGMTFGWVCWMILFDAILYFLGGWYFSNLVPGTFGLGKPWYFPFTASYWKSICGLMERRRCSLSSGLFFFNEDFGNKGLSQQNGPGEMEGGNPGVALISVTKEYEDHKVAV-QELTLTFHRDQITALLGTNGAGKTTIISMLMGLFPPTSGTITINGKNLQTDLSKVREELGVCPQQDVLLDNLTVREHLMLFASIKAPWWTTKELQQQVNKTLDEVELTQHQHKPAGVLSGGMKRKLSIGIAFMGMSKTVVLDEPSSGVDPCSRRSLWDILLKYRE-GRTIIFTTHHLDEAEMLSDHVAVLQQGRLRCYAPPADLKETYGQGLTLTLSKQPSILETQEPKDVARVTSLIQIYIPQAFLKDSCGGELTYTIPK-DADRTCFKGLCQALDQNLQHLHLTGYGISDTTLEEVFLMLLQD------TNKKSYITPDNKVEPQNERPVGPLSPHNVSPLSTPPEGALPEP----IGGCQLLLGQAVALLRKRLLHTLRAWKSTTSDLLLPVLFVALAMGLFMVQPLAITYPPLKLTPG------HYETAETYFFSSGNHGPDLTHVLLRKFRDQDPVCADAFR-MNSSSWHRDPYSG-----------------PESQDSCGCLKCPN------KSAGAPSLTNCLGHT--LLNLSGYDVEEYLLVPSAKPRLGGWSFGGQ---IPND-AEDVK--------------TNTSKPRTL----------------------AKVWYNQKGFHSLPSYLNHLNNLILWHHLPANAVDWRQYGITLYSHPYGGALLNEDRILE----SIRQCGVALCIVLGFSILSASIGSSVVRDRVTGAKRLQHISGLGHRTYWLINFLYDMLFYLVSVCLCVAVIGAFQLTAFTFRENLAATALLLALFGYAMIPWMYLMSRIFSSSDVAFISYISLNFIFGLCTMLMTTMPRLLAIISKA-QNLQKIYNVLKWAFTIFPQFCLGQGLIELCYNQIKYDLTHNFG-IDSYVSPFEMNFLGWIFVELTLQGTFLLLLRLMLHGDLLRWPRDHSVLQDIVKPAKDIDVETEQMRVLEGRTGGDMMVLCNLSKSYRSVFGGKTTA 4711          

HSP 2 Score: 146.747 bits (369), Expect = 1.885e-34
Identity = 97/328 (29.57%), Postives = 164/328 (50.00%), Query Frame = 1
Query: 2224 NLVKLYPS---NKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILN-EDIRTEMDSIRQK---IGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARM-MEESRLQ--WTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM 3177
            NL K Y S    K   ++ ++L     +    LG NGAGK+TT  IL G   PSSG   I   +    ++ S  +    IG CPQ + L + LT  +H+ +Y  L+ + K  I  V   +++ + L   ++      SGG +RKLS A+A +G   ++ LDEP++G+DP ++R +W  + +        +LT+H M+E + L  R+AI+  G  +C G    +K +FG+GY + +  ++     S  +    L F  I     R+ + E  +Q  W  +            +LFK L+ + + ++I  Y +S T+LE+VF+  A + +
Sbjct: 4696 NLSKSYRSVFGGKTTAVHGISLGIPRGECFGLLGVNGAGKSTTFKILNGETPPSSGYTVIRTPQGDMVDLASAGKAGILIGYCPQQDALDELLTGWEHLQYYCRLRGIPKQYIPEVAADLVRRLHLESHVDKPVATYSGGTRRKLSTALALVGKPDILLLDEPSSGMDPCSKRYLWQTITQEVRDGCAAVLTSHSMEECEALCTRLAIMVDGSFRCLGPPQHIKNRFGDGYTVKVWLHKEGSQPSAVSDCLKLHFPGIQFKGQRLNLLEYHVQKSWECL-----------ADLFKVLENNKSLLNIEHYSISQTTLEQVFVNFATEQL 5012          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca2 (ATP-binding cassette, sub-family A (ABC1), member 2 [Source:MGI Symbol;Acc:MGI:99606])

HSP 1 Score: 538.495 bits (1386), Expect = 3.000e-158
Identity = 315/879 (35.84%), Postives = 507/879 (57.68%), Query Frame = 1
Query:  703 KVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNN----------VFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKL----FSWIERGLNCTELDRFIPLDSLKDIDKLT-NQSFRN----FLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELS---LTMYYSC--GLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSE---SIPLMRN-------NNQNCEINHQAFES------EPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXX----------------XXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            K+ Y P      ++I KAN TF  + N+   +  W L+  T +  ++              ++ D++   +A   +  ++  A+   F++ N  + +  +  +      WI+  ++   +D F      + I   T NQ++++    F +VI        L P     + Y+IR   S  + T + +    +W P P  NT   F Y L GF+++Q+ +++A I     ++ +E G+ + + PYPCY  D FL  + +++P  +V++W  SV + I+ IV EKE RLKE MK MGLNN VHWV+WFI+  V L I V  ++  L+  ++   S + +++  +  Y ++ I   F+VSV +SKA +AS  GGI+YF  Y+ ++ ++ +  E++   +T +  C   L+S  AF    K+   +E    G+Q+    Q+P E   F +   + ++++D+ +Y ++TWY+EAV PG YG+ +PW F   +SYW+ + ++     S P            +Q C +  + FE       EP +L L + +  L K+Y ++K   +N L+LN YE+Q+ +FLGHNGAGKTTT+SILTG+F P+SG+A I   DIRTEMD IR+ +G+CPQ+NVLFD LTVE+H++FY  LK M + EI     ++I+D++L+ K ++L   LSGGMKRKLS+A+AF+G SR + LDEPTAGVDP+ARR IWDL++KY+   RTI+L+THHMDEAD L DR+AIIS GKL+CCGS +FLK  +G+GY L+L+K       S                  +   + +F++ ++A + ++ ++  + + +LP   +    F  LF+ L+  +  + + S+GL DT+LEEVFLKV+++
Sbjct:  458 KILYAPVGSEADRVILKANETFAFVGNVTHYAQVW-LNISTEIRSFLEQGRLQQHLQWLQQYVADLQLHPEAMNLSLEELPPALRQDFSLPNGTALLQQLDTIDNAACGWIQF-MSKVSVDIFKGFPDEESIVNYTLNQAYQDNVTVFASVIFQTRKDGSLPPH----VHYKIRQNSSFTEKTNEIR--RAYWRPGP--NTGGRF-YFLYGFVWIQDMMERAIINTFVGHDVVEPGNYVQMFPYPCYTRDDFLFVIEHMMPLCMVISWVYSVAMTIQHIVAEKEHRLKEVMKTMGLNNAVHWVAWFITGFVQLSISVTALTAILKYGQVLMHSHVLIIWLFLAVYAVATIMFCFLVSVLYSKAKLASACGGIIYFLSYVPYM-YVAIREEVAHDKITAFEKCIASLMSTTAFGLGSKYFALYEVAGVGIQWHTFSQSPVEGDDFNLLLAVTMLMVDTVVYGVLTWYIEAVHPGMYGLPRPWYFPLQKSYWLGSGRTEAWEWSWPWAHTPRLSVMEEDQACAMESRHFEETRGMEEEPTHLPLVVCVDKLTKVYKNDKKMALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRLTVEEHLWFYSRLKSMAQEEIRKETDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILKYKP-GRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGAYGDGYRLTLVKQPAEPGTSQEPGLASSPSGCPRLSSCSEPQVSQFIRKHVASSLLVSDTSTELSYILPSEAVKKGAFERLFQQLEHSLDALHLSSFGLMDTTLEEVFLKVSEE 1323          

HSP 2 Score: 216.468 bits (550), Expect = 9.509e-56
Identity = 149/484 (30.79%), Postives = 242/484 (50.00%), Query Frame = 1
Query: 3715 WSPASILDIPMVSP-ECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQ-NSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSN-YIKYNMTDGYAKYDAFD-------WEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNN------KIKKTE-DFDISLEKNRMNSEQKFDDVLQVINLTKIY 5115
            W+ A  L   +  P  C CS  G         GG P   R++T  D L ++TG+N+S+YLL    R     +G   F                     ++ S+  S    + P+           +       +++  N+KGY SMP Y N L+N +LR+ +  S+ N   YGI+VTN+P+  +   +S    L   +V +AI++I+A+SF+ ASFV+FL+ E+ + +K  QFVSG NP +YW++N++WD++ Y++P    +II   FD  +Y    N  A + L + YG +I P MYP SF+   PS+A+V L   NL +G   T++TF+L + E  D+  +  N  LK  FLIFP Y+LG G+++++ N YI     + YAK   FD       W++ +  L ++ +              G +   L  M + ++           K  E D D++ E+ R+      +D++++ NLTK+Y
Sbjct: 1624 WTSAPSLPRLVHEPVRCTCSAQGTGFSCPSSVGGHPPQMRVVTG-DILTDITGHNVSEYLLFTSDRFRLHRYGAITF-------------------GNVQKSIPASFGARVPPMV----------RKIAVRRVAQVLYNNKGYHSMPTYLNSLNNAILRANLPKSKGNPAAYGITVTNHPMNKTSASLSLDYLLQGTDVVIAIFIIVAMSFVPASFVVFLVAEKSTKAKHLQFVSGCNPVIYWLANYVWDMLNYLVPATCCVIILFVFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITATVATFLLQLFEH-DKDLKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYIN----EYYAKIGQFDKMKSPFEWDIVTRGLVAMTV-------------EGFVGFFLTIMCQYNFLRQPQRLPVSTKPVEDDVDVASERQRVLRGDADNDMVKIENLTKVY 2059          

HSP 3 Score: 186.422 bits (472), Expect = 1.217e-46
Identity = 106/332 (31.93%), Postives = 182/332 (54.82%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIP---VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKE 3198
            + I NL K+Y S KI     ++ L L     +    LG NGAGKT+T  +LTG  S + G A++    +  ++  ++Q +G CPQ++ LFD LT  +H+  Y  L+ +   +   V+   ++ ++LT+  +  +   SGG KRKLS A+A IG    +FLDEPT G+DP ARR +W+L++      R+++LT+H M+E + L  R+AI+  G+L+C GS+  LK +FG+GY           + S++N +++++F      +A + E    +    L    I+     ++F  ++Q +  + I  Y +S T+L+ VF+  A    + +  +E
Sbjct: 2050 VKIENLTKVYKSRKIGRILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGEAFVNGHSVLKDLLQVQQSLGYCPQFDALFDELTAREHLQLYTRLRGIPWKDEAQVVKWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGRSVVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGY------MITVRTKSSQNVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHIS---LAQVFSKMEQVVGVLGIEDYSVSQTTLDNVFVNFAKKQSDNVEQQE 2372          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|O95477|ABCA1_HUMAN (Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3)

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 571/1687 (33.85%), Postives = 898/1687 (53.23%), Query Frame = 1
Query:  514 YNELGEIICGSPEND-FKLFMRNFIKNQRRKRSLLT--CQLIFQSFFQNSIVKFE---------------MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWR---------------LHFQTFLLDYISNNVF-------INDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTF---LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDL-TEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQ----------NPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWL------MMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWS----PASILDI--------PMVSPECDCS----KTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF-----QRLSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIK--KTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 5121
            Y  +  I+CG PE    K+   N+ ++   K        +   ++F+ NS   +                ++  L PL+ GK+ Y P+    RQ++ + N TF+ L         W                +     LLD   N+ F       ++   +   A+ + +P+   + N   ++   +   +  ++    I R + C  L++  P+ +      L N+S      R F A I+F      +TP +      + Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ ++QA I ++T  E  + G  M  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W SWFIS+++ L++   ++ V L+L  +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+     LLS VAF    ++   +E+   GVQ+ NLF++P E   F +   + +M+ D+F+Y ++TWY+EAVFPGQYG+ +PW F C +SYW       +S P    +NQ   I+    E EP +LKLG+SI NLVK+Y       ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYIL +DIR+EM +IRQ +G+CPQ+NVLFD LTVE+HI+FY  LK + +  +++ + ++  DV L + K+ + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   ++ ++++AR++E+   + T VLP        F ELF  +D  ++++ I SYG+S+T+LEE+FLKVA++     ++ E S  +      +       +    F             +P+ +++  L   D    + +KG+ L QQQ +AL  KR   A+R  KGF A+++LP + +   ++F  I     K   +++ PW+       +S    E+  T        L L+N L      D G  G RCM  NP    + +  C    E   W+    P +I+D+           SP C CS    K    +C     G  P   R   ++D L +LTG NISDYL+K +     + L  KI      +GG+   + N  A         P    + D++ Q +      ++    RFL     F      T N  ++W N+KG+ ++ ++ N+++N +LR+ ++  +N  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   TD      N+ILK VFLIFP + LGRG+ID+  N    +  + + +        W++    L ++ +              GV+  ++  +++  +F      N K+     ED D+  E+ R+      +D+L++  LTKIY R
Sbjct:  301 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNGTEEDAETFYDNSTTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPKIWTFMENSQEMDLVRMLLDSRDNDHFWEQQLDGLDWTAQDIVAFLAKHPEDVQSSNG--SVYTWREAFNETNQAIRTISRFMECVNLNKLEPIATEV---WLINKSMELLDERKFWAGIVFTG----ITPGSIELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGTEK-KTGVYMQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFTLKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWFGEESDEKSHP---GSNQK-RISEICMEEEPTHLKLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYR-QGRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE---SGVDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQYTFVSNDAPEDTGT--------LELLNALT----KDPG-FGTRCMEGNP----IPDTPCQAGEEE--WTTAPVPQTIMDLFQNGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGL-PPPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNTQAL--------PPSQEVNDAIKQMKKHLKLAKDSSADRFLNSLGRFMT-GLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TDNKLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAV-------------EGVVFFLITVLIQYRFFIRPRPVNAKLSPLNDEDEDVRRERQRILDGGGQNDILEIKELTKIYRR 1923          

HSP 2 Score: 180.644 bits (457), Expect = 5.220e-44
Identity = 101/320 (31.56%), Postives = 169/320 (52.81%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + I  L K+Y   + P ++ + +     +    LG NGAGK++T  +LTG  + + G A++    I + +  + Q +G CPQ++ + + LT  +H+ F+ LL+ + + E+  V    I+ + L +     + + SGG KRKLS AMA IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           + SN + + +  F  +    + + E+ R      LP    +      +F  L Q    + I  Y +S T+L++VF+  A D
Sbjct: 1912 LEIKELTKIYRRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIVVRIAGSNPDLKPVQDFFGLAFPGSVLKEKHRNMLQYQLPS---SLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKD 2223          

HSP 3 Score: 65.855 bits (159), Expect = 4.190e-9
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            QLR LLWKN   +RR+   LL+E+  PL +  IL +VR S   Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    6 QLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|P41233|ABCA1_MOUSE (Phospholipid-transporting ATPase ABCA1 OS=Mus musculus OX=10090 GN=Abca1 PE=1 SV=4)

HSP 1 Score: 850.892 bits (2197), Expect = 0.000e+0
Identity = 568/1679 (33.83%), Postives = 901/1679 (53.66%), Query Frame = 1
Query:  514 YNELGEIICGSPEND-FKLFMRNFIKNQRRKRSLL--TCQLIFQSFFQNSIVKFE---------------MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFK---ILDNLRLASVEWRLHFQTF------------LLDYISNNVF-------INDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTF---LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDL-TEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQ----------NPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWL------MMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWS----PASILDI--------PMVSPECDCS----KTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF-----QRLSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQP-----QNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 5121
            Y  +  I+CG PE    K+   N+ ++   K        +    +F+ NS   +                ++  L PL+ GK+ Y P+    RQ++ + N TF+   +  +L     E      TF            LLD   N+ F       ++   +   A+ + NP+   + N   ++   +   +  ++    I R + C  L++  P+ +     +L N+S      R F A I+F      +TP +      + Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ ++QA I ++T +E  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IKSIVYEKE+RLKE M++MGL+N + W SWF+S+++ L++   ++ V L+L  +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  ++     LLS VAF    ++   +E+   GVQ+ NLF++P E   F +   + +M+ D+F+Y ++TWY+EAVFPGQYG+ +PW F C +SYW       +S P     +    ++    E EP +L+LG+SI NLVK+Y       ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYIL +DIR+EM SIRQ +G+CPQ+NVLFD LTVE+HI+FY  LK + +  +++ + ++  DV L   K+ + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   ++ ++++AR++E+   + T VLP        F ELF  +D  ++++ I SYG+S+T+LEE+FLKVA++     ++ E S  +      +       +    F             +P+ +++  L   D    + LKG+ L QQQ +AL  KR   A+R  KGF A+++LP + +   ++F  I     K   +++ PW+       +S    E++ T             +L +    D G  G RCM  NP    + +  C    E+  W+    P SI+D+           SP C CS    K    +C     G  P   R   ++D L NLTG NISDYL+K +     + L  KI      +GG+   + N  A         P    + D++ Q +      ++    RFL     F      T N  ++W N+KG+ ++ ++ N+++N +LR+ ++  +N   YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   T+      N+ILK VFLIFP + LGRG+ID+  N    +  + + +        W++    L ++ +  +++++I ++I+     R      K+   N+     ED D+  E+ R+      +D+L++  LTKIY R
Sbjct:  301 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNNTEEDVDTFYDNSTTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPQIWTFMENSQEMDLVRTLLDSRGNDQFWEQKLDGLDWTAQDIMAFLAKNPEDVQSPNG--SVYTWREAFNETNQAIQTISRFMECVNLNKLEPIPTEV---RLINKSMELLDERKFWAGIVFTG----ITPDSVELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGSEK-KTGVYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKSIVYEKEARLKETMRIMGLDNGILWFSWFVSSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAMVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFSIKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTAVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWFGEEIDEKSHP----GSSQKGVSEICMEEEPTHLRLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE---SGVDAETSDGTLPARRNRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQYTFVSNDAPEDMGT------------QELLNALTKDPG-FGTRCMEGNP----IPDTPCLAGEED--WTISPVPQSIVDLFQNGNWTMKNPSPACQCSSDKIKKMLPVCPPGAGGL-PPPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNSQAL--------PPSHEVNDAIKQMKKLLKLTKDSSADRFLSSLGRFM-AGLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQKGENPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELF--TNNKLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVKAKLPPLND-----EDEDVRRERQRILDGGGQNDILEIKELTKIYRR 1923          

HSP 2 Score: 182.185 bits (461), Expect = 1.910e-44
Identity = 102/320 (31.87%), Postives = 169/320 (52.81%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + I  L K+Y   + P ++ + +     +    LG NGAGK+TT  +LTG    + G A++    I + +  + Q +G CPQ++ + + LT  +H+ F+ LL+ + + E+  V    I+ + L +     + + SGG KRKLS AMA IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           + SN + + + +F  +    + + E+ R      LP    +      +F  L Q    + I  Y +S T+L++VF+  A D
Sbjct: 1912 LEIKELTKIYRRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIVVRIAGSNPDLKPVQEFFGLAFPGSVLKEKHRNMLQYQLPS---SLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKD 2223          

HSP 3 Score: 65.855 bits (159), Expect = 4.051e-9
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            QLR LLWKN   +RR+   LL+E+  PL +  IL +VR S   Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    6 QLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|Q8IZY2|ABCA7_HUMAN (Phospholipid-transporting ATPase ABCA7 OS=Homo sapiens OX=9606 GN=ABCA7 PE=1 SV=3)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 508/1579 (32.17%), Postives = 825/1579 (52.25%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRL---HFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIF------NETFQYLTPK-NTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXX------------------------XXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCN---ILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD-----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIR--CMNPSIYRLDNYQCFYRNENNM----WSPASILDIPMVSPECDCSKTG-NQICNDLRSGGPPNSY--RIMTSSDKLNNLTGYNISDYLLKNFQRLSRKI-----------FGGYQFLLPNDFAQSSKLIAQ---------SPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLI-LLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYD------AFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 5118
            ++  L PLI GK+ + P+    R+++ + N TF+ L  LR     W +      TF+ D  +  +    ++   +      P   D +  L      +S++D  S  +SW             + R   C  LD+   L++      L +++ +      F A ++F      ++  ++ TP      +  +IR+ +  +  T K +  DRFW P P  +  TD +YV  GF++LQ+ +++A +  V +  +   G  +  MPYPCY+ D FL+ L+  LP  L +AW  SVT+ +K++V EKE+RL++ M+ MGL+  V W+ WF+S +   ++   ++ + L+L  I   S   VVF  +  + ++ + Q+F++S FFS+AN+A+  GG+ YF+ Y+ +V+ +     L      +  LLS VAF    + +   E+  EG Q+ N+   P   + F +     L+++D+ +Y L TWY+EAV PGQYG+ +PWNF   RSYW          P     +    +     E  P  L  G+S+ +L K +P +  P +  L+L+FY+  ITAFLGHNGAGKTTT+SIL+G+F PS G+A+IL  D+R+ M +IR  +G+CPQYNVLFD LTV++H++FYG LK +    +     R+++DV L  K +  + HLSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP +RRGIW+LL+KYR   RT+IL+THH+DEA+ L DRVA+++ G+L CCGS +FL+R  G GYYL+L+K +                             S      +L  V+ ++  AR++EE   +  +VLP    +   F  LF+ LD  +AE+ +  YG+SDTSLEE+FLKV ++       ++ S   + C     L + LR+     E  L        +   DQ         ++G+ L +QQ+ AL +KR+  A+R  +G  A+++LP L +   ++F  I         +++SP      M    ++ F        G    LE+     L E+G+    +  S +R    +        +    W+P S       SP C CS+ G  ++  D  +          +  S + + NLTG N+SD+L+K + RL R+            +GG+     +    S + + +         SP   G  D             R LK    + + S    +  +IW N+KG+ SM A+ N  SN +LR+ +        + I+  N+P+  ++ ++S+   +   ++V ++I V+ A+SF+ ASF + LI+ER++ +K  Q + G++P +YW+ NFLWD+  Y++P  I+++IF+AF  ++Y+   N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G   +M+TF+L++   +D+  +  + ILK+VFLIFP + LGRG+ID+  N     M D + +           WEV  + L ++++   L+ +  ++++       L    +V      +   ED D++ E+ R+       DVL + NLTK+Y 
Sbjct:  283 LWRRLKPLILGKLLFAPDTPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEAL------RSFLDPGSGGYSWQDAHADVGHLVGTLGRVTECLSLDK---LEAAPSEAALVSRALQLLAEHRFWAGVVFLGPEDSSDPTEHPTPDLGPGHVRIKIRMDIDVVTRTNKIR--DRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVR-VLSGANPRAGLYLQQMPYPCYVDDVFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCLGPFLLSAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACGGLAYFSLYLPYVLCVAWRDRLPAGGRVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVGTRPTADV-FSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPPKSPAPCPTPLDPKVLV-----EEAPPGLSPGVSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLKYR-EGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGSCGQHLCTGIAGLDVTLRLKMPPQETALENGEPAGSAPETDQGSGPDAVGRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSP-----TMYGAQVSFFSEDAPGDPGRARLLEAL----LQEAGLEEPPVQHSSHRFSAPEVPAEVAKVLASGNWTPES------PSPACQCSRPGARRLLPDCPAAAGGPPPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELWALLSPLPGGALD-------------RVLKNLTAWAH-SLDAQDSLKIWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHAHSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELF--SDQKLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQA---MADAFERLGDRQFQSPLRWEVVGKNLLAMVIQGPLFLLFTLLLQH---RSQLLPQPRVRSL--PLLGEEDEDVARERERVVQGATQGDVLVLRNLTKVYR 1803          

HSP 2 Score: 169.474 bits (428), Expect = 1.183e-40
Identity = 98/318 (30.82%), Postives = 157/318 (49.37%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + NL K+Y   ++P ++ L L     +    LG NGAGKT+T  ++TG    S G A +    +  E  +    +G CPQ + +F+ LT  +H+     L+ + + ++       +  + L+   +  +   SGG KRKL+ A+A +G+  VVFLDEPT G+DP ARR +W+ L+      R+++LT+H M+E + L  R+AI+  G+ +C GS   LK +F  G+ L+L         +         FV      A + E    +    LP     +     +F  L  H AE  +  + +S T LEEVFL  + D
Sbjct: 1795 LRNLTKVYRGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQPAA-------AFVAAEFPGAELREAHGGRLRFQLPPGGRCA--LARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKD 2103          

HSP 3 Score: 70.8626 bits (172), Expect = 1.331e-10
Identity = 34/80 (42.50%), Postives = 45/80 (56.25%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQ 264
             QL  LLWKNF  +RR+   LL+EL  PL + FIL AVR S    +   C F  K + S G +P+L   +C  N +C+ Q
Sbjct:    5 TQLMLLLWKNFMYRRRQPVQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLICNVNNTCFPQ 84          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|O35600|ABCA4_MOUSE (Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=2 SV=1)

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 514/1681 (30.58%), Postives = 862/1681 (51.28%), Query Frame = 1
Query:  523 LGEIICGSPE--------------NDFKLFMRNFIKNQRR-------KRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLR--------LASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSS--------ESIPL---MRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXI--------------------------------LKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLI-------NKEKSYYSYYCNILKMKLRINA----TKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWL--------MMSKMGKENLNTFYRKENISLGLINK-LESEYRSDLGESGIRCMNPSIYRLDNYQCFYRN--ENNMWSPASILDIPMVSPECDCSK----TGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSR-----------KIFGGYQF--LLPNDFAQSSKLIAQSPTWDGIRDSVNQS-----QPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNK-IKKT-------EDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 5118
            L +++CG PE              N++K F+   I + R+       KR+   C  + QS   N + K   +    PL+ GK+ + P+    R+I++ AN TF+ LD +R        +    W    ++  +  I + +    VK F            +AV   F+    +   D ++  F W +             + L C  LD+F   +S  D  +LT ++        F A ++F   + + +      + Y+IR+ +  ++ T K K  DR+W   PR +   DF+Y+  GF +LQ+ ++Q  ++     E   +G  +  MPYPC++ D F+  L    P  +V+AW  SV++ +K IV EKE RLKE +K  G++N V W +WF+ +  ++ + + ++++ +   +I   S   ++F  +  +  + I Q+F++S  FSKA++A+   G++YFT Y+  V+    +  ++  +  +  LLS VAF    ++++ +E+   G+Q+SN+ ++P E   F     + +M++D+ +Y L+ WY++ VFPG YG   PW FL   SYW+     S        ++ PL   M +      +N   FE E   L  G+ + NLVK++  +  P ++ LN+ FYE+QITAFLGHNGAGKTTT+SILTG+  P+SGT  I  +DI T +D +RQ +G+CPQ+N+LF  LTV +HI FY  LK     E +  +  +++D  L  K N  +  LSGGM+RKLS+A+AF+G+S+VV LDEPT+GVDP++RR IWDLL+KYRS  RTII++THHMDEAD L DR+AIISQG+L C G+ +FLK  FG G+YL+L++   N  +     E +                                +  V  ++ +A+++E    +   +LP  +   R +  LF+ L++ +A++ + S+G+SDT LEE+FLKV +D     +        +E++   + C+    KLR  A    T +   ++    Q   +  D       G  L+ Q + AL +KR+H+  R  K F+A+++LP   +   ++   I     +   + + PW+         M +   E+L           G  N+ L+ E+  +       C+N + ++  +      +  +   W+ A        SP C CS     T    C +  +GG P   R   S++ L +LT  NISDYL+K +  L R           + +GG      LP        L+       G+   +N S     +  + E L FLK+ +        T +  ++W N+KG+ ++ ++ N+  N +LR+ +   ++   YGI+V + P+  ++ ++S    L   ++  +AI VI A+SF+ ASFV++LI ER++ +K  QF+SG++P  YW++NFLWDIM Y +   +++ IFI F  ++Y    N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TF+L++ E+     R  N +L+K+ ++FP + LGRG+IDL+   +   +TD YA++      + F W++  + L ++ +              GV+  +L  +++  +F  + I +        ED D++ E+ R+ S     D+L++  LTK+Y+
Sbjct:  319 LSDLLCGYPEGGGSRVFSFNWYEDNNYKAFLG--IDSTRKDPAYSYDKRTTSFCNSLIQSLESNPLTKI-AWRAAKPLLMGKILFTPDSPAARRIMKNANSTFEELDRVRKLVKAWEEVGPQIWYFFEKSTQMTVIRDTLQHPTVKDFINRQLGEEGITTEAVLNFFSNGPQEKQADDMTS-FDWRDIFNITDRFLRLANQYLECLVLDKF---ESYDDEVQLTQRALSLLEENRFWAGVVFPGMYPWAS-SLPPHVKYKIRMDIDVVEKTNKIK--DRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGIVKSQMQAEP-PIGVYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKGIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMALSIFLLTLFIMHGRILHYSDPFILFLFLLAFATATIMQSFLLSTLFSKASLAAACSGVIYFTLYLPHVLCFAWQDRMTADLKTTVSLLSSVAFGFGTEYLVRFEEQGLGLQWSNIGKSPLEGDEFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEPLTEEMEDPEHPEGMNDSFFERELPGLVPGVCVKNLVKVFEPSGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLIGGKDIETNLDVVRQSLGMCPQHNILFHHLTVAEHILFYAQLKGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDSKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDPPKGQPSPEPEDPGVPFNTGARLILQHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMYGHQYTFFSMDEPNNEHLEVLADVLLNRPGFGNRCLKEEWLPE-----YPCINATSWKTPSVSPNITHLFQKQKWTAAH------PSPSCKCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPISGEALVG---FLSGLGQMMNVSGGPVTREASKEMLDFLKHLE--------TTDNIKVWFNNKGWHALVSFLNVAHNAILRASLPRDRDPEEYGITVISQPLNLTKEQLSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFENNRTLLR-FNAMLRKLLIVFPHFCLGRGLIDLA---LSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAI-------------EGVVYFLLTLLIQHHFFLTRWIAEPAREPVFDEDDDVAEERQRVMSGGNKTDILKLNELTKVYS 1947          

HSP 2 Score: 180.644 bits (457), Expect = 5.328e-44
Identity = 116/401 (28.93%), Postives = 193/401 (48.13%), Query Frame = 1
Query: 1966 VGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADA-RMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            +G  ++ M I+  +Y L+T  ++  F     +A+P     AR             P+   ++   E   +       N    + ++ L K+Y  +  P ++ L +     +    LG NGAGKTTT  +LTG  + +SG A +  + I T +  + Q +G CPQ++ + D LT  +H+Y Y  L+ +   EIE V    I+ + L+   + L+   SGG KRKLS A+A  G   ++ LDEPT G+DP ARR +W+ ++      R ++LT+H M+E + L  R+AI+ +G  QC G++  LK KFG+GY +++                   F   +     R    S LQ+        + S     +F+ L  H   + I  Y ++ T+L++VF+  A
Sbjct: 1874 IGKNLVAMAIEGVVYFLLTLLIQHHFFLTRWIAEP-----ARE------------PVFDEDDDVAEERQRVMSGG--NKTDILKLNELTKVYSGSSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTSISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKLSTAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGRAVVLTSHSMEECEALCTRLAIMVKGTFQCLGTIQHLKYKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQRERHHSMLQF-------QVPSSSLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVNFA 2248          

HSP 3 Score: 57.7658 bits (138), Expect = 1.158e-6
Identity = 26/77 (33.77%), Postives = 42/77 (54.55%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            Q++ LLWKN+ L++R+    ++EL  PL +  +L  +R++   Y    C F  K M S G +P+L    C  N  C+
Sbjct:    6 QIQLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNANPLYSQHECHFPNKAMPSAGLLPWLQGIFCNMNNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|Q7TNJ2|ABCA7_RAT (ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus OX=10116 GN=Abca7 PE=1 SV=1)

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 513/1615 (31.76%), Postives = 836/1615 (51.76%), Query Frame = 1
Query:  631 FQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWR-LHFQTFLLDYISNNVFINDVKKFCK----AYYSANPK----------ICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYL------TPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFG---------------------------------------------EGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVAD---------DPMNK---LINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYR--------LDNYQCFYRNENNMWSPASIL-------DIPMVSPECDCSKTG-NQICNDLRSGGPPNSYRIMTSS--DKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVN---------QSQPQN-LEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL--LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 5118
            F     +  V   ++  L PLI GK+ + P+    R+++ + N TF+ L  LR     W  L  Q F  ++++++  +  ++K        +    PK            D     +N     + +  ++++   I   L C  LD+   L+++   + L +++      R   A I+F      L      +P  T     +++I +   D T   K+ D+FW P P  +   D +YV  GF++LQ+ ++QA + +++  +S   G  +  MP+PCY+ D FL+ L+  LP  L +AW  SV + +K++V EKE+RL+E M+ MGL+  V W+ WF+S +   ++   ++ + L+L  I   S   VVF  +  + ++ + Q+F++S FFS+AN+A+  GG+ YF  Y+ +V+ +     L L    +  LLS VAF    + +   E+  +G Q+ NL   P E + F +      +++D+ IY L  WY+EAV PGQYG+ +PWNF   RSYW        S+  +    Q+ ++     E  P  L  G+SI  L K +  +  P +  LNL+FYE  ITAFLGHNGAGKTTT+SIL+G+F PSSG+A IL  D++T M +IR  +G+CPQYNVLFD LTVE+H++FYG LK +    I+S    +I+DV L  K +  + HLSGGM+RKLS+A+AF+G SRVV +DEPTAGVDP +RRGIW+LL+KYR   RT+IL+THH+DEA+ L DRVA+++ G L CCGS +FL+R  G                                             +G + S      +      +   IL+ V+ ++  A+++EE   +  + LP        F  +F+ LDQ +  + +  YG+SDT+LEE+FLKV +         DP  +   L    + +     ++L+     N    ++ L+    +  +    Q    ++G+ L  QQ+ AL  KR+  A+R  +G  A+++LP L +   + F  I     +  P+Q+SP      M    ++ F          +  LE+     LGE+G++  +PS+            +  C++         ASIL       D P  SP C CS+ G  ++  D  +G          +   + + NLTG N+SD+L+K +  L R+     +++    +   S L  + P     R+ V            QP N L+  R L    ++        N  +IW N+KG+ +M A+ N  +N LLR+ +        + I+  N+P+  ++ ++S+   LI   ++V ++I V+ A+SF+ ASF + LI+ERI+ +K  Q VSG+   +YW+ NFLWD+  Y++ + I+++IF+AF  ++Y+  +N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G  ++M+TF+L+++  +D+  +  + ILK+VFLIFP + LGRG+ID+  N     M D + +           W++  + L +++    L+ +I ++++    NR+L +    S     + + ED D+  E+ R+       DVL + +LTK+Y 
Sbjct:  267 FVGALDDHPVSRLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGVLGPQIF--NFMNDSTNVAMLQKLLDVEGTGWQQQTPKGQKQLEAIRDFLDPSRGRYNWQEAHADMGRLAEILGQI---LECVSLDK---LEAVPSEEALVSRALELLGERRLWAGIVFLSPEHPLDSSEPPSPTTTGPGHLRVKIRMDIDDVTRTNKIRDKFWDPGPSADPLMDLRYVWGGFVYLQDLLEQAAVRVLSGRDS-RAGLYLQQMPHPCYVDDVFLRVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMGLSRAVLWLGWFLSCLGPFLVSAALLVLVLKLGNILPYSHPVVVFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLAYFALYLPYVLCVAWRERLPLGGLLAVSLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGPAEDV-FSLAQVSAFLLLDAVIYGLALWYLEAVCPGQYGIPEPWNFPFRRSYWCGPGPPKSSV--LAPAPQDPKV---LVEEPPPGLVPGVSIRGLKKHFRGSPQPALRGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAIDSEQEHLIRDVGLIPKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYR-EGRTLILSTHHLDEAELLGDRVAMVASGSLCCCGSPLFLRRHLGCGYYLTLVKSSQSLVTHDLKGDTEDPRREKKSGSEGKTADTVLTRDGPHRSSQVPAPDAVPVTPSAALILELVQRHVPGAQLVEELPHELVLALPYAGALDGSFATVFQELDQQLERLGLTGYGISDTNLEEIFLKVVEEAHAHGEGGDPRQQQHLLTATPQPHTGPEASVLE-----NGELAKLVLDPQAPKGSAPTTAQ----VQGWTLTCQQLRALLHKRFLLARRSRRGLFAQIVLPALFVGLALFFTLIVPPFGQYPPLQLSP-----AMYGPQVSFFSEDAPADPNRMKLLEAL----LGEAGLQ--DPSVQGKGSRGSECTHSLACYFTVPEVPPDVASILASGNWTPDSP--SPACQCSQPGARRLLPDCPAGAGGPPPPQAMAGFGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGFS-LGGRDPDLPSGREVVRTVAEMRALLSPQPGNTLD--RILNNLTQW-ALGLDARNSLKIWFNNKGWHAMVAFVNRANNGLLRAFLPSGSVRHAHSITTLNHPLNLTKEQLSE-ATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVLIFLAFQQKAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELL--SDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQA---MADAFERLGDKQFQSPLRWDIIGKNLLAMVAQGPLFLLITLLLQH--RNRLLPQ--PKSRLPPPLGE-EDEDVVRERERVTKGATQGDVLVLRDLTKVYR 1828          

HSP 2 Score: 179.104 bits (453), Expect = 1.750e-43
Identity = 102/320 (31.87%), Postives = 164/320 (51.25%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMME--ESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + +L K+Y   + P +++L L     +    LG NGAGKT+T  ++TG   PSSG A +   ++  E  +  + +G CPQ + +FD LT  +H+  +  L+ + + ++       +  + L    +  +   SGG KRKL+ A+A +G+  VVFLDEPT G+DP ARR +W+ L+      R+++LT+H M+E + L  R+AI+  G+ +C GS   LK +FG G+                  E  + F+     DA + E   SRL++ +        +R F EL      H  E     + +S T+LEEVFL  + D
Sbjct: 1820 LRDLTKVYRGQRSPAVDHLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQEPSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNNLLSVVREGRSVVLTSHSMEECEALCTRLAIMVNGRFRCLGSAQHLKSRFGAGH-------TLTLRVPPDQPEPAIAFIVTTFPDAELREVHGSRLRFQLPPGGGCTLARVFRELAAQGKAHGVE----DFSVSQTTLEEVFLYFSKD 2128          

HSP 3 Score: 67.781 bits (164), Expect = 1.199e-9
Identity = 32/80 (40.00%), Postives = 44/80 (55.00%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQ 264
             QL  LLWKN+  +RR+   L++EL  PL + FIL AVR S    +   C F  K + S G +P+L   +C  N SC+  
Sbjct:    5 TQLMLLLWKNYTYRRRQPIQLVVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQH 84          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: W5LAQ7 (ATP binding cassette subfamily A member 1 OS=Astyanax mexicanus OX=7994 GN=ABCA1 PE=4 SV=2)

HSP 1 Score: 926.391 bits (2393), Expect = 0.000e+0
Identity = 624/1907 (32.72%), Postives = 1011/1907 (53.02%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITE-IYNSLPSGALNVPKF----------------MKWITSNPNEFIRLQNSFSYISKRI-VPLISTV--------------NKVM--SENETTIESG-YNELGEIICGSPE--------------NDFKLFMRNFIKNQRRKRSLLT------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSK-------LFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEG-YYXXXXXXXXXXXXXXXXXXXILKFVKI------------------------------------YIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD-------------PMNKLINKEKSYYSYYCNILK---MKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPMV--------SPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKI-----------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQ-NLEPL---RFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF---NNKIKK--TEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLC 5208
            IS QLR LLWKNF  +RR+   LLIE+  PL + FIL AVR +   Y+   C F  K M S G +P++   +C  N  C+             E    +GN  + I + L S A  +  +                +K + +N +    +  +F  + K + +PL S +              N+++  + N T   S  Y  +  I+CG PE              +++K    N+  +     S+        C  + ++   N I +  ++  L PL+ GK+ Y P+     +II++ N TF+ L  LR     W    +    +++ ++  ++ ++   +   +A         T +++ +V S++   S+        F+W             I R + C  LD+  P+ +    +KL N S      R F A IIF +  Q  + +    ++Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ I+Q+ I  VT  +  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV ++IK +VYEKE+RLKE M++MGL+N + W SWFIS+++ L++   ++ + L++  +   S   VVF  +  + +  I Q F++S  F++AN+A+  GGI+YFT Y+ +V+ +  +  + L       LLS VAF    ++   +E+   G+Q+ NLF +P E   + +   II+M +D+FIY ++TWY+EAVFPGQYG+ +PW F   +SYW +        P+++    N        E EP +L +G+ I NLVK+Y   K   +++L L FYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYI+ +DIR+E+ +IRQ +G+CPQ+NVLF  LTVE+H++FY  LK + + E+++ + +I+ D  L  K  + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP+ARRGIWDLL+KYR+  RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK   G G Y   + K      +S RN  + + +VK                                     ++ +ARM+E+   + T +LP        F ELF ++D H+A++ I SYG+SDT+LEE+FLKVA+D             P+ +   +  ++ + + + LK      R +  ++E+    +P+ +++ +L  SD    + ++G+ L +QQ +AL  KR+ YA+R  KGF A+++LP + +   ++F  I     K   + + PW+       E+  TF   +        +L +      G  G RCM      + +  C   +++  WS    P S+L++ M         SP C+CS  G +     C     G PP   +I +  D L NLTG NISDYL+K + ++  K            +GG+        A+S++++   P  + I D++ + +   NLE +   RFLK    F N    T N  +IW N+KG+ S+ A+ N+++N +LR+ +   ++   YGI+  N+P+  ++ ++SQ   +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P++YW++NF+WD+  Y++P  ++I+IF+ F  ++Y+ + N     LLL+ YG +I P MYP SF    PSTA+VVL + N+L+G   ++STF+L++  + +      N+ILK V LIFP + LGRG+ID+  N    +  + + +      F+W++  + L ++ +              GV+  ++  +++  +F   N K+     ED D++ E+ R+ S     D+L++  LTK+Y R                    QK AV+ LC
Sbjct:    3 ISTQLRLLLWKNFTYRRRQTLQLLIEIVWPLFIFFILIAVRLNYPPYEQHECHFPNKAMPSAGTLPWIQGIVCNANNPCFRHP-------TPGESPGVVGNFNDSIISRLFSDAKKILLYSQNDKSLDGFKELIHAVKALQNNTSGKQAVGVTFKSLGKLLEMPLTSLMFPQLASMRSWSDLRNEILFLTRNATGSPSQMYQAVSRIVCGHPEGGGLKIKSLNWYEDSNYKALFGNYNSSDEEPVSVYDNTSTPFCNNLMKNMETNPISRM-IWRALKPLLMGKILYTPHTPATHKIIKEVNRTFQELGVLRDLGGMWE-ETRPKAWNFMEHSEEMDLLRTLLQNNVTAAFFSAQLTGTQWSVQDVISFLTKQSEDTRPHGTAFTWRDVFNETDQAIMSISRFMECVNLDKLEPVSTE---EKLINDSLGLLDNRKFWAGIIFPD-IQSNSSELPPHVNYKIRMDIDNVERTNKIK--DAYWDPGPRADPFEDLRYVWGGFSYLQDVIEQSIIRAVTGTKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLMSAGLLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTVFARANLAAACGGIIYFTLYLPYVLCVAWQDYIGLPAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWKNLFSSPMEKDDYSLTTSIIIMYVDAFIYGVMTWYIEAVFPGQYGIPRPWYFPFTKSYW-FGEGDQRPTPILKGRKANS--GAVCIEEEPTHLDMGVYIENLVKVYRHGKKLAVDDLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSAIRQSLGVCPQHNVLFSMLTVEEHVWFYARLKGLSEEEVKAEIDQILYDTGLPHKRKSRTCELSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRT-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTLVKKEPEASLSSCRNSSSTVSYVKKDDEASESSSDAGLGSDHESDAATAIDISLISGLIIKHVPNARMVEDLGHEITYILPYESAKDGAFVELFHDMDDHLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEILSDGTFPIRR--RRRHAFGADHQSCLKPLTEDDRYDGNESEV----DPESRETDYLSGSDGKGSYQIQGWSLKRQQFLALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALQPWMY------EDQVTFISDDAPEDASTQRLLAALMEGPG-FGTRCMEGE--PIPDAPCTIGDDD--WSIPEVPESVLEVLMSQNWTMDNPSPACECSSDGKKKMLPECPASAGGLPPPQIKI-SERDTLQNLTGRNISDYLVKTYAQIIGKSLKNKVWVNEFRYGGFSL-----GARSTQVL---PPAEEIDDAIARVRVIFNLEKVTADRFLKSLSAFIN-GLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRANLPPEKDPSKYGITAFNHPLNLTKEQLSQVALVTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFIWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFEIPSTAYVVLTSVNILIGINGSVSTFVLELFGNNE--IGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPFEWDMVGKNLFAMAV-------------EGVVFFIITVLIQYRFFFKPNAKLSPIGEEDEDVARERQRIVSGAGQGDILELRELTKVYKR-------------------KQKPAVDRLC 1828          

HSP 2 Score: 194.126 bits (492), Expect = 1.231e-45
Identity = 105/320 (32.81%), Postives = 174/320 (54.37%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    +SG A++  + I  E+D + Q +G CPQ++ + D LT  +H+ FY +L+ + + E+  V    I+ + L +  +  +   SGG  RKLS AMA IG   VVFLDEPT G+DP ARR +W+ +       R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           +  + + + ++KF++  +  + + E+ R      LP    +      +F  L +H   + I  Y +S T+L++VF+  A D
Sbjct: 1807 LELRELTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTVVTSGEAFLARKSILREIDQVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEREVCEVAEWGIRKLGLVKYSDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIILRVAGPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLPS---SVSSLAHIFSILAKHKDFLRIEDYSVSQTTLDQVFVNFAKD 2118          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: N1PB02 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226736 PE=4 SV=1)

HSP 1 Score: 918.302 bits (2372), Expect = 0.000e+0
Identity = 560/1564 (35.81%), Postives = 882/1564 (56.39%), Query Frame = 1
Query:  619 CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANP---KICDAVNTLFNITNVKSY------IDGVSKLFSWIERGLNCTELDRFIPLDSLKDI--DKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIE-VGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXI--------------LKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDP--MNKLINKEKSYYS--------YYCNILKMKLRIN---ATKTE-----IFLNQNPDQKQSKFL----DQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMM-SKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPA-SILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSS-----KLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFN-NLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKI------KKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIY 5115
            C  +F+      + +   +  + P++ GK+ Y P+  ++R++I +AN TF  L  ++  + +W L     + +++SN+    +++ F   Y  +NP   +I      LFN    +S       I+    + + I + +NC E D+F P  + +D+    LT        A +IF+       P   T + Y+IR+   R+DST K +VLDRFWTP PR     D KYV+ GF ++Q+ ++ A I   T +   E +G ++   PYPCY+ DKF   ++  LP  ++++W  +V++L+K+IVYEKE RLKE MK MGL N VHW +WFI+  V++++ V ++ + L++  +   S  +V+F  +  + I+ I Q FM+SVFF +AN+A+   GILYF  ++ +    + E  +         LLS V+F     ++  +E+   G+Q+SN+ Q+  +   F +  CI +M++D+ IY++I WYVEAVFPGQ+G+ + W F   +SYW      ++ +P  R   +  +   Q  E EP++L LG+SI  L K+Y   +   ++ LNLNFYE QIT+FLGHNGAGKTTT+SILTG+F P+ GTA I  +DIRT+++ IR+ +G+CPQ+NVLFD LTVE+HI+FY  LK M + +I   +  +I D+ L  K N  S  LSGGMKRKLS+A+AF   S+VV LDEPTAGVDP+ARR IWDLL+KYR+  RTIIL+TH MDEAD L DR+AII+QGKL C GS +FLK  FG GYYL+L+K++    +++ +   +                F+   + +A ++E   ++ T  LP +  ++  F +LF++LD H++ + ++SYG+SDT+LEEVFLKVA++    N L  ++    +        Y   + ++  R     A+K       +  + NPD   S           + + G  L+ +Q +A+ IKR++Y +R  K F+++                       +  M+I PWLM  SK+   +L TF+  +  S      +E       G  G+RCM+P +Y L  ++C    E++ WS      D P    EC C ++G Q C    +G   + Y ++ ++D++ N+TG NISD++LK  Q   ++ +GG  F   ND  +++      + AQ  T     D+ N + P  +  L       E   K+  T   ++IW N+KGY SM AY NI++NL+LR+ +    +   YGIS+ N+P+  + +++  +     +++V +++ VI A+  I ASFV+FLI+ER+SGSK  QFVSG+NP VYWV+NF WD++ Y++  I+ I+IF+AF   +Y+   NA   + LL+ YG A  P MYP S F + PS+AFV+L   N+ +G I+T+STFIL+     ++     N I+ KVFL+ P Y LGRG+ID++ N +  ++ +   +      F W++    L SL +L + ++ + I IE       +Y M  +S    +I         ED D+  E+ R+       D+L +  LTK+Y
Sbjct:  358 CNDLFEQIESQQLTRI-FWRQIKPMVRGKIPYAPDTPVVRRLIREANQTFVTLVQVKQLAEDW-LKASPGISEFLSNSDQARNIRDFIDLYMMSNPGDAQIALVQRWLFNGPRDQSAYDWRDSIEYTDYVMTMIVQYMNCFEFDKFEPHKTEEDVVNTGLTYIGDNKLWAGLIFDIDSSENLP---THIKYKIRMDTDRVDSTSKSRVLDRFWTPGPRAKPLPDMKYVVYGFSYIQDMVEHAIIREHTGDSLDEDIGMTVQQFPYPCYINDKFTMAISRSLPLFMILSWIYAVSILVKAIVYEKEQRLKEVMKTMGLTNAVHWCAWFITAFVMMLLSVFLLLIVLKVGTVLEHSDGSVIFVFLLAFTIATIMQCFMISVFFQRANLAAACAGILYFIGHIPYTFCTQWEEYMRTWQKALASLLSSVSFGFGCSYIARYEEQGIGIQWSNIHQSVLQEDDFSMLACIFMMLVDALIYMIIAWYVEAVFPGQFGMPRSWYFFVTKSYWCGYEPGTDGMPNGRAGYE-MDSGQQGQEDEPKHLPLGVSIQKLCKVYKRGQKVAVDGLNLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTEGTAVIYGQDIRTDINEIRKSLGMCPQHNVLFDHLTVEEHIWFYSSLKGMPEEDIRKEMNAMIMDIGLPHKRNEYSAKLSGGMKRKLSVAIAFTAGSKVVILDEPTAGVDPYARRSIWDLLLKYRA-GRTIILSTHFMDEADILGDRIAIINQGKLCCVGSSLFLKSNFGGGYYLTLVKDERKGDSASTSDVKVENATEDGNAGEISTTAFIMERVPEAVLVESIGIEMTYQLPNDKSHTASFEKLFRDLDAHLSSLGLLSYGVSDTTLEEVFLKVANESEEANHLSEEDVRQGTERLTDGGMYARPVTRLSFRKRNFFASKDRESNELLDADGNPDSAVSTASISCNGTGSYKVTGLSLIPRQFLAIFIKRFNYLRRSKKAFISQ-----------------------EPAMEIHPWLMSPSKLQDSHLFTFFSNDLPSEAWTQAIEDLLTQKPG-LGVRCMDPDVYSLKGFRCV-DAEDSQWSNVEEDFDEP---EECSC-ESGYQRCPKGAAGAEASKY-LLPTTDEMYNMTGRNISDWILKTSQEYIKRRYGGLTFGERNDLLRANDTEVDSIFAQLATAAAGDDTNNVTLPGLILDL-------ENLIKNIATKRNAKIWFNNKGYVSMVAYMNIMNNLVLRAHLPPDTDPSRYGISLINHPMNRTSSQLYAYTLKASIVDVMISVSVIFAMCLIPASFVLFLIEERVSGSKHLQFVSGVNPVVYWVANFTWDMLNYLVSGILCILIFVAFQQNAYVSQTNAPCLVSLLLLYGWAATPMMYPASHFFNVPSSAFVILGCMNIFLGIISTLSTFILEAF--MEQELDEINAIIMKVFLVLPHYCLGRGLIDMTRNQLVADIFENLGETFFQSPFTWDIVGRNLLSLSILGVFFFFLNICIEYKFW---IYSMKCISPCKEQIPVNVEETDEEDIDVVRERERVTLGAASGDILTLEGLTKVY 1872          

HSP 2 Score: 192.586 bits (488), Expect = 3.587e-45
Identity = 117/372 (31.45%), Postives = 199/372 (53.49%), Query Frame = 1
Query: 2095 YWVYNIKS----SESIPLMRNNNQNCEINHQAFESEPENLKLG------ISIHNLVKLYPS---NKIP-VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADA-RMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            +W+Y++K      E IP+        +I+      E E + LG      +++  L K+Y S   NK    ++ L++  +  +    LG NGAGKTTT  +LTG    + G A++    IR+EM +I Q +G CPQ++ L   LT  +H+  Y  L+ +   ++++V    I+ + L      LS  LSGG KRKLS A+A +GN  V+FLDEPT G+DP ARR +W+ +       R+++LT+H M+E + L +R+ I+  G+ +C GS+  LK +FG+GY ++L    ++ ++  +           +     +    + LQ+ +  P +   S    ++F ++++   EMSI  Y +S T+L++VF+  A
Sbjct: 1817 FWIYSMKCISPCKEQIPVNVEETDEEDID---VVRERERVTLGAASGDILTLEGLTKVYKSPLKNKGHRAVDRLSVGVHSGECFGLLGVNGAGKTTTFKMLTGNIKSTDGDAHLAGHSIRSEMTAIHQNLGYCPQFDALCPLLTPREHLQMYARLRGVPAEDVDTVAEWGIEKLGLVNHAAKLSHQLSGGNKRKLSTAIALVGNPPVIFLDEPTTGMDPKARRFLWNCISGIIKDGRSVVLTSHSMEECEALCNRIVIMVNGQFKCIGSIQHLKNRFGDGYMITLKVTSSSDASQCQIQAVASNMESTFPGIVLKEQHHNMLQYQV--PSSVHTS--LADIFGHIERVREEMSIEDYSVSQTTLDQVFINFA 2181          

HSP 3 Score: 72.7886 bits (177), Expect = 1.154e-8
Identity = 53/184 (28.80%), Postives = 84/184 (45.65%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQA-KYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFI----------------------------GNITEIYNSLPSGALNVPKFMKWITSNPNEFI-RLQNSFSYISKRIVPLISTVNKVMSE 489
            QLR LLWKN +L+ R+   L+ EL  PL++  IL  V+  +  KY +  C F  K M S GP+PFL   +CT N +C+D  + +     LN ++  I                            G + E+ +   +G+L+    +  I  +P+E   R+Q+    +S  +V  I  +N   SE
Sbjct:    7 QLRLLLWKNTKLRLRQPARLVTELVWPLLLFLILAWVKLDRGLKYPIHECHFDGKSMPSAGPLPFLQSLVCTANNTCHDHGRPDEEPGVLNTYNTSILSELFLDLETLLGDQTSSDALVRLVRDFGTLRELNDLSNAGSLSCAFELGTILIDPDELTERIQSQNITLSDDVVAEIGNLNVNTSE 190          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A3P9L2N4 (Uncharacterized protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 898.271 bits (2320), Expect = 0.000e+0
Identity = 602/1792 (33.59%), Postives = 963/1792 (53.74%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGAL-NVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEI---ICGS----------PENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNN-VFINDVKKFCKAYYSANPKIC-DAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRF--IPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXX--------------------------------------XXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD--------PMNKLINKEKSYYSYYCNILKM-----KLRINATKTEI---FLNQNPDQKQSKFLD-QSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWSPA---SILDIPM--------VSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKIS-QFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 5121
            Q   LLWKNF L++R+   LL+E+  PL +  IL AVR++        C +  K M S G +P+L   +C  +  CY+          +N F+          NS  S  L NV           N  + L N   Y+  +   L+++ N+ M     +++   + +G     +CG           P +D +  M +  +N +       C  +  +      ++F ++    PL+ GKV Y P+    R ++E+AN TF  L  ++  +  W      F+  ++ N    +N+         +  P    DA N L             ++    + + L C EL++F  +P +     + L +     F A I+F E  Q  +     +L Y+IR+ +  +  T K  V +R W+P    N + + +Y+  GF +L++ ID A I L T+  S  +G  +  MPYPCY+ D FL+ LA  LP  + +AW  SV +++K IV +KESRLKE +++MGL   V+W +W ++ ++ + I  V++++ ++  K+   S  +VVF  +  + +S I + F++SVFFSKAN+A+  GG++YF  Y+  V+       +         LLS VAF    + +  +E+   G+Q+ N+  +P E   +     I++M++D+ IY ++TWY+E VFPGQYG+ +PW FL   SYW       E IP      +   + ++  E    N+K G+SI NLVK+Y + K   ++ L+++FYE+QIT+FLGHNGAGKTTT+SILTG+F P+SGTA I   DIRT+MDSIR+ +G+CPQ+NVLFD LTVE+HIYFYG LK ++ +E+++ + ++IKDV L  K   L  +LSGGM+RKLS+A+AF+G S++V LDEPTAGVDPFARRGIWDLL+KY+   RTIIL+THHMDEAD L DR+AIIS GK++CCGS +FLK+ FG GYYL+L+++      + R+G                                      +++ +FV+ ++ +   +E    + T +LP        F  LF+ LD+ M ++ + SYG+SDT+LEE+FLKVA+D        P  + + K+    S       M     K     TK E+     N+  D K+S  ++ +   ++ G+ L++QQ +AL IKR+H+A+R  KG +A+++LP + +   ++F  I         +++ PW+  S+       TFY  +      ++++      + G  G RCM  NP I RL    C     ++ +SP+   S+ DI +         SP C CS  G  I    C     G  P   R+  ++D L NLT  N++D+LLK ++   +K +GG      N    S  L+ +    +      N   P N + ++      E   K   T N  ++W  +KG+ SM ++ ++++N +LR  +   Q+   YG+SV+N+P+  S+ ++S         +V ++I VI A+SFI ASFV+FLI ER+S +K  QFVSG+NP VYWV++F+WDI  YIIP  +++ IFI F  ++Y+  +N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF++++ E  DE+    N I+K+V LIFP + LGRG++D++ N    N+   + +    D   W +  + L ++ +   + +   +     +I    +   ++S    + ++ ED D++ E++R++  +  +DVL++ +LTK+Y R
Sbjct:    6 QFSLLLWKNFTLRKRQKVRLLVEILWPLFLFVILVAVRTTTKPVNKGQCHYPNKAMPSAGLLPWLQGMMCNIDNPCYNDPTPGETPGQVNNFN----------NSTASQILINVQ----------NLLLELSNGQGYLESKADVLVNSTNEAMK----SLDFQNDPIGSFSMFLCGKKPSSNSTFRFPTSDQQDTMNSSFQNSQDSDPF--CTTLIDTMVTTPSMQF-LWKNFRPLLKGKVLYTPDTPAARLLVEEANATFMALAAIKEFADSWG-EDGPFVWGFVENGTAVVNESSANSNNSSADTPPTSEDAYNDL-------------TQFLKLLSKVLGCFELNKFEAVPTEYQLVTEALEHLKNDTFWAGIVF-ENLQPNSSSIPPYLKYKIRMDVEEVQRTDK--VENRLWSPGANDNPYENLRYIWGGFAYLEDIIDHASIRLQTST-SQPLGVYVQQMPYPCYVDDPFLRALAGFLPLFMTIAWIFSVALIVKGIVGDKESRLKETVRIMGLRGEVYWSTWLLTCLLPMAISSVLLTIIIKYGKVLQYSDPSVVFIFLLVFCLSTISECFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFQAKVGVSLLSCVAFGYGCENLSKFEEQGVGIQWHNIATSPEEGQRYTFIVSILMMLLDAAIYWVLTWYIENVFPGQYGIPRPWYFLFTYSYWFGKTSVPEDIPDNFKLLKRSSVPNEFLEKPDPNMKAGVSIRNLVKIYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDSIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPFARRGIWDLLLKYK-KGRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPADLKHVTQFVRKHVPEVVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNTKDELKKKLSNKVEDFKKSASVNGRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQ------TTFYSNDMPEDANVSRVVETLVDNPG-FGTRCMEGNP-IPRL---PC-SSGASDWFSPSVDQSVADIFLNGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGISVGGIN----SQVLLTEVEIEEAF---ANLELPGNGDTIQ----KAEMVLKKLGTRNNVKVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQDLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYIIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTL-----LIQYKFFYKPRLSLPKVQSEEKEDVDVARERHRVHEGRANNDVLRICDLTKVYPR 1720          

HSP 2 Score: 198.749 bits (504), Expect = 4.953e-47
Identity = 116/336 (34.52%), Postives = 178/336 (52.98%), Query Frame = 1
Query: 2170 HQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESR--LQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            H+  E    N  L I   +L K+YP    P +  L +    ++    LG NGAGKTTT  +LTG    SSG A++    IRT+M  + Q +G CPQ++ + D L   +H+  Y  L+ + + E+  V    I+ + L +  N  +   SGG KRKLS AMA IG   V+FLDEPT G+DP ARR +WD ++      R+++LT+H M+E + L  R+AI+  G+ QC GS+  LK +FG+GY                + + +  FV+     + + E+    LQ+ + L Q    ++ FTE    L  H  E+ +  Y +S T+L++VF+  A +
Sbjct: 1697 HRVHEGRANNDVLRIC--DLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGY-----TLIVRVGGCPPDLKPVEDFVEETFPGSVLKEKHHNTLQYQL-LSQEGALAKIFTE----LTDHQQELDLEDYSVSQTTLDQVFVNFAKE 2020          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A3P9L2H4 (Uncharacterized protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 604/1792 (33.71%), Postives = 961/1792 (53.63%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGAL-NVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEI---ICGS----------PENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNN-VFINDVKKFCKAYYSANPKIC-DAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRF--IPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXX--------------------------------------XXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD--------PMNKLINKEKSYYSYYCNILKM-----KLRINATKTEI---FLNQNPDQKQSKFLD-QSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWSPA---SILDIPM--------VSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKIS-QFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 5121
            Q   LLWKNF L++R+   LL+E+  PL +  IL AVR++        C +  K M S G +P+L   +C  +  CY+          +N F+          NS  S  L NV           N  + L N   Y+  +   L+++ N+ M     +++   + +G     +CG           P +D +  M +  +N +       C  +  +      ++F ++    PL+ GKV Y P+    R ++E+AN TF  L  ++  +  W      F+  ++ N    +N+         +  P    DA N L             ++    + + L C EL++F  +P +     + L +     F A I+F E  Q  +     +L Y+IR+ +  +  T K  V +R W+P    N + + +Y+  GF +L++ ID A I L T+  S  +G  +  MPYPCY+ D F+Q +  +LP  L++A+  SV + IK +V EKE RLKE ++ +G+ N   W S F  T+++L +P V+MSV ++  K+   S  +VVF  +  + +S I + F++SVFFSKAN+A+  GG++YF  Y+  V+       +         LLS VAF    + +  +E+   G+Q+ N+  +P E   +     I++M++D+ IY ++TWY+E VFPGQYG+ +PW FL   SYW       E IP      +   + ++  E    N+K G+SI NLVK+Y + K   ++ L+++FYE+QIT+FLGHNGAGKTTT+SILTG+F P+SGTA I   DIRT+MDSIR+ +G+CPQ+NVLFD LTVE+HIYFYG LK ++ +E+++ + ++IKDV L  K   L  +LSGGM+RKLS+A+AF+G S++V LDEPTAGVDPFARRGIWDLL+KY+   RTIIL+THHMDEAD L DR+AIIS GK++CCGS +FLK+ FG GYYL+L+++      + R+G                                      +++ +FV+ ++ +   +E    + T +LP        F  LF+ LD+ M ++ + SYG+SDT+LEE+FLKVA+D        P  + + K+    S       M     K     TK E+     N+  D K+S  ++ +   ++ G+ L++QQ +AL IKR+H+A+R  KG +A+++LP + +   ++F  I         +++ PW+  S+       TFY  +      ++++      + G  G RCM  NP I RL    C     ++ +SP+   S+ DI +         SP C CS  G  I    C     G  P   R+  ++D L NLT  N++D+LLK ++   +K +GG      N    S  L+ +    +      N   P N + ++      E   K   T N  ++W  +KG+ SM ++ ++++N +LR  +   Q+   YG+SV+N+P+  S+ ++S         +V ++I VI A+SFI ASFV+FLI ER+S +K  QFVSG+NP VYWV++F+WDI  YIIP  +++ IFI F  ++Y+  +N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF++++ E  DE+    N I+K+V LIFP + LGRG++D++ N    N+   + +    D   W +  + L ++ +   + +   +     +I    +   ++S    + ++ ED D++ E++R++  +  +DVL++ +LTK+Y R
Sbjct:    6 QFSLLLWKNFTLRKRQKVRLLVEILWPLFLFVILVAVRTTTKPVNKGQCHYPNKAMPSAGLLPWLQGMMCNIDNPCYNDPTPGETPGQVNNFN----------NSTASQILINVQ----------NLLLELSNGQGYLESKADVLVNSTNEAMK----SLDFQNDPIGSFSMFLCGKKPSSNSTFRFPTSDQQDTMNSSFQNSQDSDPF--CTTLIDTMVTTPSMQF-LWKNFRPLLKGKVLYTPDTPAARLLVEEANATFMALAAIKEFADSWG-EDGPFVWGFVENGTAVVNESSANSNNSSADTPPTSEDAYNDL-------------TQFLKLLSKVLGCFELNKFEAVPTEYQLVTEALEHLKNDTFWAGIVF-ENLQPNSSSIPPYLKYKIRMDVEEVQRTDK--VENRLWSPGANDNPYENLRYIWGGFAYLEDIIDHASIRLQTST-SQPLGVYVQQMPYPCYVDDPFIQSIGAILPMFLILAFMSSVAMTIKGLVLEKELRLKEVLRGVGIRNGALWSSTFTETMILLTVPCVLMSVMVKYGKVLQYSDPSVVFIFLLVFCLSTISECFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFQAKVGVSLLSCVAFGYGCENLSKFEEQGVGIQWHNIATSPEEGQRYTFIVSILMMLLDAAIYWVLTWYIENVFPGQYGIPRPWYFLFTYSYWFGKTSVPEDIPDNFKLLKRSSVPNEFLEKPDPNMKAGVSIRNLVKIYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDSIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPFARRGIWDLLLKYK-KGRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPADLKHVTQFVRKHVPEVVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNTKDELKKKLSNKVEDFKKSASVNGRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQ------TTFYSNDMPEDANVSRVVETLVDNPG-FGTRCMEGNP-IPRL---PC-SSGASDWFSPSVDQSVADIFLNGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGISVGGIN----SQVLLTEVEIEEAF---ANLELPGNGDTIQ----KAEMVLKKLGTRNNVKVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQDLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYIIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTL-----LIQYKFFYKPRLSLPKVQSEEKEDVDVARERHRVHEGRANNDVLRICDLTKVYPR 1720          

HSP 2 Score: 198.749 bits (504), Expect = 4.870e-47
Identity = 116/336 (34.52%), Postives = 178/336 (52.98%), Query Frame = 1
Query: 2170 HQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESR--LQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            H+  E    N  L   I +L K+YP    P +  L +    ++    LG NGAGKTTT  +LTG    SSG A++    IRT+M  + Q +G CPQ++ + D L   +H+  Y  L+ + + E+  V    I+ + L +  N  +   SGG KRKLS AMA IG   V+FLDEPT G+DP ARR +WD ++      R+++LT+H M+E + L  R+AI+  G+ QC GS+  LK +FG+GY                + + +  FV+     + + E+    LQ+ + L Q    ++ FTE    L  H  E+ +  Y +S T+L++VF+  A +
Sbjct: 1697 HRVHEGRANNDVL--RICDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGY-----TLIVRVGGCPPDLKPVEDFVEETFPGSVLKEKHHNTLQYQL-LSQEGALAKIFTE----LTDHQQELDLEDYSVSQTTLDQVFVNFAKE 2020          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A0U2QQ09 (ATP-binding cassette transporter subfamily A member 1-like protein OS=Oryzias melastigma OX=30732 PE=2 SV=1)

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 609/1799 (33.85%), Postives = 969/1799 (53.86%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICG---SPENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFE----MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRF--IPLD---SLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNP--GESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNN---NQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILK--------------------------------------FVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDP-MNKLIN----------KEKSYYSYYCNILKMKLRINATK-----TEIFLNQNPD-QKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPA---SILDIPMV--------SPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQ--SQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKIS-QFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF------NNKIK--KTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 5121
            Q   LLWKNF L++R+   LL+E+  PL + FIL  VR++        C +  K M S G +P+L   +C  +  C +          +N F+  I  I++I  +L S  L +P+   W     N    L NS +            VN +  +N+       N    ++CG   S  + FK        N     +       F + F +++V       ++N   PL+ GK+ Y P+    R ++E+AN TF  L  ++  +  W    Q  ++  I  N+ + +  +F   + +++          +N          V+++ S I + L C EL++F  +P +     K +D L N +   F A I+F E  Q  + +   +L Y+IR+ +  +  T   KV  R W+P  R N + D +Y+  GF +L++ ID A I L T+     +G  +  MPYPCY+ D F+Q +  +LP  L++A+  SV++ IK +V EKE RLKE ++ +G+ N   W S F  T+++L +P V++SV ++  K+   S  +VVF  +  +  + I Q F++SVFFSKAN+A+  GG++YF  Y+  V+       +         LLS VAF    + +  +E+   G+Q+ N+ ++P  GES  F V   I++M++D+ IY ++TWY+E VFPGQYG+ KPW FL   SYW        ++P   +N    +   + ++  E    N+K G+SI NLVK+Y + K   ++ L+++FYE+QIT+FLGHNGAGKTTT+SILTG+F P+SGTA I   DIRT+MD+IR  +G+CPQ+NVLFD LTVE+HIYFYG LK ++ +E+++ + ++IKDV L  K   L+ +LSGGM+RKLS+A+AF+G S++V LDEPTAGVDPFARRGIWDLL+KY+   RTIIL+THHMDEAD L DR+AIIS GK++CCGS +FLK+ FG GYYL+L+++      + R+G  + K                                      FV+ ++ +A  +E    + T +LP        F  LF+ LDQ M ++ + SYG+SDT+LEE+FLKVA+D  ++K I+          K+ S  S   +I ++  R    K      E F N+  D +K +    +   ++ G+ L+++Q +AL IKR+H+A+R  KG +A+++LP + +   ++F  I     +   +++ PW     M   +  TFY  +       +++      + G  G RCM      +    C     ++ +SP+   SI DI +         SP C CS  G  I    C     G  P   R+  ++D L NLTG N++D+L+K ++   +K +GG      N    S  ++ +    D  R   N      + +    F K   E   K   T N  ++W  +KG+ SM ++ ++ +N +LR  +    N   YG+SV+N+P+  S+ ++S         +V ++I VI A+SFI ASFV+FLI ER+S +K  QFVSG+NP +YW+++F WDI  YIIP  ++++IF+ F  ++Y+   N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF+++I +D + T+   N+I+K+V L+FP + LGRG++D++ N I   +   + +    D   W +  + L ++ +             +G +      +++  +F      + KI+  + ED D++ E+ R+   +  +D+L++ +LTK+Y R
Sbjct:    6 QFSLLLWKNFTLRKRQKVRLLVEILWPLFLFFILVTVRTTTKPSNKGQCHYPNKAMPSAGVLPWLQSMMCNIDNPCSNYPTPGETPGQVNNFNDSI--ISKILINLQSFLLEIPEEGLW----SNSMESLVNSSA----------EAVNSLDFQNDPI-----NSFSMLLCGKQLSSNSTFKFPESEQTYNINSSSNSSQGSDPFCTSFIDTLVNTPSMNFLWNNFRPLLRGKILYTPDTPAARLLVEEANSTFSTLAAIKELADSWGK--QGPIIWNIVENITVLET-EFGADFNNSDGDPPSTSRDAYN---------NVTQIMSLISKILGCFELNKFEAVPTEYELVTKSLDHLNNDT---FWAGIVF-ENLQPNSSRIPPYLKYKIRMDVEEVQRTD--KVESRLWSPGARDNPYEDLRYIWGGFAYLEDIIDHASIRLQTSKNQ-PLGVFVQQMPYPCYVDDPFIQSIGAILPMFLILAFMSSVSMTIKGLVLEKELRLKEVLRAVGIQNGALWFSTFTETMILLTVPCVLISVMVKYGKVLQYSDPSVVFVFLLVFCFATISQCFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFNAKVGVSLLSCVAFGYGCENLSKYEEQGVGIQWHNIAKSPEEGESYTFIVS--ILMMLLDAVIYWVLTWYIENVFPGQYGIPKPWYFLFTSSYWC----GKTAVPEDTDNFDKLKGSSVQNEYMEKPDPNMKAGVSIRNLVKVYKTGKKVAVDGLSMDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDTIRGCLGMCPQHNVLFDELTVEEHIYFYGRLKGLNGSELKTEMDQMIKDVGLLHKRKDLAKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPFARRGIWDLLLKYK-KGRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEIMTAQRSGIILGKIEEEPNESDSPSGSSLDEGFGSQSSDNSNPADLNHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDQVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKEISPTKEPVVKDYKKNSRESKRRSISRLHGRAEKAKGKDELKEKFCNKVEDCRKNASVSGRGSVVITGWELIRRQFLALFIKRFHHARRSRKGLIAQVVLPAVFVCLALVFSLIVPSFTEYPNLELQPW-----MYDASQTTFYSDDTPDDANASRVVETLVDNPG-FGTRCMEGD--PIPGLPC-SSGASDWFSPSVDQSIADIFLTGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTGINMTDFLVKTYEHSGKKRYGGISVGGIN----SQVILTEVEIEDAFRKLRNTFFWSERGIPEDTFQK--AEMVLKRLGTRNNVKVWFYNKGWHSMVSFLSVANNGILRGNLPEGLNVRQYGLSVSNHPLNLSKEQMSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPAIYWIASFTWDICNYIIPCFLVVVIFVCFQQKAYVSPPNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCVNLFIGINGSVATFVMEIFDDENITY--INDIVKQVLLVFPHFCLGRGLMDMARNQIMATIYSNFGEDRFEDPLSWNMTGKNLVAMAI-------------QGAVMFAFTLLIQYKFFYKPRLASPKIRSEEEEDEDVARERQRVYEGRAENDMLRIRDLTKVYPR 1726          

HSP 2 Score: 204.142 bits (518), Expect = 9.282e-49
Identity = 113/332 (34.04%), Postives = 174/332 (52.41%), Query Frame = 1
Query: 2170 HQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             + +E   EN  L   I +L K+YP    P +  L +    ++    LG NGAGKTTT  +LTG    SSG A++    IRT+M  + Q +G CPQ++ + D LT  +H+  Y  L+ + ++E+  V    IK + L +  N  +   SGG KRKLS AMA IG   V+FLDEPT G+DP ARR +WD ++      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY                  + +  FV+     + + E+        LP N+       ++F  L  H   + +  Y +S T+L++VF+  A
Sbjct: 1703 QRVYEGRAENDML--RIRDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMSDVHQNMGYCPQFDAINDLLTGREHLELYARLRGVPEHEVAMVAEWGIKKLGLVQYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFKCLGSIQHLKNRFGDGY-----TLIVRVGGRPPVLKPVEDFVEETFPGSVLKEKHHNTLQYQLPNNE---GALAKIFNELTHHQQRLDLEDYSVSQTTLDQVFVNFA 2024          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: ENSAMXT00000016919.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:9912642:9956080:1 gene:ENSAMXG00000016432.2 transcript:ENSAMXT00000016919.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 926.391 bits (2393), Expect = 0.000e+0
Identity = 624/1907 (32.72%), Postives = 1011/1907 (53.02%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITE-IYNSLPSGALNVPKF----------------MKWITSNPNEFIRLQNSFSYISKRI-VPLISTV--------------NKVM--SENETTIESG-YNELGEIICGSPE--------------NDFKLFMRNFIKNQRRKRSLLT------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSK-------LFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEG-YYXXXXXXXXXXXXXXXXXXXILKFVKI------------------------------------YIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD-------------PMNKLINKEKSYYSYYCNILK---MKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPMV--------SPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKI-----------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQ-NLEPL---RFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF---NNKIKK--TEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLC 5208
            IS QLR LLWKNF  +RR+   LLIE+  PL + FIL AVR +   Y+   C F  K M S G +P++   +C  N  C+             E    +GN  + I + L S A  +  +                +K + +N +    +  +F  + K + +PL S +              N+++  + N T   S  Y  +  I+CG PE              +++K    N+  +     S+        C  + ++   N I +  ++  L PL+ GK+ Y P+     +II++ N TF+ L  LR     W    +    +++ ++  ++ ++   +   +A         T +++ +V S++   S+        F+W             I R + C  LD+  P+ +    +KL N S      R F A IIF +  Q  + +    ++Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ I+Q+ I  VT  +  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV ++IK +VYEKE+RLKE M++MGL+N + W SWFIS+++ L++   ++ + L++  +   S   VVF  +  + +  I Q F++S  F++AN+A+  GGI+YFT Y+ +V+ +  +  + L       LLS VAF    ++   +E+   G+Q+ NLF +P E   + +   II+M +D+FIY ++TWY+EAVFPGQYG+ +PW F   +SYW +        P+++    N        E EP +L +G+ I NLVK+Y   K   +++L L FYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYI+ +DIR+E+ +IRQ +G+CPQ+NVLF  LTVE+H++FY  LK + + E+++ + +I+ D  L  K  + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP+ARRGIWDLL+KYR+  RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK   G G Y   + K      +S RN  + + +VK                                     ++ +ARM+E+   + T +LP        F ELF ++D H+A++ I SYG+SDT+LEE+FLKVA+D             P+ +   +  ++ + + + LK      R +  ++E+    +P+ +++ +L  SD    + ++G+ L +QQ +AL  KR+ YA+R  KGF A+++LP + +   ++F  I     K   + + PW+       E+  TF   +        +L +      G  G RCM      + +  C   +++  WS    P S+L++ M         SP C+CS  G +     C     G PP   +I +  D L NLTG NISDYL+K + ++  K            +GG+        A+S++++   P  + I D++ + +   NLE +   RFLK    F N    T N  +IW N+KG+ S+ A+ N+++N +LR+ +   ++   YGI+  N+P+  ++ ++SQ   +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P++YW++NF+WD+  Y++P  ++I+IF+ F  ++Y+ + N     LLL+ YG +I P MYP SF    PSTA+VVL + N+L+G   ++STF+L++  + +      N+ILK V LIFP + LGRG+ID+  N    +  + + +      F+W++  + L ++ +              GV+  ++  +++  +F   N K+     ED D++ E+ R+ S     D+L++  LTK+Y R                    QK AV+ LC
Sbjct:    3 ISTQLRLLLWKNFTYRRRQTLQLLIEIVWPLFIFFILIAVRLNYPPYEQHECHFPNKAMPSAGTLPWIQGIVCNANNPCFRHP-------TPGESPGVVGNFNDSIISRLFSDAKKILLYSQNDKSLDGFKELIHAVKALQNNTSGKQAVGVTFKSLGKLLEMPLTSLMFPQLASMRSWSDLRNEILFLTRNATGSPSQMYQAVSRIVCGHPEGGGLKIKSLNWYEDSNYKALFGNYNSSDEEPVSVYDNTSTPFCNNLMKNMETNPISRM-IWRALKPLLMGKILYTPHTPATHKIIKEVNRTFQELGVLRDLGGMWE-ETRPKAWNFMEHSEEMDLLRTLLQNNVTAAFFSAQLTGTQWSVQDVISFLTKQSEDTRPHGTAFTWRDVFNETDQAIMSISRFMECVNLDKLEPVSTE---EKLINDSLGLLDNRKFWAGIIFPD-IQSNSSELPPHVNYKIRMDIDNVERTNKIK--DAYWDPGPRADPFEDLRYVWGGFSYLQDVIEQSIIRAVTGTKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLMSAGLLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTVFARANLAAACGGIIYFTLYLPYVLCVAWQDYIGLPAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWKNLFSSPMEKDDYSLTTSIIIMYVDAFIYGVMTWYIEAVFPGQYGIPRPWYFPFTKSYW-FGEGDQRPTPILKGRKANS--GAVCIEEEPTHLDMGVYIENLVKVYRHGKKLAVDDLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSAIRQSLGVCPQHNVLFSMLTVEEHVWFYARLKGLSEEEVKAEIDQILYDTGLPHKRKSRTCELSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRT-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTLVKKEPEASLSSCRNSSSTVSYVKKDDEASESSSDAGLGSDHESDAATAIDISLISGLIIKHVPNARMVEDLGHEITYILPYESAKDGAFVELFHDMDDHLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEILSDGTFPIRR--RRRHAFGADHQSCLKPLTEDDRYDGNESEV----DPESRETDYLSGSDGKGSYQIQGWSLKRQQFLALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALQPWMY------EDQVTFISDDAPEDASTQRLLAALMEGPG-FGTRCMEGE--PIPDAPCTIGDDD--WSIPEVPESVLEVLMSQNWTMDNPSPACECSSDGKKKMLPECPASAGGLPPPQIKI-SERDTLQNLTGRNISDYLVKTYAQIIGKSLKNKVWVNEFRYGGFSL-----GARSTQVL---PPAEEIDDAIARVRVIFNLEKVTADRFLKSLSAFIN-GLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRANLPPEKDPSKYGITAFNHPLNLTKEQLSQVALVTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFIWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFEIPSTAYVVLTSVNILIGINGSVSTFVLELFGNNE--IGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPFEWDMVGKNLFAMAV-------------EGVVFFIITVLIQYRFFFKPNAKLSPIGEEDEDVARERQRIVSGAGQGDILELRELTKVYKR-------------------KQKPAVDRLC 1828          

HSP 2 Score: 194.126 bits (492), Expect = 4.663e-49
Identity = 105/320 (32.81%), Postives = 174/320 (54.37%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    +SG A++  + I  E+D + Q +G CPQ++ + D LT  +H+ FY +L+ + + E+  V    I+ + L +  +  +   SGG  RKLS AMA IG   VVFLDEPT G+DP ARR +W+ +       R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           +  + + + ++KF++  +  + + E+ R      LP    +      +F  L +H   + I  Y +S T+L++VF+  A D
Sbjct: 1807 LELRELTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTVVTSGEAFLARKSILREIDQVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEREVCEVAEWGIRKLGLVKYSDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIILRVAGPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLPS---SVSSLAHIFSILAKHKDFLRIEDYSVSQTTLDQVFVNFAKD 2118          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 817.379 bits (2110), Expect = 0.000e+0
Identity = 528/1576 (33.50%), Postives = 842/1576 (53.43%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAV-----NTLFNITNVKSYIDGVSK--------------LFSWIERGL-------NCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXX---------------------------XXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKE-KSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMW-----SPASILDI----------PMVSPECDCSK----TGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF--------NNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 5118
            M+N L P + GK+ Y P+   IRQ+I+ AN TF+ L+ LR     W       L D+  +N+ ++ ++   +     NP + D +     NT   I ++ +++   S+              +F+  +R L        C  LD+F+    L D  +LT ++      + F A ++F +TF + T K    + ++IR+ +  ++ T K K  DR+W P PR +   D +YV  GF +LQ+ ++ A I+  T  E   +G  +  MPYPCY+ D F+  L+   P  +V+AW  SV++++KS+V EKE RLKE +K MG+ N V W +WFI + +V+     +++  +   K+   S+  ++F  +  +  + I Q F+++VFF+KAN+A+   GILYF+FY+  +     +  ++  M     L+SQVAF    +++  +E+   G+Q+ N+  +P E   F     II+M++D+ +Y ++ WY+++VFPGQYG+ +P+ F    SY      +  S P               FE+EP  L +G+ + NLVK++  +  P ++ L++ FYE QITAFLGHNGAGKTTT+SILTG+F P+SGTA+I  +DIRT+MD+IR  +G+CPQ+N++F  +TV +HI FY LLK     E +  +  +++D  L  K N  + +LSGG++RKLS+AMAF+G ++VVFLDEPT+GVDP++RR IWDLL+KYR   RT+IL+THHMDEAD LSDRVAIISQG+L CCGS +FLK   G G+YL+L++   + +                           ++  + E I   V  ++ +AR++E    + T +LP      R +  LF+ L++ +A++ + S+G+SDTSLEEV          +L N++  S Y   C         N   T    +    Q   +        +KG  L+ +Q +AL IKR+H+  R  K F A+++LP   +L  ++F  I     +   + +SPW+   +       TF+  E   +  +        +  G  G RCM      L+ Y C   N    W     +PA ++D+          P  SP+C CS     T   +C +  +GG P   RI ++ D L +LTG NISDYL+K +  L R                +S LI++   +     SV    P                  S KT+    +W N+KG+ +MPA+ N+ +N +LR+ +  + N   YG++V N+P+  ++ ++S+ N L   ++  +A+ VI A+SF+ ASFV++LI ER++ +K  QFVSG++P VYW +NFLWD++ Y +   +++ IFI FD + Y    N  A I LL+ YG ++ P MYP S+  S PSTA+V L+  NL +G  ++  TFILD+  D+  T    N++LK+V LIFP + LGRG+ID++   I   + D YA++      D F W    + +  +                G I  +L  +++  +F           +   ED D++ E+ R+       D+L + +L+K Y+
Sbjct:  383 MWNTLKPFLMGKILYAPDSPAIRQLIKNANSTFEELERLRNIIRSWE-EVGPQLWDFFQSNIQLDVLRDILR-----NPSVMDYMDRGLKNTGLTIRHILNFLHTGSEEERERDMVQFDWRNIFNLTDRTLRMINQYGECLVLDKFV---GLPDETQLTQKALDLIAEKKFWAGLVFVDTFSWTT-KIPPHIKFKIRMDIDTVERTNKIK--DRYWDPGPRADPMDDLRYVWGGFAYLQDMVEHAVIKTHTGKE-WPLGVYLQQMPYPCYVDDLFMLTLSRCFPIFIVLAWVYSVSMMVKSVVLEKEMRLKETLKAMGVTNEVLWCAWFIDSFLVMAASTALLTAIIMGGKVLNYSNPIILFIFLLTFTTATIMQCFLMTVFFNKANLAAACSGILYFSFYLPHLACFTWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIHTSPLEGDEFSFHTSIIMMLLDTVLYAVLAWYLDSVFPGQYGIGRPFYFPIQPSYCSLKPHALVSSP---------PTEKVFFEAEPSGLVVGVHVENLVKVFSGSSKPAVDGLSITFYEGQITAFLGHNGAGKTTTMSILTGLFPPTSGTAFIYGKDIRTDMDTIRHSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLAEAQQEVENMLEDFGLPHKRNEQTQNLSGGLQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYRP-GRTVILSTHHMDEADLLSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEV------STSKELPNRQVSSLYKKAC--------ANGQPTAGGSSSGEGQGSRQ--------VKGVSLVVKQFLALLIKRFHHTTRSGKDFFAQIVLPASFVLVSLMFTLIVPPFGEYPSLTLSPWIYGRQF------TFFSNEQSEMEGMKYFADVLLNRPG-FGTRCMVDE--PLEEYPC--NNITTEWEKPLVNPA-LVDVLNKSQWTELRP--SPDCQCSTPTKLTMLPVCPE-GAGGLPLPQRIQSTGDVLIDLTGRNISDYLVKTYPTLIR----------------TSSLISECLFYRYGGISVGGRLP--------------VVGLSPKTIQ-DTVWYNNKGWHAMPAFLNVANNAILRAHLPTNANPSEYGVTVINHPLNLTKEQLSEVNVLTTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFLWDMISYSVSAALVVQIFINFDKKCYTSPANLHALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCLNLFIGINSSAITFILDLF-DSSTTLYMFNQVLKRVLLIFPHFCLGRGLIDMA---INQAVMDVYAQFGEDYSLDPFSWNFVGKNVVCMAA-------------EGFIYFILNILIQYRFFLEHWMPDSKKPLIVDEDLDVAKERERIYRGGSSSDILHIRDLSKTYS 1850          

HSP 2 Score: 165.622 bits (418), Expect = 2.555e-40
Identity = 84/228 (36.84%), Postives = 128/228 (56.14%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            + I +L K Y     P ++ + +     +    LG NGAGKTTT  +LTG    SSG A I    I T +  +   +G CPQ++ + D LT  +H++ Y  L+ + ++EI  V    I+ + L++     +   SGG KRKLS A+A IG   +V LDEPT G+DP +RR +W  ++      R ++LT+H M+E + L  R+AI+  G  +C G++  LK KFG+GY
Sbjct: 1840 LHIRDLSKTYSGGTKPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVSSGEAAITGYSILTNILDVYHNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSQYAGYGAGTYSGGNKRKLSTAIAMIGCPALVLLDEPTTGMDPHSRRFLWKSIMSVIQDGRAVVLTSHSMEECEALCTRLAIMVNGIFKCLGTIQHLKYKFGDGY 2067          

HSP 3 Score: 53.9138 bits (128), Expect = 1.844e-6
Identity = 23/80 (28.75%), Postives = 42/80 (52.50%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQ 264
            +Q+R LLWKN+ +++R+     +E+  P+++   L  +R +   Y+   C F  K M S G +P++    C  N  C+  
Sbjct:    5 SQVRLLLWKNWTVRKRQKMRFFMEIMWPVMLFIGLVWLRKANPLYRQHECHFPNKAMPSAGVLPWIQGIFCNANNPCFQH 84          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 537/1662 (32.31%), Postives = 854/1662 (51.38%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAV-----NTLFNITNVKSYIDGVSK--------------LFSWIERGL-------NCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWV-----------------YNIKSSESIPLMRNNNQNCEINHQA--------------------------------------------FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLK----------------------RKFG----------------EGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMW-----SPASILDIP--------MVSPECDCSK----TGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSS-----KLIAQSPTWDGIRDSVNQ--------SQPQNLEPLR----FLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF--------NNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 5118
            M+N L P + GK+ Y P+   IRQ+I+ AN TF+ L+ LR     W       L D+  +N+ ++ ++   +     NP + D +     NT   I ++ +++   S+              +F+  +R L        C  LD+F+    L D  +LT ++      + F A ++F +TF + T K    + ++IR+ +  ++ T K K  DR+W P PR +   D +YV  GF +LQ+ ++ A I+  T  E   +G  +  MPYPCY+ D F+  L+   P  +V+AW  SV++++KS+V EKE RLKE +K MG+ N V W +WFI + +V+     +++  +   K+   S+  ++F  +  +  + I Q F+++VFF+KAN+A+   GILYF+FY+  +     +  ++  M     L+SQVAF    +++  +E+   G+Q+ N+  +P E   F     II+M++D+ +Y ++ WY+++VFPGQYG+ +P+ F    SYW+                  +I +S   P    NNQ   +  Q                                             FE+EP  L +G+ + NLVK++  +  P ++ L++ FYE QITAFLGHNGAGKTTT+SILTG+F P+SGTA+I  +DIRT+MD+IR  +G+CPQ+N++F  +TV +HI FY LLK     E +  +  +++D  L  K N  + +LSGG++RKLS+AMAF+G ++VVFLDEPT+GVDP++RR IWDLL+KYR   RT+IL+THHMDEAD LSDRVAIISQG+L CCGS +FLK                      RK G                E    +  + ++     + + E I   V  ++ +AR++E    + T +LP      R +  LF+ L++ +A++ + S+G+SDTSLEE+FLKV  D    L                      A K      Q      S    Q    +KG  L+ +Q +AL IKR+H+  R  K F A+++LP   +L  ++F  I     +   + +SPW+   +       TF+  E   +  +        +  G  G RCM      L+ Y C   N    W     +PA ++D+           SP+C CS     T   +C +  +GG P   RI ++ D L +LTG NISDYL+K +  L R       ++    +   S      ++  SP    I+D+  Q        +       LR    FL+Y +  +N         ++W N+KG+ +MPA+ N+ +N +LR+ +  + N   YG++V N+P+  ++ ++S+ N L   ++  +A+ VI A+SF+ ASFV++LI ER++ +K  QFVSG++P VYW +NFLWD++ Y +   +++ IFI FD + Y    N  A I LL+ YG ++ P MYP S+  S PSTA+V L+  NL +G  ++  TFILD+  D+  T    N++LK+V LIFP + LGRG+ID++   I   + D YA++      D F W    + +  +                G I  +L  +++  +F           +   ED D++ E+ R+       D+L + +L+K Y+
Sbjct:  386 MWNTLKPFLMGKILYAPDSPAIRQLIKNANSTFEELERLRNIIRSWE-EVGPQLWDFFQSNIQLDVLRDILR-----NPSVMDYMDRGLKNTGLTIRHILNFLHTGSEEERERDMVQFDWRNIFNLTDRTLRMINQYGECLVLDKFV---GLPDETQLTQKALDLIAEKKFWAGLVFVDTFSWTT-KIPPHIKFKIRMDIDTVERTNKIK--DRYWDPGPRADPMDDLRYVWGGFAYLQDMVEHAVIKTHTGKE-WPLGVYLQQMPYPCYVDDLFMLTLSRCFPIFIVLAWVYSVSMMVKSVVLEKEMRLKETLKAMGVTNEVLWCAWFIDSFLVMAASTALLTAIIMGGKVLNYSNPIILFIFLLTFTTATIMQCFLMTVFFNKANLAAACSGILYFSFYLPHLACFTWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIHTSPLEGDEFSFHTSIIMMLLDTVLYAVLAWYLDSVFPGQYGIGRPFYFPIQPSYWLNLTNPTKAVPEKSVVKRPSIDNSAQKPEETANNQTQPVEEQTTQPSEPPGTCKHGDRREKLGMQIKLEEEGSSYQNQSYLSGEKVFFEAEPSGLVVGVHVENLVKVFSGSSKPAVDGLSITFYEGQITAFLGHNGAGKTTTMSILTGLFPPTSGTAFIYGKDIRTDMDTIRHSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLAEAQQEVENMLEDFGLPHKRNEQTQNLSGGLQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYRP-GRTVILSTHHMDEADLLSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGQTKSAGRQMDGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEIFLKVTADGETSLGKSA------------------ADKKACANGQPTAGGSSSGEGQGSRQVKGVSLVVKQFLALLIKRFHHTTRSGKDFFAQIVLPASFVLVSLMFTLIVPPFGEYPSLTLSPWIYGRQF------TFFSNEQSEMEGMKYFADVLLNRPG-FGTRCMVDE--PLEEYPC--NNITTEWEKPLVNPA-LVDVLNKSQWTELRPSPDCQCSTPTKLTMLPVCPE-GAGGLPLPQRIQSTGDVLIDLTGRNISDYLVKTYPTLIRTSLKSKYWVNEQRYGGISVGGRLPVVGLSP--KTIQDTAEQLGGIFNITAGKHVKRALRDTGTFLRYMETEYN--------VKVWYNNKGWHAMPAFLNVANNAILRAHLPTNANPSEYGVTVINHPLNLTKEQLSEVNVLTTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFLWDMISYSVSAALVVQIFINFDKKCYTSPANLHALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCLNLFIGINSSAITFILDLF-DSSTTLYMFNQVLKRVLLIFPHFCLGRGLIDMA---INQAVMDVYAQFGEDYSLDPFSWNFVGKNVVCMAA-------------EGFIYFILNILIQYRFFLEHWMPDSKKPLIVDEDLDVAKERERIYRGGSSSDILHIRDLSKTYS 1975          

HSP 2 Score: 165.622 bits (418), Expect = 2.605e-40
Identity = 84/228 (36.84%), Postives = 128/228 (56.14%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            + I +L K Y     P ++ + +     +    LG NGAGKTTT  +LTG    SSG A I    I T +  +   +G CPQ++ + D LT  +H++ Y  L+ + ++EI  V    I+ + L++     +   SGG KRKLS A+A IG   +V LDEPT G+DP +RR +W  ++      R ++LT+H M+E + L  R+AI+  G  +C G++  LK KFG+GY
Sbjct: 1965 LHIRDLSKTYSGGTKPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVSSGEAAITGYSILTNILDVYHNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSQYAGYGAGTYSGGNKRKLSTAIAMIGCPALVLLDEPTTGMDPHSRRFLWKSIMSVIQDGRAVVLTSHSMEECEALCTRLAIMVNGIFKCLGTIQHLKYKFGDGY 2192          

HSP 3 Score: 54.299 bits (129), Expect = 1.691e-6
Identity = 23/80 (28.75%), Postives = 42/80 (52.50%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQ 264
            +Q+R LLWKN+ +++R+     +E+  P+++   L  +R +   Y+   C F  K M S G +P++    C  N  C+  
Sbjct:    5 SQVRLLLWKNWTVRKRQKMRFFMEIMWPVMLFIGLVWLRKANPLYRQHECHFPNKAMPSAGVLPWIQGIFCNANNPCFQH 84          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 813.527 bits (2100), Expect = 0.000e+0
Identity = 538/1675 (32.12%), Postives = 862/1675 (51.46%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAV-----NTLFNITNVKSYIDGVSK--------------LFSWIERGL-------NCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWV-----------------YNIKSSESIPLMRNNNQNCEINHQA--------------------------------------------FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLK----------------------RKFG----------------EGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLN-QNPDQKQSKFLDQSDHL------------LKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMW-----SPASILDIP--------MVSPECDCSK----TGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSS-----KLIAQSPTWDGIRDSVNQ--------SQPQNLEPLR----FLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYF--------NNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYN 5118
            M+N L P + GK+ Y P+   IRQ+I+ AN TF+ L+ LR     W       L D+  +N+ ++ ++   +     NP + D +     NT   I ++ +++   S+              +F+  +R L        C  LD+F+    L D  +LT ++      + F A ++F +TF + T K    + ++IR+ +  ++ T K K  DR+W P PR +   D +YV  GF +LQ+ ++ A I+  T  E   +G  +  MPYPCY+ D F+  L+   P  +V+AW  SV++++KS+V EKE RLKE +K MG+ N V W +WFI + +V+     +++  +   K+   S+  ++F  +  +  + I Q F+++VFF+KAN+A+   GILYF+FY+  +     +  ++  M     L+SQVAF    +++  +E+   G+Q+ N+  +P E   F     II+M++D+ +Y ++ WY+++VFPGQYG+ +P+ F    SYW+                  +I +S   P    NNQ   +  Q                                             FE+EP  L +G+ + NLVK++  +  P ++ L++ FYE QITAFLGHNGAGKTTT+SILTG+F P+SGTA+I  +DIRT+MD+IR  +G+CPQ+N++F  +TV +HI FY LLK     E +  +  +++D  L  K N  + +LSGG++RKLS+AMAF+G ++VVFLDEPT+GVDP++RR IWDLL+KYR   RT+IL+THHMDEAD LSDRVAIISQG+L CCGS +FLK                      RK G                E    +  + ++     + + E I   V  ++ +AR++E    + T +LP      R +  LF+ L++ +A++ + S+G+SDTSLEE+FLKV  D    L        +          R     T + +N + P+ K++    Q                +KG  L+ +Q +AL IKR+H+  R  K F A+++LP   +L  ++F  I     +   + +SPW+   +       TF+  E   +  +        +  G  G RCM      L+ Y C   N    W     +PA ++D+           SP+C CS     T   +C +  +GG P   RI ++ D L +LTG NISDYL+K +  L R       ++    +   S      ++  SP    I+D+  Q        +       LR    FL+Y +  +N         ++W N+KG+ +MPA+ N+ +N +LR+ +  + N   YG++V N+P+  ++ ++S+ N L   ++  +A+ VI A+SF+ ASFV++LI ER++ +K  QFVSG++P VYW +NFLWD++ Y +   +++ IFI FD + Y    N  A I LL+ YG ++ P MYP S+  S PSTA+V L+  NL +G  ++  TFILD+  D+  T    N++LK+V LIFP + LGRG+ID++   I   + D YA++      D F W    + +  +                G I  +L  +++  +F           +   ED D++ E+ R+       D+L + +L+K Y+
Sbjct:  386 MWNTLKPFLMGKILYAPDSPAIRQLIKNANSTFEELERLRNIIRSWE-EVGPQLWDFFQSNIQLDVLRDILR-----NPSVMDYMDRGLKNTGLTIRHILNFLHTGSEEERERDMVQFDWRNIFNLTDRTLRMINQYGECLVLDKFV---GLPDETQLTQKALDLIAEKKFWAGLVFVDTFSWTT-KIPPHIKFKIRMDIDTVERTNKIK--DRYWDPGPRADPMDDLRYVWGGFAYLQDMVEHAVIKTHTGKE-WPLGVYLQQMPYPCYVDDLFMLTLSRCFPIFIVLAWVYSVSMMVKSVVLEKEMRLKETLKAMGVTNEVLWCAWFIDSFLVMAASTALLTAIIMGGKVLNYSNPIILFIFLLTFTTATIMQCFLMTVFFNKANLAAACSGILYFSFYLPHLACFTWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIHTSPLEGDEFSFHTSIIMMLLDTVLYAVLAWYLDSVFPGQYGIGRPFYFPIQPSYWLNLTNPTKAVPEKSVVKRPSIDNSAQKPEETANNQTQPVEEQTTQPSEPPGTCKHGDRREKLGMQIKLEEEGSSYQNQSYLSGEKVFFEAEPSGLVVGVHVENLVKVFSGSSKPAVDGLSITFYEGQITAFLGHNGAGKTTTMSILTGLFPPTSGTAFIYGKDIRTDMDTIRHSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLAEAQQEVENMLEDFGLPHKRNEQTQNLSGGLQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYRP-GRTVILSTHHMDEADLLSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGQTKSAGRQMDGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEIFLKVTADGETSLGKSAADLRALQETSRSSVFR----DTTVTVNTEEPEDKKACANGQPTAGGSSSGEGQGSRQVKGVSLVVKQFLALLIKRFHHTTRSGKDFFAQIVLPASFVLVSLMFTLIVPPFGEYPSLTLSPWIYGRQF------TFFSNEQSEMEGMKYFADVLLNRPG-FGTRCMVDE--PLEEYPC--NNITTEWEKPLVNPA-LVDVLNKSQWTELRPSPDCQCSTPTKLTMLPVCPE-GAGGLPLPQRIQSTGDVLIDLTGRNISDYLVKTYPTLIRTSLKSKYWVNEQRYGGISVGGRLPVVGLSP--KTIQDTAEQLGGIFNITAGKHVKRALRDTGTFLRYMETEYN--------VKVWYNNKGWHAMPAFLNVANNAILRAHLPTNANPSEYGVTVINHPLNLTKEQLSEVNVLTTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFLWDMISYSVSAALVVQIFINFDKKCYTSPANLHALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCLNLFIGINSSAITFILDLF-DSSTTLYMFNQVLKRVLLIFPHFCLGRGLIDMA---INQAVMDVYAQFGEDYSLDPFSWNFVGKNVVCMAA-------------EGFIYFILNILIQYRFFLEHWMPDSKKPLIVDEDLDVAKERERIYRGGSSSDILHIRDLSKTYS 2002          

HSP 2 Score: 165.236 bits (417), Expect = 3.346e-40
Identity = 84/228 (36.84%), Postives = 128/228 (56.14%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            + I +L K Y     P ++ + +     +    LG NGAGKTTT  +LTG    SSG A I    I T +  +   +G CPQ++ + D LT  +H++ Y  L+ + ++EI  V    I+ + L++     +   SGG KRKLS A+A IG   +V LDEPT G+DP +RR +W  ++      R ++LT+H M+E + L  R+AI+  G  +C G++  LK KFG+GY
Sbjct: 1992 LHIRDLSKTYSGGTKPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVSSGEAAITGYSILTNILDVYHNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSQYAGYGAGTYSGGNKRKLSTAIAMIGCPALVLLDEPTTGMDPHSRRFLWKSIMSVIQDGRAVVLTSHSMEECEALCTRLAIMVNGIFKCLGTIQHLKYKFGDGY 2219          

HSP 3 Score: 53.9138 bits (128), Expect = 1.873e-6
Identity = 23/80 (28.75%), Postives = 42/80 (52.50%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQ 264
            +Q+R LLWKN+ +++R+     +E+  P+++   L  +R +   Y+   C F  K M S G +P++    C  N  C+  
Sbjct:    5 SQVRLLLWKNWTVRKRQKMRFFMEIMWPVMLFIGLVWLRKANPLYRQHECHFPNKAMPSAGVLPWIQGIFCNANNPCFQH 84          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: ENSAMXT00000022236.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:13397857:13560117:1 gene:ENSAMXG00000021540.2 transcript:ENSAMXT00000022236.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 531/1543 (34.41%), Postives = 838/1543 (54.31%), Query Frame = 1
Query:  673 YNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXX-------------------XXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNP-----DQKQSKFLD-QSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGES--GIRCM--NPSIYRLDNYQCFYRNENNMWSPA---SILDI--------PMVSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKS--SKTM--NFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXE-RGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFN 5130
            +  L PL+ G+V Y P+    R+I+E+AN TF  L  + L +  W           + N    +++ KF +      P + +A         V                 L C +LD+F   + +     L  Q+ +      F A ++F +    L     + + Y+IR+ +   + T K K  DR W+P  R N F D +YV  GF++LQ+ +D+  +   T      +G  +  MPYPCY+ D F+  ++ +LP  LV+A+  SV  +IK +V EKE RLKE ++V+G+ N   W++WF   +V+L +P  ++SV ++  K+   S  +V+F  +  + ++ + Q F +SVFFS+AN+A+  GG++YF  Y+  V+       ++     +  LLS VAF    +    +E+   G+Q+SN+F +  E  P+     I++M++D+ +Y ++TWY+E VFPGQYG+ KPW F    SYW      S++ P   + +       +  E  P  LK G+SI NLVK+Y +     ++ L+L+FY+  IT+FLGHNGAGKTTT+SILTG+F+P+SGTAY+   DIR +MD+IR+K+G+CPQ+NVLF+ LTVE+HIYFY  LK     E++  + ++IKDV L  K   L+ +LSGGM+RKLS+A+AF+G S VV LDEPTAGVDP+ARRGIW+LL+KY+   RTIIL+THHMDEAD L DR+AIIS G++ CCGS +FLK+ +G GYYL+L++                                ++   V+ ++ +A  +E    +   +LP        F  LFK LD     + I SYG+SDTSLEEV   +A    + L  + K            + R ++  + +   +       DQ+QS  L+ +   ++ G+PL++ Q +AL IKR+H+A+R  KG +A+++LP   +   ++F  I     +   +++ PW+     GK   NTFY  +  +   +  +    RS L E   G RCM  NP    +  Y C      +  +PA   +IL I           SP+C CS     I    C     G PP   R  +++D L+NLT YN++D+LLK + +  +  +GG      N    S  ++ +S     + D                  F+  FN +  S+T+  + S +W  ++G+ ++ ++ N+ SN +LR+ +        YGIS  N+P+  ++ ++S        +V ++I VI A+SFI ASFV+FLI ER+S +K  QFVSG+NP  YWV+NF WD+  YI+P +I+IIIF+ F  +SY+   N  A ILLLI YG +I P MYP SF  S PSTA+VVL   NL +G   +++TF++++ +D + T    N+I+K+V LIFP + LGRG+ID++ N     +     +    D   W++  + L ++ +  ++ +   ++I+ +      L + L VS         ED D++ E+ R++     +D+L++ +LTK+   +F+
Sbjct:  184 WTALRPLLQGRVLYTPDTPFTRRIMEQANSTFDALSKVELLADAW-----------LENE---DEIWKFFQNISCFTPPLREAFVCTCVCVCVCV-----------CVCVLQCFDLDKF---EGVSSESLLVQQALKLLDEERFWAGVVFTD----LDSGEPSLVRYKIRMDVEDTERTDKIK--DRSWSPSARDNPFNDLRYVRGGFVYLQDMLDRGIVRAQTGIRET-LGVFVQQMPYPCYVDDAFVSSISTILPMFLVLAFMNSVGQIIKGLVLEKELRLKEVLRVVGVQNGPLWLAWFTENMVLLSVPCALISVMVKYGKVLRYSDPSVIFVFLLVFCMATVMQCFFISVFFSRANLAAACGGLIYFLLYLPHVLCQAWRDVITFRAKLATSLLSCVAFGYGCENFARYEEQGVGIQWSNIFVSSQEDDPYSFFVSIVMMLVDTLMYWILTWYIENVFPGQYGIPKPWYFPFTSSYWCGTPVGSDTEPDALDGSS------RYLEKPPPGLKAGVSIRNLVKVYKTGNKLAVDKLSLDFYQDHITSFLGHNGAGKTTTMSILTGLFAPTSGTAYVNGFDIRRDMDTIRKKLGMCPQHNVLFNELTVEEHIYFYARLKGRSSGEVKQEIEQMIKDVGLPHKRKELAKNLSGGMQRKLSVAIAFVGGSSVVILDEPTAGVDPYARRGIWELLLKYK-QGRTIILSTHHMDEADILGDRIAIISHGRVCCCGSSLFLKKTYGSGYYLTLVQANQERGARKHQSQCDDFSLDEGIGSSSLSNVADLSALVRRHVPEAVFLEVLGQELVYILPYTGSKDGSFASLFKELDLEKERLGISSYGISDTSLEEVH-TLAQTHTHTLSIQYKDTLVRDWKRSSRESRTHSISSAMEQKEKESSKCDDQRQSVCLNGKGSSVMSGWPLIRHQFLALFIKRFHHARRSRKGIIAQVVLPAFFVCLSLIFSLIVPPFVEYPSLELQPWM----YGKPQ-NTFYSTDRPTEAAVTSVT---RSLLNEPGFGTRCMESNP----IPKYPCVPAGATDWSTPAVDPAILKIFQDGNWTMQNPSPDCQCSTPERNIMLPDCQPGAGGLPPP--RTQSTTDTLHNLTSYNMTDFLLKTYAKSGKIRYGGISVGGVN----SQVMLNESEIIAAVSD------------------FKALFNSTQVSQTLCTSLSLVWFYNQGWHAIASFLNVASNAILRASLPSRLQPKLYGISAFNHPLNLTKQQMSA---AFSTDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPAGYWVANFTWDMCNYIVPCLIVIIIFLCFQQKSYVSPPNLPALILLLILYGWSITPMMYPASFLFSVPSTAYVVLTCINLFIGINGSVATFVMELFDDPNITR--INDIMKQVLLIFPHFCLGRGLIDMAKNQAMATLFSSLGEDRFKDPLGWDMVGKNLFAMAVEGVVMFGFTLLIQYKFCWKPGLVKGLPVSL------GQEDEDVARERERVHKGGAENDLLRICDLTKVLLLSFS 1636          

HSP 2 Score: 134.42 bits (337), Expect = 6.583e-31
Identity = 99/291 (34.02%), Postives = 142/291 (48.80%), Query Frame = 1
Query: 2305 AFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWD-LLIKYR-SHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESR--LQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
              LG NGAGKTTT  +LTG  + S G A++    +RTEM  + Q +G CPQ++ + D LT  +H+ FY  L+ + + E+ SV    I+ + L +  N  +   SGG KRKLS AM+ IG   VVFLDEPT G+DP ARR +WD +LIK   +H  T  L                           +L FL R FG+GY                +   +  FV      + + E+    LQ+ I   +  + S  F +  KN  QH   + +  Y +S T+L++VF+  A
Sbjct: 1651 GLLGINGAGKTTTFKMLTGDITASGGEAFLNGYSMRTEMGQVHQNMGYCPQFDAIDDLLTGREHLEFYARLRGVPEQEVASVAEWGIQKLGLVKYSNKSAGTYSGGNKRKLSTAMSLIGCPPVVFLDEPTTGMDPKARRFLWDCILIKSSITHFPTTPL---------------------------ALAFLYR-FGDGY-----TVIVRVQGGATDLSAVEDFVSRSFPGSVLKEKHHNTLQYQIPYTEGAL-SHMFNQFSKN--QH--ALGVEDYSVSQTTLDQVFVNFA 1903          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002495.1 (pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene:ENSPMAG00000002218.1 transcript:ENSPMAT00000002495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 687.182 bits (1772), Expect = 0.000e+0
Identity = 407/1123 (36.24%), Postives = 645/1123 (57.44%), Query Frame = 1
Query: 1150 LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLR----LSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSE---SIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXX--------------------------XXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNK-------LINKEKSYYSYYCNILKMKLRIN-ATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWL------MMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASI------------LDIPMVSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNF-----------------SRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQ 4278
            + Y+IR+ +  +  T K K  DR+W P PR + F D +Y+  GF +LQ++++Q  I   TN  S+ VG  +  MPYPCY+ D FL+ +   LP  L +AW  SV +++K +V+EKE+RLKE M++MGL+  + W+SWFIS ++ L+I  ++++V L+    L  I   S   +V+  +  + I+ + Q F++S FFS+AN+A+ +GGI+YF+FY+ +V+ +  + +++ ++  S  + S VAFS   +F   +E+   G+Q+ N+F +P E   +     I +M+ D+F+Y L+T Y+E VFPGQYGV KPW F C R+YW  +    E   +I   +        ++   E EP +L +G+SI  LVK+Y + K   ++ L+LNFY+ QIT+FLGHNGAGKTTT+SILTG+F P++GTAYIL  DIRT++D IR+ +G+CPQYNVLFD LTVE+HI+FY  LK   + E +  + ++I+DVDL  K + +S  LSGGM+RKLSI +AF+G S+VVFLDEPTAGVDP+ARRGIW+LL+KYR H RTIIL+THHMDEAD L DR+AIIS G+L+CCGS +FLK  FG GYYL+++K   +                           S +  +  ++ + ++ ++ DAR++E    + T +LP +      F  LFK LD+ +AE+ + SYG+SDT+LEE+FLKVA++P           ++   S Y+Y   +    +  N +T  +        +K ++   +    + G  L+  Q  AL IKR+H+A+R  KGF+A++ILP + +   ++F  I     K   +Q+ PW+       +S    EN+ T     ++   L+NK            G RCMN     + +  C       +  P S             ++ P  SPEC CS  G ++    C +  +GGPP   R+  ++D L +L+G NISDYL+K + +  RK      ++  N+       +       G +   + + P++++ +      +  F+  +K ++                   ++W N+KG+ ++ A+ N+ +N +LRS +    +  +YGI+  N+P+  ++ ++S+
Sbjct:    5 VRYKIRMDIDSVQRTNKIK--DRYWDPGPRADPFDDLRYIWGGFAYLQDSVEQGIIRAQTNG-SLSVGVYVQQMPYPCYVDDIFLRIMNRSLPMFLTLAWMYSVAMILKEVVHEKEARLKETMRIMGLSTSMLWLSWFISILIPLLISAMLLTVLLKVREQLGNILYYSDPTIVYLYLCVFAIATVMQCFLISTFFSRANLAAATGGIVYFSFYLPYVLCVAWQNQITYSVKISTSIFSTVAFSFGSEFFSLYEEQGVGMQWENVFSSPVEGEDYTFISSIFMMLFDAFVYGLLTVYIENVFPGQYGVPKPWYFPCTRAYWRGDTMEKELYETIAQKQPQAITGVPDNIYVEDEPGDLPVGVSIQGLVKIYNAGKKLAVDGLSLNFYQGQITSFLGHNGAGKTTTMSILTGLFPPTAGTAYILGRDIRTDIDKIRKNLGVCPQYNVLFDRLTVEEHIWFYARLKGRSEQEAKQEIEQMIQDVDLAHKRSDISKSLSGGMQRKLSIGIAFVGGSKVVFLDEPTAGVDPYARRGIWNLLLKYR-HGRTIILSTHHMDEADLLGDRIAIISHGRLRCCGSSLFLKNAFGAGYYLTMVKRSGSGGSNSSCLAGLASSSDEGFGSDESNPDSIAANHVSSVTRLLQQHVPDARLIENFGQELTYLLPSHGAKDGTFALLFKELDEKLAELGVSSYGVSDTTLEEIFLKVAEEPAANSHFTNGVKLSARNSKYTYLQPVHAGCICKNYSTCKKAPAELGELEKLNELDGKGTQQISGVQLILLQFKALFIKRFHHARRSRKGFVAQIILPAVFVCLALVFSLIIPPFGKYPMLQLQPWMYGEQYTFLSNDAPENVKT----NSLYDALLNK---------PGFGTRCMNGE--SIPDAACVETKSEWVQPPMSPAMARTMQSRNWSMEDP--SPECRCSGEGRRVILPDCPE-GAGGPPPMQRVQNTTDTLEDLSGRNISDYLVKTYPQAIRKSLKHKYWV--NEIRYGGLSV-------GKKKLSHSASPKDMDIV--FTNVKRVFHIENKAVDVLYSGVKDMVSFLGPKETIKVWFNNKGWHAIVAFMNMANNAVLRSSLPAGTDPSDYGITAYNHPLNLTKEQLSE 1094          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:ZFIN;Acc:ZDB-GENE-030131-9790])

HSP 1 Score: 363.614 bits (932), Expect = 1.749e-102
Identity = 270/858 (31.47%), Postives = 435/858 (50.70%), Query Frame = 1
Query: 1141 TTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSL---TMYYSCGLLSQVAFSNAVKFMIYWEQ---LYEGVQFSNLFQNP--GESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCAR-SYWVYNI----KSSESIPLMRNNNQN-------CEIN----------HQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMD--KNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXX---------XXILKFVKIYIADARMM--EESR----LQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFL---KVADDP---------------MNKLINKEKSYYS--YYCNILKMKLRINATKTEIFLNQNPDQKQ------------------------SKFLDQSDHLLK-----GFPLLQQQIIALHIKRYHYAKRDFKGFLAE 3426
             T L+Y +R+ +  +  T   +  D  W P P  N   ++ Y    F+  +  +++A I L       E    +  MPYPCY  D FL  +  + P L ++AW  ++   +K +V EKE   +EYM +MG+    H++SW + + V+L++ V++++V L+ S      + A++ A+   + IS +   +M+S  F+  NVAS++   +Y   +  F+    L  +L+    ++   C LLS  AFS A   +        +   VQ+SN++ +P  G+ + F   +   ++IID+ IY ++ WY+  V+PG YG+A+P+ FL  R S   + I      S  I  +++  +        C                 E+ P +L  G+S+ +L K Y   K   + +L+L+FY+ QIT  LGHNGAGKTTT+S+L G++ PSSG+ ++   D RT+M  +R+++G+C Q +VLF +L V +H+  YG LK +D  +  ++  +   + D+ L    + L   LSGGMKRKLSIA+AFIG S  V LDEPT+GVDP +RR IW+L++K+R+  RTIIL+THH+DEA+ LSDR+A++  GKL+CCGS  +LK  +G+G  L+L K       S             E ++  V+  +A A +   E+S          +LP +  N    + L   L+++M E+ +  Y +SDT+LEEV L   +V  +P                  L+ K        Y C+ L  +      K     N++P+ +                         S       HL+K     G  LL ++  AL  KR+H+ +RD KG  A+
Sbjct:    2 ATHLNYTLRLSIQNVMRTDYLR--DLVWVPGPHTNQ--NYMYYTHAFLS-RTMLERAAISLYIGRNISEPALQVQPMPYPCYTDDSFLHSVGLMFPILFMIAWILTIASTVKFLVQEKELCQQEYMNIMGVRPASHFLSWLLQSCVLLLLMVILLTVILKASGTLPSINWALLLALFLCFGISVLAMGYMLSACFTHTNVASLTACFIYLLSFFPFLALSSLTLKLTRWQKSLIVRC-LLSPTAFSYATNLITQHCTCIPMRALVQWSNMYHSPLFGDDVSFA--YLCWMLIIDTAIYFILGWYIRNVYPGTYGLARPFYFLFTRISSKAHGIPGQKHGSRVIRGLQDGRKGVLRGVTECSCTSPLGAPDGSMRPQLEAVPADLTAGVSLRSLTKQYSKGKKAALQDLSLDFYQDQITTLLGHNGAGKTTTMSLLMGLYEPSSGSVHVGGHDARTDMAEVRRQLGVCLQRDVLFPALNVHEHLLLYGRLKALDWSRQRLQQEVDTFLNDLGLYNHKDKLVGTLSGGMKRKLSIAIAFIGGSTTVILDEPTSGVDPCSRRSIWNLILKHRA-GRTIILSTHHLDEAEVLSDRIAVLEHGKLRCCGSPQYLKEIYGQGLTLTLTKKVRVLCLSQSVTLGSRPPFDPERVVSLVRSGVAGAALKSGEDSSGNRNADMVFLLPAHSQNVLGQSFLV-TLEENMEELGLSGYAISDTTLEEVCLRQQRVMSEPALGCSASARYFTPTSAASLLTKATQCGPGLYSCSQLVQEAEDQRLKD--ITNKSPEAESGSINSETAAPPDHTSPAASSILCLSSLWRTEKHLVKKERVTGIHLLVRKTQALIYKRFHHWRRDVKGAAAQ 847          

HSP 2 Score: 176.792 bits (447), Expect = 1.604e-44
Identity = 101/308 (32.79%), Postives = 170/308 (55.19%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRT---EMDSIRQK---IGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             ++ L+L    +Q    LG NGAGKTTT  +LTG   PS G A I  ++  +   +M+  R+    IG CPQ++ L D LT  +H+Y Y  ++ +  + IE V   ++  + L+   + L    SGG KRKLS A+A IG  +++ LDEP++G+DP ++R +W  + +      ++ILT+H M+E + L D++AI+  G+ +C G+L  LK +FG G+       +   S+ N     + +F+  +   A + E+   Q    +P    N+ K +E+F  L++    +SI  Y +S T+L++VF+  A
Sbjct: 1462 AVDGLHLGVSPNQCFGLLGVNGAGKTTTFKMLTGDIQPSGGDAIIRTQNGHSALLKMEKARRTGTLIGYCPQFDALDDLLTGWEHLYCYARIRGIPSHHIEQVSQELVTRLHLSLHADKLVKTYSGGTKRKLSTALALIGKPQLLLLDEPSSGMDPKSKRYLWKTITREVRGGCSVILTSHSMEECEALCDKLAIMVNGQFKCLGTLQHLKNRFGNGH-----MIKLRLSSGNSKVTEVTEFITSHFPGAYLKEQHISQLEFQVPS---NAGKLSEIFIALEKEKESLSIQHYSISQTTLDQVFINFA 1761          

HSP 3 Score: 149.443 bits (376), Expect = 3.685e-36
Identity = 123/447 (27.52%), Postives = 214/447 (47.87%), Query Frame = 1
Query: 3859 NLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNY-GISVTNYPIADSETKISQFNNLILL---EVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDII---EDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTE-------DFDISLEKNRMNSEQKF------DDVLQVINLTKIY---NRTFN 5130
            NL+G ++ +YL+    +   K +GG+ F LP+      +++                 P N    +  +             N  ++W N +GY ++PAY N  +NLLL   +   ++  +Y GISV + P A  +  +SQ  ++IL    +  +AI ++L  S ++ SF   ++ ERI+GSKR Q +SG++P  YW  NF +D++ Y +   + I +  AF   +Y  + N  A  LLLI +G A +P MY  S   S    AFV   + N+++G  T +STF+++ +    D+   +   N I++ +FL+FPQ+ LG G++ LS    K  + +   K    D      + +S   + +  W  + +   G++   L  +L  S+     +K         D D+  E++R+  + +       DD LQ++ L K Y   NR+F 
Sbjct: 1059 NLSGEDVEEYLMGTTCQYLLKRYGGWSFGLPHSTTSDLEVV-----------------PDNRTLTKVWR-------------NHMKVWYNPEGYHALPAYVNSFNNLLLWDNLPDGEHPGDYKGISVNSKPYAGQQ--LSQ--DMILQNLGDTGVAICILLGFSILTGSFATAVVRERITGSKRLQQISGVSPTFYWAVNFTYDMVSYTVTTGLCIAVIAAFHLPAYTDNSNLGAVSLLLILFGFASLPWMYLISGVFSEEEMAFVTYISINIILGVSTIISTFLVNFLYLSSDSQSLYNAYN-IMRWLFLVFPQFCLGWGLVSLS----KQRLMEDIMKLLGSD-----PQESSSFAMDITGWPFVALAVNGIVCFTLRLVLTDSFIRWWRRKAVEPGQPELDTDVQAERSRVEEQSRVVDAATPDDTLQLVGLRKRYRLLNRSFT 1461          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004117.1 (pep scaffold:Pmarinus_7.0:GL489716:190:6182:-1 gene:ENSPMAG00000003765.1 transcript:ENSPMAT00000004117.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 295.049 bits (754), Expect = 5.642e-88
Identity = 174/470 (37.02%), Postives = 286/470 (60.85%), Query Frame = 1
Query: 1156 YQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELS---LTMYYSC--GLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGK--TTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIE 2544
            Y+IR   S  + T + +    +W P P  N+   + Y   GF+++Q+ I++A I     ++ +E G+ + + PYPCY  D FL  + +++P  +V++W  SV ++I+ IV EKE RLKE MK+MGL+N V WV+WFI+  + L I V +++V L+  ++   S + +++  +  Y ++ +   F+VSV +SKA +A+  GGI+YF  Y+ + +++ +  E++   +T +  C   L+S  AF    K+   +E    G+Q+    Q+P E   F +   ++++++DS +Y ++TWY+EAV PG YG+ +PW F   RSYW+ + ++        +  +      +  E EP +L L + I  L K+Y + K   +NNL+LN YE+QI +FLGHNGAGK  T   +  TG+F P+SG+A I   DIR+EMD+IR+ +G+CPQ+NVLFD LTVE+H++FY  LK M  ++I 
Sbjct:    7 YKIRQNSSFTEKTNEIR--RAYWRPGP--NSGGQY-YFFYGFVWIQDMIERAIINTFVGHDVVEPGNYVQLFPYPCYTRDDFLFVIEHMMPLCMVISWVYSVAMMIQHIVAEKEHRLKEVMKMMGLSNAV-WVAWFITGFLQLSITVAVLTVILKYGQVLMHSDIFIIWLFLTIYALATVMFCFLVSVLYSKARMAAACGGIMYFLSYVPY-MYVAIREEVAHDKITAFEKCIASLMSTTAFGLGAKYFALYEVAGVGIQWHTFRQSPVEGDDFNLSLALLMLLLDSVVYGVLTWYIEAVHPGTYGLPRPWYFPLQRSYWLGSGRA--------DAWEWSGYEARGMEKEPTHLPLVVCIERLTKVYKTGKKLALNNLSLNLYENQIVSFLGHNGAGKTTTMYDTRTTGLFPPTSGSARIYGHDIRSEMDAIRKSLGMCPQHNVLFDQLTVEEHLWFYSRLKGMQAHDIR 461          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006988.1 (pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-1 gene:ENSPMAG00000006318.1 transcript:ENSPMAT00000006988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 247.669 bits (631), Expect = 1.371e-69
Identity = 184/555 (33.15%), Postives = 291/555 (52.43%), Query Frame = 1
Query: 1264 YVLSGFIFLQEAIDQAFIELVTNNESIEVGSSM-HIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKP---WNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLG---ISIHNLVKLY--PSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMD--SIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            Y+ SGF+ LQ AID A I+L TN  +  + S+M   M    + + +   +L  L    L  A+ P ++ L+ ++V EKE   ++ M+ MGL     W+SW +    ++ +  ++++V  R++ I   S+  ++F +   Y +S +    ++  FF KA  AS  G +L   F ++ +  + L    ++ +++   L S  AF+ AV  ++  E    G  FSNL + P    P  V   + ++++D  IYL +   +  + PG+ G+  P   + FL  R   V N  +   I L RNN  N  I+HQ    +     LG   I I N+ K Y      +  +  L+LN YE QITA LGHNGAGKTT I+ILTG+ +PS+G  +      + ++D   IR  +  C     L+ S T          L      ++ S + R++    L +  +     LSGG KRKLS+A A +G  R++ LDEPT+G+DP +RR +W LL+  +  +   +L+TH M+EAD L+D  A++SQG+L+C GS +FLK KFG GY
Sbjct:  135 YLESGFVSLQLAIDSALIQLQTNASARALTSAMVQRMGRGRHTVVRTWPQL--LASIYLAGAFAPFLSFLLLNLVLEKEQGSRDLMRTMGLRTPALWLSWAMVYGAMICLVSLVLAVVTRVTHIFDTSNTVLMFLLFLLYGLSLVAMALVLMAFFRKAKTASSVGSLLALLFCLLNIPVLLLWNSHTV-LHWLLSLFSPAAFALAVAQVVALEAGGSGAHFSNLLEGPN---PLAVP--LTMLLLDIAIYLGLAAALHRLLPGERGLEGPRIGFIFL-RRCSCVQNAWNLHQINLPRNN-LNPHISHQNLHDKVGREILGSEAIRIRNVRKTYRLKGTDVMALRGLSLNIYEGQITALLGHNGAGKTTLINILTGLITPSAGATHT-RAHTQHQLDKFEIRNTVKCCTSLTNLYPSRTTGRERKKDVSLSSFPSPDLPSEVSRVLSATGLEKAADKQVQDLSGGQKRKLSLAAALLGKPRLLILDEPTSGMDPVSRRRVWSLLLGGK-RECVTLLSTHSMEEADALADWKAVLSQGRLKCAGSSLFLKTKFGVGY 677          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006855.1 (pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene:ENSPMAG00000006189.1 transcript:ENSPMAT00000006855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 4.768e-47
Identity = 102/322 (31.68%), Postives = 169/322 (52.48%), Query Frame = 1
Query: 2251 KIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRM---DKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLE---EVFLKVADDPMNKLINKE 3198
            +I  ++ L +     +    LG NGAGKTTT  +LTG  S + G A++    +  +   ++Q IG CPQ++ LFD LT  +H+  Y  L+ +   D+  +  V+   ++ + LT   +  +   SGG KRKLS A+A IG   ++FLDEPT G+DP ARR +W+L++      R+++LT+H M+E + L  R+AI+  G  +C GS+  LK +FG+GY           + S  + + +L+F      DA + E      T V  Q    +     +F  ++Q +  + +  Y +S T+L+   +VF+  A    + L  +E
Sbjct:    1 RILAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDASVTGGEAFLNGHSVLRDQHKVQQTIGYCPQFDALFDELTAREHLELYTRLRGIPWRDEKRVRQVVNWALQKLGLTSYADKPAGTYSGGNKRKLSTAIALIGYPPLIFLDEPTTGMDPKARRFLWNLILDIIKTGRSVVLTSHSMEECEALCTRLAIMVNGHFKCLGSIQHLKNRFGDGY------MITIRTRSTLHVKEVLRFFSRSFPDAVLKER---HHTKVQYQLKSETLSLAAVFTKMEQVLDVLGVEDYSVSQTTLDNDPQVFVNFAKKQSDNLEQQE 313          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: ATM1 (Mitochondrial inner membrane ATP-binding cassette (ABC) transporter; exports mitochondrially synthesized precursors of iron-sulfur (Fe/S) clusters to the cytosol; human homolog ABCB7 can complement yeast null mutant [Source:SGD;Acc:S000004916])

HSP 1 Score: 81.6481 bits (200), Expect = 5.864e-16
Identity = 63/232 (27.16%), Postives = 118/232 (50.86%), Query Frame = 1
Query: 2191 PENLKLGISIHNLVKLY-PSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRT-EMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESV----LPRIIKDV--DLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLI-KYRSHDRTIILTTHHMDE-ADYLSDRVAIISQGKLQCCG 2856
            PEN+   I+  N+   Y P  KI  + N +        TA +G +G+GK+T + ++   + P SG   I   DI+  ++D++R+ IG+ PQ   LF+  T+ +++ F G +   D+  I  V    L  +IK +       +    + +SGG K++L+IA   + N+R++F DE T+ +D    + +   +   + S  RT +   H +   AD  +D++ ++  G+++  G
Sbjct:  429 PENVPYDITFENVTFGYHPDRKI--LKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFND-TIWENVKF-GRIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIAD--ADKIIVLDNGRVREEG 654          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: YOL075C_mRNA (Putative ABC transporter [Source:SGD;Acc:S000005435])

HSP 1 Score: 80.4925 bits (197), Expect = 1.803e-15
Identity = 68/260 (26.15%), Postives = 119/260 (45.77%), Query Frame = 1
Query: 2167 NHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISIL----TGIFSPSSGTAYILNEDIRTEMDSIRQK----------------IGLCPQYNVLFDSLTVEDHIYFYGLLK-----RMDKNEIESVLPRI-IKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHD-RTIILTTHH-MDEADYLSDRVAIISQGKLQCCGSL 2862
            N  +F   P   ++ + + +L  +       ++N  +++     + A +G +G+GKTT +++L    +G  + +    Y+L ED  +E +    K                +   PQ +VL   LT  + + F   LK     R  K  +E ++  + +KD   T   +     LSGG KR+LSI    I N  ++FLDEPT G+D ++   +   L K    D RT I++ H    +  +L D+V I+S+G +  C  +
Sbjct:   16 NRLSFSRIP---RISLHVRDLSIVASKTNTTLVNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVL-EDTGSEPNETEPKRAHLDGQDHPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSERTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVYCDKM 271          

HSP 2 Score: 61.2326 bits (147), Expect = 1.262e-9
Identity = 46/190 (24.21%), Postives = 95/190 (50.00%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTG-----IFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNV-LFDSLTVEDHIYFYGLLKRMDKNEIESV--LPRIIKDVDLTEKINALSMH-----LSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKY-RSHDRTIILTTHH 2787
            ++ ++N  F    I A +G +G+GK++ +++++G     +F+    +  I+  DI+      +       Q +  L  +LTV++ + +   L+     E E +     +I+ + L    N +  +     +SGG KR++++ +  + +  ++ LDEPT+G+D F    I ++L K  R   +TII+T H 
Sbjct:  709 ILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDIQVSELMFKNVCSYVSQDDDHLLAALTVKETLKYAAALRLHHLTEAERMERTDNLIRSLGLKHCENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQ 898          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: ADP1 (Putative ATP-dependent permease of the ABC transporter family [Source:SGD;Acc:S000000604])

HSP 1 Score: 77.7962 bits (190), Expect = 1.082e-14
Identity = 58/205 (28.29%), Postives = 100/205 (48.78%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVD--------LTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRS-HDRTIILTTHH-MDEADYLSDRVAIISQGKL 2844
            V+N ++      QI A +G +GAGKTT + IL         +  I    I  +  S  + IG   Q + L  +LTV + +    LL+       E+   R+ K ++             N     +SGG KR++SIA   + +  V+FLDEPT+G+D      + + L++  S ++RT++L+ H       YL D++ ++S+G++
Sbjct:  405 VLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKIIGFVDQDDFLLPTLTVFETVLNSALLRLPKALSFEAKKARVYKVLEELRIIDIKDRIIGNEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNVIECLVRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEM 609          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: STE6 (Plasma membrane ATP-binding cassette (ABC) transporter; required for the export of a-factor, catalyzes ATP hydrolysis coupled to a-factor transport; contains 12 transmembrane domains and two ATP binding domains; expressed only in MATa cells; human homolog ABCB1 mediates multidrug resistance in many chemotherapy-resistant tumors by effluxing toxic compounds from the cell [Source:SGD;Acc:S000001692])

HSP 1 Score: 76.2554 bits (186), Expect = 3.931e-14
Identity = 71/273 (26.01%), Postives = 128/273 (46.89%), Query Frame = 1
Query: 2098 WVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIP-VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRT-EMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRI-IKDV------DLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGE 2889
            W+Y I   +   L   NN    +         +  K  +SI NL   YPS     V  N+N + +  Q    +G +G GK+T + +LT +++   G   I   D+    + S+R++I +  Q  +LF+  T+ D++  YGL   + + E+   L  + I D        L  +I+  +  LSGG  ++L IA A +  S+++ LDE T+ +D  +   I +++ K      T+++T  H ++     + +A++  GK+   G+   L    GE
Sbjct: 1014 WIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVEQKPLLFNG-TIRDNLT-YGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRID--TTLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKKGPPALLTMVIT--HSEQMMRSCNSIAVLKDGKVVERGNFDTLYNNRGE 1280          

HSP 2 Score: 64.3142 bits (155), Expect = 1.810e-10
Identity = 57/208 (27.40%), Postives = 101/208 (48.56%), Query Frame = 1
Query: 2239 YPSNKI-PVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRT-EMDSIRQKIGLCPQYNVLFDS-------LTVEDHIYFYGLLKRMDKNEIE-----SVLPRIIKDV--DLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTH--HMDEADYL 2808
            YPS     V+ N++LNF   Q T  +G +G+GK+T  ++L   +   +G+  I   +I+T +   + + I +  Q   LF+        L   D +         +++ I+     ++L R I D+   L   I    + LSGG +++++IA AFI ++ ++FLDE  + +D   R  +   +  +R    TIILT     ++  DYL
Sbjct:  366 YPSRPSEAVLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILTHELSQIESDDYL 573          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: MDL2 (Mitochondrial inner membrane half-type ABC transporter; required for respiratory growth at high temperature; localizes to vacuole membrane in response to H2O2; similar to human TAP1 and TAP2 implicated in bare lymphocyte syndrome and Wegener-like granulomatosis [Source:SGD;Acc:S000006191])

HSP 1 Score: 69.3218 bits (168), Expect = 3.778e-12
Identity = 61/196 (31.12%), Postives = 97/196 (49.49%), Query Frame = 1
Query: 2239 YPSN-KIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDI-RTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINA----LSMH---LSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGI---WDLLIKYRSHDRTIILTTHHM 2790
            YP+   + +  NLN           +G +G GK+T   +L   ++P++GT  I N+DI +    S+R+ IG+  Q  VL  S T+ D+I  YGL     K EI SV  +      +T+  N     +  H   LSGG K++++IA A I    ++ LDE T+ +D  +   I   +  L+K +S   TI+   H +
Sbjct:  455 YPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLM-SGTIRDNIT-YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM--TIVSIAHRL 646          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO46878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNL9])

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 495/1358 (36.45%), Postives = 775/1358 (57.07%), Query Frame = 1
Query: 1204 KVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXX-------------------------------XILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSK--FLDQS---DHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDK--LNNLTGYNISDYLLKNFQRLSRKIF-GGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQ-NSWNYGISVTNYPI------ADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNY-------IKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSE-QKFDDVLQVINLTKIY 5115
            ++ D +W P P    F+   Y+  GF+FLQ+ ID+A + +  N    E G+   + PYPCY+ D+F+  +   +P  + +AW  +  ++IKSIVYEKE RLKE MKVMGL   VHWV+WFI++   ++I ++ + +TL+  +I   S   ++F  +  ++ + I   F++SVFFS+ANV++  GGI++F  Y+ + +    E  ++ +   +  L S  AF  A  ++  +E+   G Q++NL+ +P     F +G+ + +M+ID  +Y L T+Y+EAV PGQYG+ +PW F   +SYW     +S  +  +  +      N  A E+EP +L +G+SI NLVK+Y   K   ++ LNLN YE QI +FLGHNGAGKTTT+S+LTG+F P+ GTA I   DIRT++D +R+ +G+CPQ+NVLFD LTVE+H++FY  LK M+K+ I   + + +KDV LT K + LS +LSGGMKRKLS+AMAF+  SRVV LDEPTAGVDP+ARR IWDLL+KY+  DRT++L+THHMDEAD L DR+AIISQGKLQCCG+ +FLK  +G GYYL+L K        + +                                 ++  F+K +I  A ++E    + T VLP +     KF ++F+ LD+++ ++ + SYG+SDT+LEEVFLKVA++  +     E++  S    + +     ++   +    Q P Q  SK   +D S   D    G  LL +Q  AL +KR+H+ +R+ K F+A++ILP + +   ++  +I    +K   ++++P + + +   EN    Y  ++    L   L   +    G  G  CM+ +  R          +   + P S+  +P  SP+CDCS+  N +C     G PP ++   TS D   +  ++G NISDYLLK + +  +K +    + ++  ++   S     +     +R+S + +  + + P                     +IW N+KGY ++PA+ N LSN +LR++ K    +   YGI+  N+P+       D ET + +      ++V +AI V+ ALSF+ ASFV+FL+ ER+S +K    VSG+ PY+YW++N++WD+  Y IP ++ + IF+AF  +SY  + N      LL+ YG +I P MYP S F S  STA++VL + NL VG   T++TFIL++ ED D+     N +LK VFL+FP Y LGRG+IDL+ N           N+T      D F W++    + ++I+   +++ + ++IE     R   ++  V      +++ ED D+  E+ R+NS      D L+++NLTK+Y
Sbjct:   36 RIRDWYWRPGPN-GWFSKQGYMNFGFVFLQDMIDRALLTISFNETVFEPGTYAQMFPYPCYIRDRFVFYIGGTMPLFMTLAWIYTAAMIIKSIVYEKEKRLKEVMKVMGLGRTVHWVAWFINSASTMLITIIFLVITLKAGRILQHSDPFIIFLFLVVFMFATIMMCFLISVFFSRANVSAACGGIIFFVTYLPYTMVRWFEAFMNSSQIAAACLSSTTAFGVACNYLARYEEQGVGAQWNNLYASPIAGDEFSLGYAMGMMMIDGVLYALATFYIEAVMPGQYGIPRPWYFPLQKSYWFPQKPASPDMDDVAFSPDGATNNDVAMETEPSHLSMGVSIRNLVKIYKEGKKLAVDGLNLNLYEGQILSFLGHNGAGKTTTMSVLTGLFPPTHGTALISGYDIRTDIDMVRRNLGMCPQHNVLFDCLTVEEHLWFYASLKGMEKSRIPGEIEKFLKDVGLTNKRHELSANLSGGMKRKLSVAMAFVAESRVVILDEPTAGVDPYARRSIWDLLLKYKK-DRTVLLSTHHMDEADVLGDRIAIISQGKLQCCGTSLFLKSHYGNGYYLTLTKKTPGLGLDSVDASERDSLGSRSSDSDPISDSVLGDYSDVYCNEKSVTSFIKSHIPSASLVEHVGTELTYVLPSHAAKEGKFQDMFEELDRNLHKLHVGSYGVSDTTLEEVFLKVAEEAQS-----EEAGTSAEVPVRRSTFTFSSHPVKCL--QPPAQGDSKNDSVDGSLEFDDRESGLALLLRQFFALLVKRFHHCRRNRKAFIAQIILPAVFVCLAMIVAQIRPFYEKPA-LELTPHMFVKEEPYENY-VLYANDDPGEPLARNLSDAFLQYPG-LGTWCMSNNCSR----------KPIAFQP-SLSPVPTPSPDCDCSEAMN-VCPAGAGGPPPPTW---TSYDGNIIQKMSGRNISDYLLKTYMKFVKKRYINKIEIMIVREYGGLSFGDNYNNLPANVRNSSDPAIRRLISPRNV------------------KIWYNNKGYHALPAFLNTLSNTVLRAKAKARGLDPSQYGITAYNHPMNYTKEQLDDETFVKR-----AVDVLVAICVVFALSFVPASFVVFLVSERVSKAKHLHLVSGVKPYIYWLANYVWDMCNYFIPAMLCVFIFLAFGDESYTTAMNFPPTFCLLLLYGWSITPLMYPASHFFSVSSTAYIVLISINLFVGINCTLATFILELFED-DKELTDINTVLKSVFLVFPNYCLGRGLIDLAKNQFLGIFSRFGVNLTR-----DPFSWDITGRNIFAMIIEGFVFFTLTVLIEY----RFFIKLRPVKVVLKPVEE-EDDDVQRERQRVNSGLGHATDALRLMNLTKVY 1332          

HSP 2 Score: 191.815 bits (486), Expect = 6.668e-49
Identity = 130/426 (30.52%), Postives = 209/426 (49.06%), Query Frame = 1
Query: 1918 QFSNLFQNPGESL---PFG---VGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPS--NKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            QF  +F   G +L   PF     G  I  MII+ F++  +T  +E  F           F+  R   V  +K  E        + + +   Q   S   +    + + NL K+Y S   +I  ++ L +   + +    LG NGAGKTTT  +LTG    +SG  ++    I ++++   Q +G CPQ++ L D LT +DH+  Y  L+ + +  I  V+  +I+ ++L +  +  +   SGG KRKLS A+A +GN  +VF+DEPT G+DP ARR +W+++       RT+ILT+H M+E + L +RVAI+  G+++C GS   LK KFG+GY + L    +N          I  F    + D            +V  Q        + LF +L+ +     I  Y ++ T+L++VF+  A D
Sbjct: 1237 QFLGIFSRFGVNLTRDPFSWDITGRNIFAMIIEGFVFFTLTVLIEYRF-----------FIKLRPVKVV-LKPVE------EEDDDVQRERQRVNSGLGHATDALRLMNLTKVYRSRRKRIVAVDRLCVGVPKGECFGLLGVNGAGKTTTFKMLTGDIPVTSGEGFVDGHSILSDINGAHQSMGYCPQFDALDDLLTAKDHLRLYARLRGVPERYIPKVVNSLIQRMNLVQYQDVCAGKYSGGNKRKLSTAIALVGNPAIVFMDEPTTGMDPKARRFLWNIITGIMKEGRTVILTSHSMEECEALCNRVAIMVNGQMKCLGSPQHLKNKFGDGYTVILRVAGSNPDTEQVCQFIIQCFPNAVLKDK--------HHNMVEYQIPCQGLSVSRLFGHLEANRKMFDIEDYSVTQTTLDQVFINFAKD 1636          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO38879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBQ0])

HSP 1 Score: 575.859 bits (1483), Expect = 5.294e-175
Identity = 378/1105 (34.21%), Postives = 583/1105 (52.76%), Query Frame = 1
Query:  484 SENETTIESGYNELGEIICGS-PENDFKLFMRNFIKNQRRKRSLLT--CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW--------RLHFQT---FLLDYISNNV---------FINDVKK--------FCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFR------NFLAVIIFNETFQYLTPKNT--TFLSYQIRIPLSRIDSTYKFKVLDR----FWTPYPRR--NTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYS----CGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQ-----------AFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXX----------------XXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLIN-----------------KEKSYYSYYCNI------------LKMK--LRINATKTEIFLNQNP-----------------DQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAE 3426
            + N+  I+  +  LG ++CGS P+      +++    +   +S  T   +L+F     N                 K+ Y PN      +I+ AN TF  ++ L+  + +W        R   Q    F L  +SN +          I+ + +        + K  +S   K    VN +    +    ID V K+  WIE+     +LD F+     KD + L   +F       +  + I+    F  + P  T    ++Y+IR+     ++TY     DR    +W P P+    ++ D      GF++LQ+ I++A + L    E I+    +H MPYPCY  D+F+  + +++P  L ++W  +V ++++SIVYEKE RLKE MK+MGL+N VHWV+WFI+++ V+ I V++++V L+  K+ A S   +++  +  + I  I   F++S FFSKA +A+  GGI+YF  YM FV     EG    T+  S      LLS  AF    ++   +E+  EGVQ+SN+ ++P     F +   +  ++ D+F+Y+++ WY+EAV PG YG+ +PW F    +YW  +  ++ + P +R  N     + +           A+E EP +L LG++I NL K+Y S     ++ LNLN YE QI +FLGHNGAGKTTT+SILTG+F P++GT YI   DIR +MD IR  +G+CPQ+NVLFD LTV++H++FY  +K M  + +++ + ++++D+ L  K N     LSGGMKRKLS+AMAF+  SR V LDEPTAGVDP+ARR IWDLLIKY+   RTI+L+TH M+EAD L DR+AIIS GKL+C GS ++LKR+FGEGY L+L+K   +                   S R+ E +  F+  +I+ A++  ++  ++T +LP N I    F +LF +L+Q++  + I SYG++ T LEEVFLKV D  +N+  N                  +K  +  +  +            L+M   +R     TE  L   P                       F     H L G  L  QQ  AL +KR+HYA+R+FKG +++
Sbjct:    5 ARNKAYIQGMWKNLGPVLCGSDPDEQPDRVVKHMFDYRCLTKSCQTRALRLMFYLLTHNP----------------KILYAPNNTAADDVIKDANRTFSDIEYLQDLAHDWLNTSSQIRRALLQNETQFYLGLVSNYIRAYPDSYWELISGISEKDPTTHAPYFKNIHSLLTKKNGGVNPIIEQLD---RIDAVLKI--WIEQ-TKAFKLDIFV---GFKDEESLVRYAFNTSGVRGDDSSKIVAGIVFTNIEPNKTLPVHVTYKIRM-----NATYFTPATDRIRDSYWRPGPQSWGQSYYDL-----GFVWLQDKIERAVVNLHAMREVIKPAVYLHEMPYPCYSKDRFMLVIQHMMPLCLTVSWIYTVAIVVRSIVYEKEQRLKEVMKMMGLSNVVHWVAWFITSVSVMSITVMLLTVILKYGKVLAFSDPLIIWLSLMLFAIVTIVFCFLISAFFSKAKLAAACGGIIYFLTYMPFVFVSIREGAAHATIESSEKMAISLLSTSAFGLGARYFALYEEQGEGVQWSNIGKSPIRGDDFNLLKVLYFLVFDTFLYVILVWYIEAVHPGSYGLPRPWYFPIQPTYWFGH--NTNACPNLRKKNYRMMTSDEMEDSPQTPGLLAYEREPVHLPLGVTIDNLQKVYKSGT-KAVDGLNLNLYEGQIMSFLGHNGAGKTTTMSILTGLFPPTAGTGYIYGHDIRFDMDKIRHNLGMCPQHNVLFDGLTVDEHLWFYARMKGMAAHAVKTEMNQLVEDIGLPNKRNCAVETLSGGMKRKLSVAMAFVAGSRTVILDEPTAGVDPYARRAIWDLLIKYKK-GRTILLSTHFMEEADILGDRIAIISSGKLRCVGSPLYLKRRFGEGYNLTLVKKSISSPHGSIGSFRRSTSSNLEASRRSEEKLTSFITSHISSAQLKHKTNQEFTFILPDNSIKRGAFKKLFADLEQNIDVLGIDSYGITHTLLEEVFLKVTDVSLNETGNMPHHRQDKLPTQLLQFPADKPGHLGHVLLSPPLPTLPTNEGLEMSDVVRNRGEDTERLLGYQPLSDSGTHQGNLYNEASNGHAAGLFEGVGSHTLTGSALQWQQFYALMLKRFHYARRNFKGVISQ 1070          

HSP 2 Score: 215.698 bits (548), Expect = 4.033e-56
Identity = 146/472 (30.93%), Postives = 233/472 (49.36%), Query Frame = 1
Query: 3748 VSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQ-NSWNYGISVTNYPIADSETKISQFNNLILLEVT---LAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDA----FDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIK--------KTEDFDISLEKNRMNSEQKFDDVLQVINLTKIY 5115
              P C CS  G     D  + G      +  + D L N+TG N+S+YLL   Q      +G   F                        +V Q  P  L+ +      +    ++SK+      W N+KGY ++P Y N+++N +LR+ I  S+ N   YGI+  N+P   + T     +   L + T   +AI+VI+A+SF+ ASFV+FL+ ER + +K  QFVSG++P VYW+SN+LWD+  Y+IP +  I +   F   +Y    N  A + L + YG +I P MYP +F  S  S+A+V +   NL VG   T++TFIL +  D DE     N+++K + L FP Y LGRG++DL+ N           + D+    F+W + S  L  +++              G    +L  +++  +F  + +        +TED D++ E++R+      DD++++ NLTKIY
Sbjct: 1209 AGPGCRCSANGTWYLCDQGAAGKQPKELVTITRDTLQNVTGRNMSEYLLYTTQTFRMHRYGALSF-----------------------GNVVQFVPSRLDSVHIDAVRRLAIREASKS------WYNNKGYHALPTYLNVMNNAILRASIPKSKGNPAAYGITAYNHPFPFNSTSAVHLSADYLRQGTDLVIAIFVIIAMSFVPASFVVFLVTERSTKAKHLQFVSGVDPVVYWLSNYLWDMCNYLIPALACITLLYLFGVPAYASETNFPAVVGLFMLYGWSITPMMYPSAFCFSEASSAYVAMIVLNLFVGVTATVTTFILQLFPD-DEVLTDVNDVIKLISLGFPNYCLGRGLMDLAYNQYLSEYYRQIGEEDSIKSPFEWMIVSRNLVCMLM-------------EGFAFFILTILIEFKFFLKRRRIPVSQLPIETEDEDVAAERDRVLRGDADDDLVKIENLTKIY 1637          

HSP 3 Score: 106.301 bits (264), Expect = 9.685e-23
Identity = 57/160 (35.62%), Postives = 92/160 (57.50%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIP---VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFL 2682
            + I NL K+Y S K      ++ L +   + +    LG NGAGKT+T  +LTG  + ++G A + +  I T++  + + IG CPQ++ L D +T E+HI  Y  L+ + + EI+ V+   I+ ++LT+         SGG KRKLS A+A IG+  ++FL
Sbjct: 1628 VKIENLTKIYYSRKRGKHLAVDRLCVGVPQGECFGLLGVNGAGKTSTFKMLTGDTAMTAGDAVLNSYRIATDIHRVHRCIGYCPQFDALIDEMTSEEHILLYARLRGVPEKEIKQVMKWAIRKMNLTQYAKTPCKTYSGGNKRKLSTAIALIGDPPIIFL 1787          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO48951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI12])

HSP 1 Score: 451.825 bits (1161), Expect = 1.714e-131
Identity = 294/790 (37.22%), Postives = 453/790 (57.34%), Query Frame = 1
Query: 1087 FLAVIIFN-ETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHI--MPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEG--ELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWV---YNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLY--PSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAE 3426
            +LA ++F+ E  +   PK    + Y +R+P S       ++  +R +  +      T   Y  SGF  LQ AID A I+    +        M+I  +PYP Y+ D F+Q +ANLLP LL +A+  S   +IK +V+EK+ RLKE MK+MGL+N++HW +WFI  ++ L   ++I+++ +++ KI   S+  VVF     Y+IS I   F +SVFFS   ++ + G +L++   + + +  + E    LS +   S  LL           +   E    G  FSNL  +P     F +   + +MII S +YL++TWY+  VFPGQYG+ KP+ F   +SYW    ++      +  ++NN         A E EP +L +G+ I +L K++   +     ++NL+LN Y+ QITA LGHNGAGKTTT+SILTG+F+P+SG+A I N+ I T++D IR+ +GLCPQ+NVLFD LTVE+H+ F+  LK       +  + ++I D+ L +K  A S  LSGGMKRKL+ A+A +G S  VFLDEPT+G+DP+ARR  WDLL+K+++  +T+ILTTH MDEAD+L DR+AI++ G+L+CCGS +FLK ++G GY+             + +   I+  V+  +  A+++     +   VL  N   S+ F  LF  L+ +  +  I SYG+S T++EEVF+KV +         EK+      +IL + LRI ++++ +   QN   K  + L  +  L  GF L  Q   A+ +KR+  +KRD K  + +
Sbjct:  129 YLAAVVFDVEKDKLSLPK---VVKYTLRMPHSSAGERKTWRT-ERTYPNFQGIGARTTNFYTFSGFAILQYAIDMAIIQ-AKASLPFPFAYPMNIKQLPYPGYVQDFFVQTVANLLPLLLTLAFIYSAVSIIKELVFEKQQRLKESMKMMGLSNWIHWSAWFIKCLLFLGFTIIIITIFVKVLKIFEFSNGIVVFLFFLCYIISMISYCFFISVFFSNPTLSMLFGSVLWYAALLPYQLLAQNENYDTLSQSAKASMCLLPNTCLGIGATLIARLEGFKTGASFSNLASSPSADDHFSLAWVLGMMIISSLVYLILTWYISTVFPGQYGIPKPFYFPFMKSYWCGFSHDDVVEAGLERVKNN--------PAIEDEPTDLAIGVQIKDLRKVFKGSTGSKVAVDNLSLNMYKGQITALLGHNGAGKTTTMSILTGLFTPTSGSAMIDNKSILTDIDGIRESLGLCPQHNVLFDRLTVEEHLEFFINLKGKYGQAAKDEVLQMITDLQLLDKRKAKSSELSGGMKRKLNCAIALVGGSETVFLDEPTSGMDPYARRATWDLLLKHKA-GKTVILTTHFMDEADFLGDRIAIMADGQLRCCGSSLFLKSRYGVGYH------LTLVKKEDCDDNAIINAVRETVPSAQVLSNVGAEIEFVL--NGEASKDFESLFVKLENNKEDYGIASYGVSCTTMEEVFMKVGE-------GSEKTVE----DILNLLLRILSSQS-LLRYQNIKIKILRLLKSNYPLQTGFALQWQHYKAMLVKRFINSKRDKKSVVTQ 884          

HSP 2 Score: 209.92 bits (533), Expect = 2.125e-54
Identity = 129/424 (30.42%), Postives = 222/424 (52.36%), Query Frame = 1
Query: 1912 GVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQ---AFESEPENLKL-GISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            G+QF++   N       GVG   + M +++ +  ++T  ++        V +P+                  IP+    +Q+C++  +        PE +K   + + +L K+Y  +    +++L +     +    LG NGAGKTTT S+LTG  S S GTAY+   DI+T +  ++Q+IG CPQ++   + +T  + +  +  L+ +  ++I +V+   I+ ++L +  + L    SGG KRKLS A+A +GN  ++FLDEPT G+DP ARR +WD L       R+I+LT+H M+E + L  R+AI+  G+ +C GS   LK +FG GY L L         SN       +FV      A+++E      T  +   +++   ++ +F  L+++ A ++I+ Y +S TSLE+VFL +A +
Sbjct: 1334 GIQFTDSSLNWDRP---GVGQHALYMAVEAVVLFILTLLIQ--------VRRPYRL----------------IPICPWTSQDCDVAGERARVHSLNPEQIKKESVIVKDLTKVYHGSDRTAVDHLCIGIPRGECFGLLGVNGAGKTTTFSMLTGDQSISEGTAYLDGYDIQTHLKEVQQRIGYCPQFDAFIERMTGREMLTMFARLRGVQPDKIPNVVSTTIEHLNLGKWADKLCGDYSGGNKRKLSTAIALVGNPPIIFLDEPTTGMDPVARRFLWDSLTHVMKGGRSIVLTSHSMEECEALCTRLAIMVNGQFKCVGSAQHLKSRFGMGYTLMLKVEARLVPVSNTE-----QFVSSTFPGAQLLESHNGMLTYQINSTELS---WSRIFGELERNRASLNIVDYSVSQTSLEQVFLNLAKE 1722          

HSP 3 Score: 105.916 bits (263), Expect = 1.069e-22
Identity = 78/240 (32.50%), Postives = 137/240 (57.08%), Query Frame = 1
Query: 4126 NSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIAD-SETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITT----MSTFILDI--IEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNY 4824
            N+ GY  + +  N LSN+LL    +LS +S   GI  TN+P+ + ++ K     + I + + LAI++ + ++F++ASF+ FL+ ER S +K  QFVSG++ + YW + + WD + Y++P ++I+I+F AF  + +    +  +  LLLI +GL ++P +Y  SF   +   A+    A  + V SI +    ++ F+  I  +   DE      EI+  VF++ P Y +   +ID+S+NY
Sbjct: 1092 NASGYHIIASSINALSNILLA---ELSGDS-EQGIETTNHPLPNNAQNKADNVTSTISV-LFLAIFMSMGMAFMAASFITFLVQERTSKAKHLQFVSGVDAFSYWSATYTWDFLNYLVPCLLILILFAAFQIEEF--ENDMGSVFLLLILFGLVVLPFIYVMSFAFKSQLIAY----AMTVFVLSIMSFGMLLAVFLCRIPSLNLLDEA-----EIMHYVFMLLPTYTVSYALIDMSTNY 1315          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO32070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW56])

HSP 1 Score: 275.404 bits (703), Expect = 1.970e-80
Identity = 184/530 (34.72%), Postives = 308/530 (58.11%), Query Frame = 1
Query: 1261 KYVLSGFIFLQEAIDQAFIELVTNNESIEVGS-SMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMY--YSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESE---PENLKL----GISIHNLVKLYPSNKIPV-INNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIR--TEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLS 2811
            KY++     LQ +ID A  ++V N     V + ++ +MP   +     LQ +  ++P  +V+A+ P +T+L+ ++V EK+ + KE M++MG+ +  +W+SWF++  +V++I  +IM     ++     S+  V+  V + Y +S I  +FM+S  F     A    G +   F  +F V I      S+  Y  +   + S  AF+ A+   +   +++ G QFSNL    G+   F V +CI+++I+D  +YLLI  Y++AV P +YG  +P  F+   S+W    +      L  +  +     H+ + SE   P   ++     ISIHNL K++P  K  V ++ ++++ YE QITA LGHNGAGK+T I  LTG+  PSSGTA I  +DI    ++  +R+ IG+CPQ +V+F+ LTV++H+ FY  LK    ++  +    I+K++ L EK + ++ +LSGG KRKLS+ ++ +G+ +V+FLDEPT+G+DP +RR +W LL + +  ++ ++LTTH MDEAD L+
Sbjct:    8 KYLIYNTTTLQASIDAAISKVVANLPFYIVPNITVQMMPKAQF--TPSLQGIQTIVPIYMVLAFSPYITILVINLVREKQEKHKELMRIMGMVDTAYWLSWFLTYAIVVLIACLIMVTVSVIAGFFGESNYLVLLIVFYLYGLSIIMLSFMMSPLFKNPKTA----GFIASLFTAIFAVLIIPLTGPSIPQYAKWLVSIFSPTAFAFALNEAV---EVHPGAQFSNL-ATKGD---FPVLNCIVMLIVDILLYLLIALYLDAVVPAEYGRRQPPYFIFQPSFWKTMFQRGGG-SLEAHGVRRQLSAHEVYSSEDVEPVAQEMHGREAISIHNLKKVFPGKKPTVAVDGISMDIYEGQITALLGHNGAGKSTLIGALTGMIQPSSGTALIYGKDISRFGDLAELRRNIGVCPQQDVIFEFLTVKEHLEFYFKLKTGGDSQQNNGADAILKEIGLQEKKDDIAKNLSGGQKRKLSVGISLVGDPKVLFLDEPTSGMDPHSRREMWKLL-QGQCKEKCVLLTTHFMDEADILA 522          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO32071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW57])

HSP 1 Score: 168.703 bits (426), Expect = 7.039e-46
Identity = 102/304 (33.55%), Postives = 168/304 (55.26%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXX--XXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            V+ ++       ++   LG NGAGKTTT++++T     S G+  +   D++TE   + Q +G CPQ + LFD +T+E+H+  Y  ++ +    I++V+   +  + +TE  N  +  LSGG KRKLS  MA +G+  ++ LDEP+ G+DP ARR     L K  +  R  ILTTH M+EAD L  RV I+ +G+L+C GS   LK KFG GY L +  + +  +          ++ FV+    +A+  E    +    +P+++++  K +  F  L++    + I  Y  S ++LE+VFL+ A
Sbjct:    3 VVKDVYFGVTPGEVFGLLGPNGAGKTTTLNMMTAGIPASRGSVSVAGYDLQTETHKVFQHMGFCPQQDALFDDITLEEHLTLYASVRGVPWASIDNVVNHYMSAMKITEHANKRAKELSGGTKRKLSFGMAMLGDPDLLLLDEPSTGMDPSARR----FLCKNVTGARGAILTTHSMEEADALCSRVGIMVKGQLKCLGSTQHLKSKFGSGYTLEIKLSPSFQSSDPDVDMQTQLVAFVEGLFPNAKRTESFGDRVIYKVPKSNVS--KLSSTFATLEEGKRSIGIEEYSFSQSTLEQVFLEFA 300          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: ENSORLT00000045391.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 854.358 bits (2206), Expect = 0.000e+0
Identity = 559/1607 (34.79%), Postives = 888/1607 (55.26%), Query Frame = 1
Query:  547 PENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSAN--PKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRF--IPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXX--------------------------------------XXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD--------PMNKLINKEKSYYSYYCNILKM-----KLRINATKTEI---FLNQNPDQKQSKFLD-QSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWSPA---SILDIPM--------VSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQ--EFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKIS-QFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 5121
            P +D +  M +  +N +       C  +  +      ++F ++    PL+ GKV Y P+    R ++E+AN TF  L  ++  +  W      F+  ++ N   + +         S +  P   DA N L +   + S +             L C EL++F  +P +     + L +     F A I+F E  Q  +     +L Y+IR+ +  +  T K  V +R W+P    N + + +Y+  GF +L++ ID A I L T+  S  +G  +  MPYPCY+ D FL+ LA  LP  + +AW  SV +++K IV +KESRLKE +++MGL   V+W +W ++ ++ + I  V++++ ++  K+   S  +VVF  +  + +S I + F++SVFFSKAN+A+  GG++YF  Y+  V+       +         LLS VAF    + +  +E+   G+Q+ N+  +P E   +     I++M++D+ IY ++TWY+E VFPGQYG+ +PW FL   SYW       E IP      +   + ++  E    N+K G+SI NLVK+Y + K   ++ L+++FYE+QIT+FLGHNGAGKTTT+SILTG+F P+SGTA I   DIRT+MD+IR+ +G+CPQ+NVLFD LTVE+HIYFYG LK ++ +E+++ + ++IKDV L  K   L  +LSGGM+RKLS+A+AF+G S++VFLDEPTAGVDPFARRGIWDLL+KY+   RTIIL+THHMDEAD L DR+AIIS GK++CCGS +FLK+ FG GYYL+L+++      + R+G                                      +++ +FV+ ++ +A  +E    + T +LP        F  LF+ LD+ M ++ + SYG+SDT+LEE+FLKVA+D        P  + + K+    S       M     K     TK E+     N+  D K+S  ++ +   ++ G+ L++QQ +AL IKR+H+A+R  KG +A+++LP + +   ++F  I         +++ PW+  S+       TFY  +      ++++      + G  G RCM  NP I RL    C     ++ +SP+   S+ DI +         SP C CS  G  I    C     G  P   R+  ++D L NLT  N++D+LLK ++   +K +GG      N    S  L+ +    +            NLEP  +    Q  E   K   T N  ++W  +KG+ SM ++ ++++N +LR  +   QN   YG+SV+N+P+  S+ ++S         +V ++I VI A+SFI ASFV+FLI ER+S +K  QFVSG+NP VYWV++F+WDI  Y+IP  +++ IFI F  ++Y+  +N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF++++ E  DE+    N I+K+V LIFP + LGRG++D++ N    N+   + +    D   W +  + L ++ +   + +   +     +I    +   ++S    + ++ ED D++ E+ R++  +  +DVL++ +LTK+Y R
Sbjct:   17 PTSDQQDTMNSSFQNSQDSDPF--CTTLIDTMVTTPSMQF-LWKNFRPLLKGKVLYTPDTPAARLLVEEANATFMALAAIKEFADSWG-EDGPFVWGFVENGTAVVNESSANSNNSSTDTPPTSEDAYNDLTHFLKLLSKV-------------LGCFELNKFEAVPTEYELVTEALEHLKNDTFWAGIVF-ENLQPNSSSIPPYLKYKIRMDVEEVQRTDK--VENRLWSPGANDNPYENLRYIWGGFAYLEDIIDHASIRLQTST-SQPLGVYVQQMPYPCYVDDPFLRALAGFLPLFMTIAWIFSVALIVKGIVGDKESRLKETVRIMGLRGEVYWSTWLLTCLLPMAISSVLLTIIIKYGKVLQYSDPSVVFIFLLVFCLSTISECFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFQAKVGVSLLSCVAFGYGCENLSKFEEQGVGIQWHNIATSPEEGQRYTFIVSILMMLLDAAIYWVLTWYIENVFPGQYGIPRPWYFLFTYSYWFGKTSVPEDIPDNFKLLKRSSVPNEFLEKPDPNMKAGVSIRNLVKIYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDNIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVFLDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNTKDELKKKLSNKVEDFKKSASVNGRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQ------TTFYSNDMPEDANVSRVVETLVDNPG-FGTRCMEGNP-IPRL---PC-SSGASDWFSPSVDQSVADIFLNGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGISVGGIN----SQVLLTEVEIEEAF---------ANLEPPGYGDTIQKAEMVLKKLGTRNNVKVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQNLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTL-----LIQYKFFYKPRLSLPKVQSEEKEDVDVARERQRVHEGRANNDVLRICDLTKVYPR 1568          

HSP 2 Score: 197.208 bits (500), Expect = 4.187e-50
Identity = 112/322 (34.78%), Postives = 173/322 (53.73%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESR--LQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + I +L K+YP    P +  L +    ++    LG NGAGKTTT  +LTG    SSG A++    IRT+M  + Q +G CPQ++ + D L   +H+  Y  L+ + + E+  V    I+ + L +  N  +   SGG KRKLS AMA IG   V+FLDEPT G+DP ARR +WD ++      R+++LT+H M+E + L  R+AI+  G+ QC GS+  LK +FG+GY                + + +  FV+       + E+    LQ+ + L Q    ++ FTE    L  H  E+ +  Y +S T+L++VF+  A +
Sbjct: 1557 LRICDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGY-----TLIVRVGGCPPDLKPVEDFVEETFPGTVLKEKHHNTLQYQL-LSQEGALAKIFTE----LTDHQQELGLEDYSVSQTTLDQVFVNFAKE 1868          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: ENSORLT00000046301.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 561/1607 (34.91%), Postives = 886/1607 (55.13%), Query Frame = 1
Query:  547 PENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSAN--PKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRF--IPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXX--------------------------------------XXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD--------PMNKLINKEKSYYSYYCNILKM-----KLRINATKTEI---FLNQNPDQKQSKFLD-QSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWSPA---SILDIPM--------VSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQ--EFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKIS-QFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNR 5121
            P +D +  M +  +N +       C  +  +      ++F ++    PL+ GKV Y P+    R ++E+AN TF  L  ++  +  W      F+  ++ N   + +         S +  P   DA N L +   + S +             L C EL++F  +P +     + L +     F A I+F E  Q  +     +L Y+IR+ +  +  T K  V +R W+P    N + + +Y+  GF +L++ ID A I L T+  S  +G  +  MPYPCY+ D F+Q +  +LP  L++A+  SV + IK +V EKE RLKE ++ +G+ N   W S F  T+++L +P V+MSV ++  K+   S  +VVF  +  + +S I + F++SVFFSKAN+A+  GG++YF  Y+  V+       +         LLS VAF    + +  +E+   G+Q+ N+  +P E   +     I++M++D+ IY ++TWY+E VFPGQYG+ +PW FL   SYW       E IP      +   + ++  E    N+K G+SI NLVK+Y + K   ++ L+++FYE+QIT+FLGHNGAGKTTT+SILTG+F P+SGTA I   DIRT+MD+IR+ +G+CPQ+NVLFD LTVE+HIYFYG LK ++ +E+++ + ++IKDV L  K   L  +LSGGM+RKLS+A+AF+G S++VFLDEPTAGVDPFARRGIWDLL+KY+   RTIIL+THHMDEAD L DR+AIIS GK++CCGS +FLK+ FG GYYL+L+++      + R+G                                      +++ +FV+ ++ +A  +E    + T +LP        F  LF+ LD+ M ++ + SYG+SDT+LEE+FLKVA+D        P  + + K+    S       M     K     TK E+     N+  D K+S  ++ +   ++ G+ L++QQ +AL IKR+H+A+R  KG +A+++LP + +   ++F  I         +++ PW+  S+       TFY  +      ++++      + G  G RCM  NP I RL    C     ++ +SP+   S+ DI +         SP C CS  G  I    C     G  P   R+  ++D L NLT  N++D+LLK ++   +K +GG      N    S  L+ +    +            NLEP  +    Q  E   K   T N  ++W  +KG+ SM ++ ++++N +LR  +   QN   YG+SV+N+P+  S+ ++S         +V ++I VI A+SFI ASFV+FLI ER+S +K  QFVSG+NP VYWV++F+WDI  Y+IP  +++ IFI F  ++Y+  +N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF++++ E  DE+    N I+K+V LIFP + LGRG++D++ N    N+   + +    D   W +  + L ++ +   + +   +     +I    +   ++S    + ++ ED D++ E+ R++  +  +DVL++ +LTK+Y R
Sbjct:   17 PTSDQQDTMNSSFQNSQDSDPF--CTTLIDTMVTTPSMQF-LWKNFRPLLKGKVLYTPDTPAARLLVEEANATFMALAAIKEFADSWG-EDGPFVWGFVENGTAVVNESSANSNNSSTDTPPTSEDAYNDLTHFLKLLSKV-------------LGCFELNKFEAVPTEYELVTEALEHLKNDTFWAGIVF-ENLQPNSSSIPPYLKYKIRMDVEEVQRTDK--VENRLWSPGANDNPYENLRYIWGGFAYLEDIIDHASIRLQTST-SQPLGVYVQQMPYPCYVDDPFIQSIGAILPMFLILAFMSSVAMTIKGLVLEKELRLKEVLRGVGIQNGALWSSTFTETMILLTVPCVLMSVMVKYGKVLQYSDPSVVFIFLLVFCLSTISECFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFQAKVGVSLLSCVAFGYGCENLSKFEEQGVGIQWHNIATSPEEGQRYTFIVSILMMLLDAAIYWVLTWYIENVFPGQYGIPRPWYFLFTYSYWFGKTSVPEDIPDNFKLLKRSSVPNEFLEKPDPNMKAGVSIRNLVKIYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDNIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVFLDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNTKDELKKKLSNKVEDFKKSASVNGRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQ------TTFYSNDMPEDANVSRVVETLVDNPG-FGTRCMEGNP-IPRL---PC-SSGASDWFSPSVDQSVADIFLNGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGISVGGIN----SQVLLTEVEIEEAF---------ANLEPPGYGDTIQKAEMVLKKLGTRNNVKVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQNLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTL-----LIQYKFFYKPRLSLPKVQSEEKEDVDVARERQRVHEGRANNDVLRICDLTKVYPR 1568          

HSP 2 Score: 197.593 bits (501), Expect = 3.782e-50
Identity = 112/322 (34.78%), Postives = 173/322 (53.73%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESR--LQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + I +L K+YP    P +  L +    ++    LG NGAGKTTT  +LTG    SSG A++    IRT+M  + Q +G CPQ++ + D L   +H+  Y  L+ + + E+  V    I+ + L +  N  +   SGG KRKLS AMA IG   V+FLDEPT G+DP ARR +WD ++      R+++LT+H M+E + L  R+AI+  G+ QC GS+  LK +FG+GY                + + +  FV+       + E+    LQ+ + L Q    ++ FTE    L  H  E+ +  Y +S T+L++VF+  A +
Sbjct: 1557 LRICDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGY-----TLIVRVGGCPPDLKPVEDFVEETFPGTVLKEKHHNTLQYQL-LSQEGALAKIFTE----LTDHQQELGLEDYSVSQTTLDQVFVNFAKE 1868          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: abca1a (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163147])

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 576/1782 (32.32%), Postives = 911/1782 (51.12%), Query Frame = 1
Query:  274 NWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICGSPE--------------NDFKLFMRNFIKNQR-------RKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---RLHFQTFL-----LDYISNNVFINDVKKFCKAYYSANP-KICDAVNTLFNITNVKSYIDGVSKLFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGS-------------LVFLKRKF-------------------------GEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLI----------NKEKSYYSYYCNILKMKLRINATKTEIFLNQ---NPDQKQSKFLDQSDH----LLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDI--------PMVSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQR-----LSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK---YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRML---KVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLC 5208
            +WL    + F   +  +  I  SL +G       M  +  +   F     S+  + K I+ L  T N   S N+      Y  +  I+CG PE              N++K    N   +            S   C  + +S   + I +  ++  L PL+ GK+ Y P+    ++II + N TF+ L  LR     W   +  F  F+     +D + N +  N    F  A  S    ++ D  N L   +  K         ++W             I R + C  LD+  P+    + ++L N+S      + F A I+F +            ++Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ I+Q  I  VT ++  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV ++IK +VYEKE+RLKE M++MGLNN   W+SWFIS+++ L+I   ++ + L++  +   S   VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +         LLS VAF    ++   +E+   G+Q+SNL  +P E   + +   I LM+ D+ +Y ++TWY+E+VFPGQYG+ +PW F   +SYW    K ++++  + +   N E+     E EP +++ G+ I NLVK+Y       ++ L+L FYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYIL +DIR+E+ +IRQ +G+CPQ+NVLF  LTVE+HI+FY  LK + + ++++ + +I+ DV L  K  + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP+ARRGIWDLL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS             L  +KR +                          E    + L ++ +   +  +   I   +  ++ +AR++E+   + T VLP        F ELF  LD  + ++ I SYG+SDT+LEE+FLKVA+D     +           + +  +  + + LK       T+ E   N    +P+ +++ +L  +D      +KG+ L +QQ +AL  KR+ YA+R  KGF A+++LP + +   ++F  I     K   + + P +   +       +F   +       NKL        G  G RCM      + N  C    +   W+      S+ DI           SP C CS  G +     C D   G PP         + L NLTG N+SDYL+K + +     L  KI      +GG+        A+SS+ ++     DG                RF      F  +   + N  +IW N+KG+ S+ ++ N+++N +LR+ +   ++   +GI+  N+P+  ++ ++SQ   +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P++YW++NF+WD+  YI+P  ++IIIF+ F   +Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   ++STF+L++    +      N+ILK VFLIFP + LGRG+ID+  N    +  + + +        W++  + L ++ +  ++++         +   + YR     + S  + K    ED D++ E+ R+ S     D+L++  LTKIY R                    QK AV+ LC
Sbjct:  225 DWLNKAQSHFLSNLDFLKPIRVSLSTG-------MDGVHPDSQSFFSSMKSWKDMRKEILYL--TANPTGSPNQM-----YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGNHGNDSDIEPMSIYDNSSTPYCNNLMKSLESSPISRM-IWRALKPLLMGKILYTPDTPATQRIIHEVNKTFQELGVLRDLGGMWEEMKPQFWNFMENSEEMDMVRNLLQSNVGAAFLNAQLSGTEWRVSDVANFLSKASEDKR---PAGTAYTWRDAFNESDHAIQTISRFMECVNLDKLEPV---ANEERLVNKSMSLLDNQKFWAGIVFPDIVHSDNSDLPPNVNYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDLRYVWGGFSYLQDVIEQGIIRAVTGSKE-KTGIYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLNNGTLWLSWFISSLIPLLISAGLLVMLLKMGNLLPYSDPGVVFLFLGSFGVVTIMQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFGAKVLVSLLSPVAFGFGCEYFALFEEQGVGIQWSNLLASPLEEDSYNLTTSICLMLFDAVLYGIMTWYIESVFPGQYGIPRPWYFPFTKSYWCGE-KENKNMSALLSKKGNAEV---CIEEEPGHIEPGVYIENLVKVYSHGNKLAVDGLSLKFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSELSTIRQNLGMCPQHNVLFSMLTVEEHIWFYARLKGLSEEKVKAEMEQIVNDVGLPHKRKSRTNTLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTMVKRDYDLALQSCRNSASTVSYSKKTEKDSISESSSDAGLGSEPDSETTTIDVSLISNVIFKHVREARLVEDLGHELTYVLPYQSAKDGAFVELFHELDDRLTDLGISSYGISDTTLEEIFLKVAEDSGVDAVELSDGVVPTRTRRRHAFGDHQSCLK-----PFTEDEFDFNDSEGDPESRETDWLGGADGKGSFQVKGWSLKRQQFVALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALHPSMYGEQF------SFISNDMPDDPHTNKLLGALMEKPG-FGSRCMKGE--PIPNTPCTAVEDE--WAVPEVSESLRDIFAKGNWTRENPSPLCQCSCEGRKRMLPECPDGAGGLPPPQV------NTLQNLTGRNVSDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSL-----GARSSQFLSHKDDIDGTAAD------------RFFHSLSSFI-QGLDSKNNVKIWFNNKGWHSISSFLNVMNNGILRASLPAGKDPTKFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFC--------ITVLIQYRFCITTRSSISHLKPIGEEDEDVARERQRVLSGSGQSDILELRELTKIYKR-------------------KQKPAVDRLC 1908          

HSP 2 Score: 194.126 bits (492), Expect = 4.590e-49
Identity = 102/320 (31.87%), Postives = 176/320 (55.00%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + +  L K+Y   + P ++ L +     +    LG NGAGKT+T  +LTG    +SG AY+  + + TE+D + Q +G CPQ++ + D LT  +H+ FY +L+ + + E+  V    I+ + L + ++  +   SGG  RKLS A+A IG   VVFLDEPT G+DP ARR +W+ ++      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           +  + +   ++ F++  +  + + E+ R      LP +  +      +F  L ++   + I  Y +S T+L++VF+  A D
Sbjct: 1887 LELRELTKIYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSLVTSGEAYLAGKSVTTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVAEWGIRKLGLVKYVDKSAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNAILSIIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIILRVAGPDPDLRPVMGFIERELPGSTLKEKHRNMLQYQLPSSLTS---LARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKD 2198          

HSP 3 Score: 67.781 bits (164), Expect = 1.117e-10
Identity = 33/80 (41.25%), Postives = 45/80 (56.25%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            +S QL  LLWKNF  +RR+   LLIE+  PL + FIL +VR     Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    3 VSTQLGLLLWKNFTYRRRQTIQLLIEIIWPLFIFFILISVRMYYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: zgc:172302 (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101162276])

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 583/1845 (31.60%), Postives = 931/1845 (50.46%), Query Frame = 1
Query:  220 LTDFLCTFNTSCYDQT-QINWLGTNLNEFHVFIGNI-TEIYNSLPS---GALNVPKFM--KWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMS-------------ENETTIESGYNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT---CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTF---KILDNLRLASVEWRLHFQTFL-----------------LDYISNNVFINDVKKFCK-AYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDS-LKDIDK----LTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLT--------------MYYSCGL----------LSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXX--------------------------------------XXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMK-LRINATKTEIFLNQNPDQKQSKFLD---QSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKM-----------GKEN-LNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKI-----------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQ-------SQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAK------YDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNN----------KIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF 5211
            L D +C  N S  ++   +    TN+ +    + N+  E+     S     L++ KF+  + + SN  +   +  + S IS+ +  L  +++ + S             E+ T     ++   +I+CG PE              NDFK L  ++ I++     S  T   C+ +      +   +  ++  + PL  GK+ Y P+   +++++++ N TF   ++L ++  A +E     +T++                 +  + N    N      + A++ + P           +T +  Y D  S + + + +   C  LD+   L+S  K ID+    L N+ F   +  ++ N +   L P     +SY+IR+ +  +  T K K  D FW P P    F+D +Y+  GF+++Q+ +++A  +++T  +    G  +  MPYPCY+ D FL+ L   LP  + +AW  SV ++ KSIVYEKE+RLKE M++MGL++   W SWFIS+++  +I   ++   L+   I   S  AVVF  +  +  + I Q F++S FF KAN+AS  GG++YF+ Y+ + +F      L+ T              +Y+  G+          LS VAF    ++   +E+   G+Q+ NL  +P E   +     II++ +D+FIY L  WY+EAVFPG++G+ +PW F+   +YW   +     +P+        E N    E+EP N+ LG++I NLVK+Y       +N+LNL F+E QIT+FLGHNGAGKTTTIS+LTG+F P+SGT YI   DIR +MD IR  +G+CPQ+NVLFD LTVE+H++FYG LK + + ++++ L  +++DV L  K +  + +LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIWDLL+KYR   RTIIL+TH+MDEA+ L DR+AIIS+GKL CCGS +FLK + G GYYL+++K +                                           S+     +L  V+ +I  A ++EESR +  I LPQ              LDQ + E+ I SYGLSD++LEE+FL+VA++     ++ E        N  +    R+     E      P+  ++  L    +    L G  L+ QQ+ AL IKR+ YA+R  +GF A+++LP L +L  +LF  I     +   +++ PW+   +              EN L     +       + K E    S   E G +   P +     +Q F +   +   P         SPEC CS          C +   G PP   + +T  D L NLT YN+SDYL+K + ++ +K            +GG        F+   K+       + + D+V+        +Q  +L+ L  L     F        N  ++W N+KG+ SM ++ N+++N LLR+ +        +GIS  N+P+  ++ ++++   +   ++V ++  VI A+SF+ ASFV+FLI+ER S +K  QFVSG+ P +YWV+NF+WD++ Y +P  ++++IFI F  +SY+  +N  A ILLL+FYG +I P MYP SF  + PSTA+VVL + NL +G   +M+TF+L++    D+     N +LKKVFLIFP + LGRG+ID++ N     M D + +       D F W+   + L               +   GV   +   +L+  +F +               ED D++ E+ R+ S +   D+L +INL+K+Y                      +K AVN LC 
Sbjct:  192 LKDVVC--NGSLLEKMLSVEGGATNMTDLQTQLCNLPAEVLKEAESLFFSQLDLTKFITRELVVSNAEDLRVMSQAISTISQDLTVLTDSISSLSSFTEVSQALSFLTPESNTAEGERFSAFSKIMCGHPEMGGERIPSFNWYEDNDFKSLLGKDAIEDANLGLSNTTTPFCRSLIHQLESDPRSRI-VWRGIKPLFVGKLLYAPDTPAVKEVMKEVNKTFEDLQVLQDVDEAWMEVGPEIKTYMETSSDIRLLRDLLRRPEVAVLVNMRLENTPWTASQIAHFLSTPSPNAERKPGHPVTWLDLYND-FSHVTNTVAQVTKCISLDKLEGLESEAKLIDRALELLDNRQFWGGVLFLLPNSSTTELPPH----VSYKIRMDIDNVARTNKIK--DNFWDPGPAAEPFSDLRYIWGGFVYIQDLVERALNQVLTGIKQT-TGIYIQQMPYPCYVDDVFLRVLNRSLPLFMTLAWIYSVAMITKSIVYEKEARLKETMRIMGLSSGTLWFSWFISSLIPFLISAALLIGLLKWGNILPYSDPAVVFFFLMAFATATIMQCFLISTFFCKANLASACGGLIYFSLYLPYALFTAWRDHLNSTHRILNCIFSPFIVKIYFCLGMFFFLREFLSFLSPVAFGFGCEYFAQYEEQGLGIQWFNLQSSPVEGDSYSFTTSIIMLYVDAFIYALAAWYIEAVFPGEFGIPRPWYFIFQLNYW-GGVPLEAGMPIPPAPTDQDEDN---IEAEPSNMTLGVNIRNLVKIYKKGGKLAVNHLNLKFFEGQITSFLGHNGAGKTTTISVLTGLFPPTSGTVYIKGLDIRYDMDIIRNTLGVCPQHNVLFDILTVEEHVWFYGCLKGLSEEKVKAELDNLLEDVGLLHKRHEQTKNLSGGMQRKLSVAIAFVGGSKVVVLDEPTAGVDPYSRRGIWDLLLKYRK-GRTIILSTHYMDEAELLGDRIAIISKGKLCCCGSPLFLKSQLGSGYYLTVVKREETNPNTPSGSSFSTSTSIITNKLPHAKDSESSLSEDTGLGSDESSSCVAALLALVQQHIPSASLVEESRREAVINLPQKAAKDGSLAIFLSKLDQRLPELGISSYGLSDSTLEEIFLRVAEE---TGVDAEPEQEELSPNSQQPSGERVEEQPAE---QPEPEPLETDLLSGDCRGGEPLSGSWLMWQQLKALFIKRWLYARRSRRGFFAQIVLPALFVLVALLFSLIVPPFGRYPSVELQPWMYGEQYTFFSNDAPGNPAMENLLEALLDQPGFGTKCMEKEEGNNTSCEVEGGGQFRRPQV-SFSMWQMFSKGNWSKERP---------SPECQCSTEDVSRMLPECPEGAGGLPPPQIKRVT-GDILQNLTSYNVSDYLVKTYAQILKKSLKTKKLVNEFRYGG--------FSLGGKVTQTEVDVEHVEDAVSAFRRRYQVTQNSSLDSL--LNKLPAFLEGLHSKDNV-KVWFNNKGWHSMVSFVNVMNNGLLRASLPPGPERSKHGISAYNHPLNLTKDQLTEVALMATSVDVLISTCVIFAMSFVPASFVLFLIEERASKAKHLQFVSGVQPLLYWVANFIWDMLNYAVPAAMVVLIFIGFQQKSYVSEQNLPALILLLLFYGWSITPLMYPASFVFTVPSTAYVVLTSINLFIGINCSMATFVLELF--VDDNLNQINNVLKKVFLIFPHFCLGRGLIDMAKNQA---MADAFHRLGARPVLDPFQWDFVGKNL-------------FCMAASGVFYFIFTILLQYKFFIHLKPWWTEPQLPPIGPEDEDVARERARVMSGKFHSDILTMINLSKVY-------------------KAGKKPAVNRLCL 1955          

HSP 2 Score: 184.496 bits (467), Expect = 4.557e-46
Identity = 99/320 (30.94%), Postives = 172/320 (53.75%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            +++ NL K+Y + K P +N L L     +    LG NGAGKT+T  +LTG    + G A++    + TEMD + Q +G CPQ++ + D LT  +H+  Y  L+ + +  +  V    ++ + LT+     +   SGG KRKLS A++ IG   V+FLDEPT G+DP A+R +W+ +       + ++LT+H M+E + L  R+AI+  G+ QC GS+  LK +FG+GY    +  +   + S+     + +++     +  + E+ +      LP +  +      +F  L  +  E+ +  + +S T+L++VF+  A D
Sbjct: 1933 LTMINLSKVYKAGKKPAVNRLCLGIPPGECFGLLGVNGAGKTSTFRMLTGDTPITHGEAFLDRHSVLTEMDRVHQLMGYCPQFDAISDLLTGREHLELYARLRGVPEESVSKVAQWGVRKLGLTQYAEQKAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVTKEGKAVVLTSHSMEECEALCTRMAIMVNGQFQCLGSVQHLKNRFGDGY---TVILRLADTKSDTESCPVDEYMTKSFPNIELKEQHQNVLQYHLPSHGCS---LALIFDALANNCEELGVADFSVSQTTLDQVFISFAKD 2246          

HSP 3 Score: 67.3958 bits (163), Expect = 1.804e-10
Identity = 32/78 (41.03%), Postives = 42/78 (53.85%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            +QL  LLWKN   +RR    L+IEL  PL +  IL AVR S   YK   C F  K + S G +P++   +C  N  C+
Sbjct:    5 HQLYLLLWKNVTYRRRNKIQLIIELAWPLFLFLILIAVRQSHPPYKQGQCHFPNKALPSAGTLPWIQSIVCNVNNPCF 82          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: abca4a (retinal-specific ATP-binding cassette transporter [Source:NCBI gene;Acc:101171449])

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 509/1582 (32.17%), Postives = 830/1582 (52.47%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVN-----TLFNITNVKSYIDG-----------------VSKLFSWIERGLN----CTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYY---------------------------XXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMW-----SPASI--LDIP-----MVSPECDCSKTGN----QICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSR-----KIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQ-SQPQNL-------EPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNL-ILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKY------DAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKK---TEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRT 5124
            M+N + P++ G++ Y P+   +R++I+ AN TF+ L+ LR     W       +  +  + + +  ++   +     NP + D ++       F+  ++ +++                   V K+   + R LN    C  LD+F+   +L D D +T ++        F A +IF     + T      + ++IR+ +  ++ T K K  DR+W P PR +   D +YV  GF + Q+ I+   I   T  E   +G  +  MPYPCY+ D F   L    P  +V+AW  SV++++KSIV EKE RLKE +K MG+ N V W +WFI + +++     +++  +   ++   S+  ++F  +  +  + I Q F++SVFF++A +A+   GI+YFT Y+  V  I  +  ++  M     LLSQVAF    +++  +E+   G+Q+ N+  +P E   F     I +M++D+ +Y ++ WY++ VFPGQYG+ +P+ F     YW+ N K+ +   L +   +  E +   FE+EP+NL  G+ I NLVK++ S   P I+ L ++FYE  IT+ LGHNGAGKTTT+SILTG+F P+ GTA I  +DIRT+MDSIR  +G+CPQ+N+LF  +TV +HI F+ LLK     E E  +  +++D+ L  K + L  +LSGGM+RKLS+A+AF+G ++VV LDEPT+GVDP++RR IWDLL+KYR+  RT+I++THHMDEAD LSDRVAI+SQG+L CCGS +FLK  FG G+Y                            ++  N      S  N E+I+  V  ++  AR++E    + T +LP  +   R +  LF+ L++ + ++ + S+G+SDTSLEE+FLKV  D  N+    E +                         Q+P Q +     +  + ++G  L  +Q +AL IKR H+A R +K F+A+++LP   + F ++F  I     +   + +SPW+     G++   TF+  E  +   +    +      G  G RCM      L+++ C   N    W     +PA I  L+ P       SPEC CS         +C +  +GG P   RI ++ D L +LTG NISDYL+K + +L R     ++F    F      +   +L   S   + I+D  +Q  Q  N+       + LR +  F  +     +T N  ++W N+KG+ +M ++ N+ +N +LR+ +    N   +GI+V N+P+  ++ ++S+   L   ++  +A+ VI A+SF+ ASFV++LI ER++ +K  QFVSG++P VYW++NFLWD++ Y I   +++ IF+ FD + Y  + N  A I LL+ YG ++ P MYP S+  S PSTA+V L+  NL +G  ++                                Y LGRG+ID++ N     +TD YA++      D F W      L               +   G +  ++  +++  +F +  +     ED D++ E+ R+      +D+L++ +L+K Y  T
Sbjct:  384 MWNSVKPMLMGRILYAPDSPAVRRVIKNANTTFEELERLRTMGKAWE-EVAPQIWAFFQDGIQVEMIRDIIR-----NPSVMDFIDKSLEDAPFSSKHILNFLRNEPLEDRPYDVPNFDWRDVFKMIDRVIRMLNQYGDCVVLDKFV---ALPDEDAVTYRALNLLEDGKFWAGLIFVNMHPWTT-SVPPHIKFKIRMDIDIVERTNKVK--DRYWDPGPRADPMEDLRYVWGGFAYFQDIIEHGIIRTHTGKE-WPLGVYLQQMPYPCYVDDLFTLTLNRCFPVFMVLAWVYSVSMVVKSIVLEKELRLKETLKTMGVTNGVIWSTWFIDSFIMMGTSTALLTAIIMGGRVLNYSNPFILFLFLLTFTTATIMQCFLLSVFFNQAKLAAACCGIIYFTLYLPHVFCIAWQDRITKDMKILLSLLSQVAFGFGTEYLSRYEEQGMGLQWDNIQTSPLEGDEFSFLTSICMMVLDTVLYSVLAWYLDNVFPGQYGIGRPFYFPLLPCYWL-NKKNRKKRILKKILEKVSEQDMSFFEAEPDNLVKGVCIENLVKVFSSCVRPAIDGLTISFYEGHITSLLGHNGAGKTTTMSILTGLFPPTCGTATIYGKDIRTDMDSIRLSLGMCPQHNILF-HMTVAEHILFFSLLKGCPIAEAEEEVENMLQDLGLPHKRDELIQNLSGGMQRKLSVALAFVGGAKVVVLDEPTSGVDPYSRRSIWDLLLKYRT-GRTVIMSTHHMDEADLLSDRVAILSQGRLYCCGSPIFLKNCFGAGFYLTLVRRMKNDPPKVGRKPPVCFCAFKARAVSSNSKTAFLSTGNIESIMALVHHHVPQARLIETIGQELTFLLPNQNFQPRAYASLFRELEETLVDIGLSSFGVSDTSLEEIFLKVTADGTNRKCIPESN------------------------GQDPSQIKEGSAGRGSYRVRGVCLTVKQFLALLIKRLHHATRSYKDFVAQIVLPASFVFFSLMFNLIVPPFGEYPSLTLSPWM----YGRQ--YTFFSNERPTDAAMRYFGNVLLDKPG-FGTRCMVDE--PLEDFPC--NNITTEWEMPLVNPALIEMLESPRWDSLRPSPECQCSTAKKLTMLPVCPE-GAGGLPPPQRIQSTGDVLMDLTGRNISDYLVKTYPKLIRTREVKQVFCSVMFRY-GGISVGGQLPVLSLQPNAIQDLASQLGQLLNVTGGKYSKQTLRDIGTFLRYL----ETPNNVKVWYNNKGWHAMVSFMNVANNAILRAHLPERANLDEFGITVINHPLNLTKEQLSEITVLSTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWMANFLWDMVNYSISAAMVVQIFLFFDKKCYTSATNVQALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCINLFIGINSS-------------------------------HYCLGRGLIDMAMNQA---VTDVYARFGEDYSPDPFSWVFIGRNL-------------FCMAAEGFVYFIINILIQYRFFMDHWQPHILEEDVDVAEERKRIQQSGNTNDILRIKDLSKTYTGT 1861          

HSP 2 Score: 167.933 bits (424), Expect = 4.395e-41
Identity = 80/228 (35.09%), Postives = 132/228 (57.89%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            + I +L K Y    IP ++ + +     +    +G NGAGKTTT  +LTG    +SG A +    I T +  + Q +G CPQ++ + + LT  +H++ Y  L+ + +++I  V    I+ + L+E  +  +   SGG +RKLS A+A IG   +V LDEPT G+DP +RR +W+ ++      R ++LT+H M+E + L  R+AI+  G  +C G++  LK K+G+GY
Sbjct: 1849 LRIKDLSKTYTGTIIPAVDRICVGVLPGECFGLVGVNGAGKTTTFKMLTGDIDVTSGDASVAGHSILTNILDVHQNMGYCPQFDAIDELLTGREHLHLYARLRGVPESQISRVADWAIQKLGLSEYASRTAGTYSGGNRRKLSTAIAMIGCPALVLLDEPTTGMDPLSRRFLWNSIMSVIQDGRAVVLTSHSMEECEALCTRLAIMVNGSFKCLGTIQHLKYKYGDGY 2076          

HSP 3 Score: 55.0694 bits (131), Expect = 8.747e-7
Identity = 24/81 (29.63%), Postives = 40/81 (49.38%), Query Frame = 1
Query:   22 SNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQ 264
              Q+R LLWKN+ ++RR+     +E+  P+++   L  +R     Y+   C F  K M S G +P++    C  N  C+  
Sbjct:    4 GGQVRLLLWKNWTIRRRQRMRFFVEIMWPVMLFIGLVWLRRVNPLYRQHECHFPNKAMPSAGVLPWIQGIFCNANNPCFQH 84          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000029537.1 (SMESG000029537.1)

HSP 1 Score: 3267.63 bits (8471), Expect = 0.000e+0
Identity = 1698/1699 (99.94%), Postives = 1699/1699 (100.00%), Query Frame = 1
Query:  115 MVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF 5211
            MVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRI+PLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAVVFAVIFFYVISFICQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYLSLLKNQNNHSNSNRNGENILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAELILPVLMILFIILFLKISILPKKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASLILLFLLWWIILIIIERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF
Sbjct:    1 MVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIIPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAVVFAVIFFYVISFICQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYLSLLKNQNNHSNSNRNGENILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAELILPVLMILFIILFLKISILPKKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASLILLFLLWWIILIIIERGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF 1699          

HSP 2 Score: 188.734 bits (478), Expect = 1.348e-47
Identity = 106/304 (34.87%), Postives = 177/304 (58.22%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDR-TIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSR-KFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             +NNL     E +    LG NGAGKTTT  +LTG    + G A+I    I +++    + +G CPQ++ L   LT E+ + FY  ++ ++ N+I+SV+   ++++ LT     L+ +LSGG KRKLS A+A IGN +V+FLDEPT+G+D  ARR +W+++ K  + ++  +ILT+H+M+E + L  R++I+  G+++C GS+  LK KFG+ YY+ +  +      +N         VK  I +A + + S         Q    S+ +  +LF+  +Q  A  +I+ Y +S  +LE+VF+ +A
Sbjct: 1693 AVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITHGNAFINGHSIISDIIGAHRNMGFCPQFDALHALLTCEEQLIFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEK------VKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 1990          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000029534.1 (SMESG000029534.1)

HSP 1 Score: 1861.66 bits (4821), Expect = 0.000e+0
Identity = 1024/1793 (57.11%), Postives = 1312/1793 (73.17%), Query Frame = 1
Query:    7 MNSLISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLG--TNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNF----IKN---------QRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKA-YYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMR--NNNQNCEINHQA---FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXX-----XXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKE-KSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQS---------DHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENI-------SLG-------LINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQP----QNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSW-NYGISVTNYPIA-DSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNN-KIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCC-KNKNNDVENENQKFAVNNLCF 5211
            MNS+ + QL+ LLWKNFRLK+RK   L+ E+ VPL+++ I+  VR+S  K+KMD C FKEK M SMG +PF+ DF CTFNT+CY++TQINW    +++  F +F  N+  +Y +LP   L V   + W T +  E  +L ++   I K + PLI+++ +  +EN T  +    ++ ++ CGS ENDF  F   F     KN         Q    S +TC+  F++FF NS     ++  ++  +FGK+++ PN  + R+I+ +AN+TF+ LD +RLAS+EWRLHF+ ++ + ++N+  IN++K  CK+ Y+  +  +C+ VN + N   ++S ++ +S +FS++E+ LNCTEL++F+P++    ++    Q  ++  AV++ N+TF+YLTP N TFL+YQIRIP S+IDST  FKV D+FWT  PRR T  DFKY  SGF+ LQEAID+AFIE+VTNNE+I+VGSSM IMPYPCY+ D F++ + N++PF+LV+AW PSVT LIKSIVYEKE RLKE+M+VMGL N VHW+ WF+ST+VVLI PV IMS+ L  S I + S  AVVF V+  YV+SFICQ FM+S+FF+ AN+ASV+GG++YF  YM FVVFI+++ +LS   YY  GL +QVAF NA+ F+ YWEQ  EG  F NLF      L FGVGHC++++I+DS +YL + WYVE+VFPGQYGV K W FL  R+YW    ++ E+I L    NN++   I++ +   FE+E  +L++GISI NLVK YP  K   ++NLNLNFY+SQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIR++MD IR+K+GLCPQ+N+LF +LTVEDHIYFYGLLK M   EI  VLP IIKDV LT K+N LS  LSGGMKRKLS+A+AFIG+  +VFLDEPTAGVDPFARRGIWDLLIKYR+ +RTIILTTH MDEADYLSDR+AIISQGKLQCCGS VFLKRKFG+GY L L+KN N          + +G+ +L+F+K +I DA+M  E+  QW+ VLPQND NS KF+ LF NLD+ +  ++ +SYGLSDTSLEEVF++VADDP    IN+E K+      N+ ++ +  +    E FL+   D  Q  F+D+S           LL+GFPLL+QQII L IKR+HYAKR+ KG  AELILP+LMI  +I  LK+    +    M+ISPWLMM K    NLNTFYRKEN         LG       L ++LESEYRSDLGESGIRCMNPSIYR  +Y+CF   +NN WSP    +IP++SPECDC+ TG QICND RSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF++LSRK++GG+QF+LP+ F  SSKLI  SP W+ +RD VN SQ      NL  L+F+ Y Q+ F       +F+RIW+NSKGY SMPAYANI SNLLLRSR+  S   + +YGISV+N+PI  +  TK       ++LE++LAI+VI  LSFI ASFVIFL++ER+SGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLN YNLLVG+ITT+STFILDI+E   E  +  N+ILKKVFLIFPQ++LGRG++DL  NY   + +    +Y+A  W++A EKL SL  L + WWI+LIIIE G++NR++   LK SY    +I+ TEDFD++LE+ RM+S+QK DDVL+VINLTKIYN    F+  C  K K+N ++N+ ++ AVNNLCF
Sbjct:    1 MNSIFTKQLKVLLWKNFRLKKRKPITLISEILVPLLIIIIIVPVRNSIFKFKMDHCEFKEKSMASMGFVPFILDFFCTFNTTCYNKTQINWNENYSSIYAFKMFTKNLYNVYQTLPKEKLTVNSLITWATIHKFEIDQLISNIMPIIKLLSPLIASLKEADTENLTASKPIIIQIFKVFCGSDENDFTEFYYKFSSISTKNVSGQTNAGSQFMNESNVTCERNFENFFGNS----NIFGTISSWVFGKIYFSPNSPLTREIMRRANITFETLDYIRLASIEWRLHFRDWINEAVNNSKLINELKS-CKSWYFYFDNNLCETVNAVLNFQTIQSILNKISLMFSFLEKTLNCTELNKFVPINESITVENFIKQPIKSVFAVLVINDTFRYLTPSNATFLNYQIRIPESQIDSTKHFKVTDKFWTAEPRRETLRDFKYYTSGFLLLQEAIDRAFIEIVTNNETIDVGSSMQIMPYPCYVDDMFIRFITNMMPFMLVIAWVPSVTGLIKSIVYEKERRLKEFMRVMGLGNSVHWIGWFLSTVVVLIFPVTIMSLLLIYSSILSFSCFAVVFLVLLLYVVSFICQVFMISLFFNNANLASVAGGVIYFILYMPFVVFIRMQSDLSTGFYYLGGLSAQVAFCNAINFIGYWEQSTEGAHFGNLFDGAIIDLKFGVGHCMLMLIVDSVLYLSVAWYVESVFPGQYGVGKAWYFLFTRNYW----RAKENISLAHDINNSEPLIIDYDSEGNFENEYTDLRVGISIRNLVKTYPGAKTRAVDNLNLNFYQSQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKVKEIRQVLPIIIKDVGLTAKVNTLSKKLSGGMKRKLSLALAFIGDPSIVFLDEPTAGVDPFARRGIWDLLIKYRNDERTIILTTHQMDEADYLSDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAK--INEETKNEKLIPDNLNRIAVYGDIENQEPFLDLE-DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAELILPILMITLMIALLKLVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFRKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWVNSKGYVSMPAYANIFSNLLLRSRLNKSAVKFIDYGISVSNFPIEMEQSTKFLDLVIQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNVYNLLVGTITTISTFILDILEGNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCF 1781          

HSP 2 Score: 184.496 bits (467), Expect = 2.938e-46
Identity = 104/318 (32.70%), Postives = 172/318 (54.09%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDR-TIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQN-------------------DINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVF 3153
             +NNL     E +    LG NGAGKTTT  +LTG    + G A+I  + I ++M    + +G CPQ++ L   LT E+ + FY  ++ ++ N+I+SV+   +K++ LT     L+ +LSGG KRKLS A+A IGN +V+FLDEPT+G+D  ARR +W+++ K  + ++  +ILT+H+M+E + L  R++I+  G+++C GS+  LK KFG+ YY                       VKI++   +     RL+  + +  N                   D++  K +++F    +   +  II + +  TSL+E+F
Sbjct: 1775 AVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITHGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLKNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDNYY-----------------------VKIHLYSRKCQISHRLEVKLAIENNFRSGISIKDENFLTLLYTFDLSFIKLSDIFTFFHKMKVDGLIIDFTVYQTSLDEIF 2069          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000032861.1 (SMESG000032861.1)

HSP 1 Score: 1849.33 bits (4789), Expect = 0.000e+0
Identity = 976/1717 (56.84%), Postives = 1270/1717 (73.97%), Query Frame = 1
Query:  163 MDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELV-TNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNN----------NQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXX-----XXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-------NKLINKEK-SYYSYYCNILKMKLRINATKTEIF-----LNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIR-DSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETK-ISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNND-VENENQKFAVNNLCF 5211
            MDLC  +EK+M SMGPIPFL DFLCT NT+CY++TQI+W G N N+F  F+ N+T +Y+       N P    + T  PN+  +L  S +Y++    PL+  + ++ S N+T  + G   +   ICGS END  LF+ +F+ NQ+ KRSL +CQ  F     +S    ++Y ++APLIFGK++Y P+    R++I++AN TFKILD+LRL++VEWRLHF ++ ++Y++N+  IN+++ FCK       ++C  VNT  ++ N+ +Y   +S +F+ IE  LNCTEL++F+P+ S  DID L NQS  N  A ++ NE+FQYLT  N TFLSYQIR+P +RID+T KFKV+D FWTP PR +TF+DFKY  SGF+ LQEA+DQAFIE+V TNNESI VGSSM IMPYPCY+ DKF++ L++++PFLL++AW PSVT+L+K IVYEKE+RLKE+M+VMGL+N VHW+ WFI+TI +L++P++IM++ LR S I   SS AVVF ++  YV+SFICQ+FM+SVFF KANVA+V+GGI+YF  Y+ F VFI +  +++ +MYY  GLL+QVAFSN++ F+ +WEQ  +GVQFSNLF +   +L  GVGHC+++M +DS IYLLI WYVE+VFPGQYGV KPW FL  + YW  N  S +  P+  +N          N N  I    FESEP NLK+GISI NLVK YP  K   +++LNLNFY+SQITAFLGHNGAGKTTTISILTGIFS +SGTAYILNEDIR++MD IR+K+GLCPQ+N+LF +LTVEDHIYFYGLLK M   EI  +LP+II+DV LT+K+ + S +LSGGMKRKLS+AMAFIG+S+VVFLDEPTAGVDPFARRGIWDLLIKYR+ +RTIILTTHHMDEADYLSDR+AIISQGKLQCCGS VFLK++FG+GYYL L+KN  +      S  + +GE +L F++ +I DA+M+EE+R QWTIVLPQN+INS KF++LF ++D+ ++ ++I+SYGLSDTSLEEVFLKVADDP        +K I  E     +   N  +   R++      F     LN  P +  +        LL G  LL+QQ++ L +KR+HY KR+ KGF+AEL+LP+L+I+ +I F KIS     Q PM+ISPWLMM K    NLNTFYRKEN S  LI+KL   YRSDL E+G RCMN S+YRLD+Y C   +  N W+      IP+++  CDC+ TG Q+C++  SGGP NSYR+M S+DKLNNLTGYNISD+L+K F+   +K +GG+QFLLP+ F QS KLI   P WD +R  S + +   N + L FL YFQEFFN S    NF+RIWINSKGYAS+PAY NI SNLL+R+R +   N  NYGISV NYP+  +++  +S+ N  + +EV+LA++VI  LSFI ASFVIFLI+ERI+GSKRQQ VSG+NPYVYW+SNFLWDI+KYI+PI II++IF+AFDYQSYIGSKN  AFI LLIFYGLAIIPHMYPFSF +STPSTAFVVL+AYNLL+GSITT+STF LD+++  DET +P N++LKKVFL+FPQY LGRGM+DLS NY+ +N+++G   YD F W    EKL SL +LF+ WWI++ IIE G+INR+L   +K      K  K   ED D+++E+ R+ SE+  DDVL+VI LTK+YN++ N ++ CCK    D +ENE +K AVNNLCF
Sbjct:    1 MDLCELREKQMASMGPIPFLRDFLCTLNTTCYNKTQIDWSGNNTNDFQTFLNNMTYLYD-----VFNKP----FPTPTPNDITQLTYSLNYLNSSTYPLLVAMMQIQSGNKTESDKGMKTIEASICGSSENDMNLFVNSFVTNQKSKRSLQSCQNQFLQTLGSSSYGSQLYEVIAPLIFGKIYYTPDSPFTRELIKRANSTFKILDDLRLSAVEWRLHFSSYFVNYMNNSQPINNLRNFCKLNIPGTQQMCSTVNTTLDMENILAYNAAISAVFAIIENSLNCTELNKFVPMKSSIDIDNLANQSLTNIYAGLVINESFQYLTRNNATFLSYQIRMPTNRIDTTLKFKVIDSFWTPAPRISTFSDFKYYTSGFMLLQEALDQAFIEIVSTNNESINVGSSMQIMPYPCYVNDKFIKFLSSMMPFLLIIAWMPSVTILLKGIVYEKENRLKEFMQVMGLSNLVHWIGWFITTISILMLPIIIMTLILRYSTILGFSSPAVVFLILLSYVVSFICQSFMISVFFDKANVAAVAGGIIYFISYLPFYVFITIPDDVTDSMYYGVGLLTQVAFSNSINFIAFWEQSTDGVQFSNLFDSTVVNLNVGVGHCMVMMWVDSVIYLLIAWYVESVFPGQYGVGKPWYFLFTQHYWCQNSASYKITPI--DNYYPYESSPIPNINEGILKHGFESEPTNLKVGISIKNLVKTYPGAKTRAVDDLNLNFYQSQITAFLGHNGAGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDERTIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINSGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITAEDLDSLTDDGNFPRPSSRLSFRCKREFPRFDDLNSIPYESGAP-----SSLLTGSALLRQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVVMIAFSKISSNLNYQPPMEISPWLMMPKARSLNLNTFYRKENSSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYPC-SSSIGNQWTGNPPEPIPLLTAACDCNTTGFQLCSNSSSGGPQNSYRLMASTDKLNNLTGYNISDHLIKKFKSYIKKQYGGFQFLLPSPFGQSCKLIGSLPIWDAMRSQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLMRTRFE--SNGSNYGISVANYPLKYTQSDLLSKLNTQMFVEVSLAVFVIFGLSFIPASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLLGSITTISTFFLDLLQQDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVFIIESGIINRMLCGKIKNRNLKAKEMKDEFEDVDVAVERERIISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDTLENEKRKLAVNNLCF 1698          

HSP 2 Score: 190.274 bits (482), Expect = 4.979e-48
Identity = 110/314 (35.03%), Postives = 180/314 (57.32%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDR-TIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDI-NSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA--DDPMNKLI 3189
             +NNL     E +    LG NGAGKTTT  +LTG    + G A+I  + I ++M    + +G CPQ++ L   LT E+ + FY  ++ +  N+I+SV+ R ++++ LT     L+ +LSGG KRKLS A+A IGN +V+FLDEPT+G+D  ARR +W+++ K  + ++  +ILT+H+M+E + L  R++I+  G+++C GS+  LK KFG+ YY+++         ++         VK  I D    E S +  + V  Q    +S K   +F   +    +  I+ Y +S T+L++VF+  A  D P+  L+
Sbjct: 1692 AVNNLCFGVQEGECFGLLGVNGAGKTTTFKMLTGEEEITHGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIKSNQIKSVVDRSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVTIRMPFGKDHENDNEK------VKAIIEDKFPSEVSFVDGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILDYSVSQTTLDDVFINFARDDKPVKSLV 1999          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000068605.1 (SMESG000068605.1)

HSP 1 Score: 1842.4 bits (4771), Expect = 0.000e+0
Identity = 966/1735 (55.68%), Postives = 1273/1735 (73.37%), Query Frame = 1
Query:   97 LTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNF-IKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYW-----VYNIKSSESIPLMRNNN-QNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXI-----LKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLIN-KEKSY-------------YSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDH-LLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKI-SQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINR-VLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNND-VENENQKFAVNNLCF 5211
            + +PL ++FIL AVR   + Y M  C  +EK+M SMGPIPFL DF+CTFNTSCY+ TQI+W   ++N+F  F+ NI+ +Y+SL +    VP F+ W   NPN + +L NS +YIS  I   I+++ ++ + ++T I      LG+++CGS +ND  +F++NF +      +S+ TCQL F ++F  S     +Y ++ PL+FGK++Y PN    ++II +AN TF+ILDNLRLASVEWRL F  +L++  +N   +ND + +C    ++   +C  +N   +I  ++S I  +S +F  IE  LNCT+L++F P+ S  DID L+NQS    LA I+F + FQYLTP+N TFL+Y+IR+P SRIDST  FKVLDR WTP PR NT T+F Y  SGF+FLQE IDQAFIEL+T+N S+ +GSSM IMPYPCYL D+ +  L+NL+PFLLV+AW P+VT LIKSIVYEKE+RLKE+M+VMG++NFVHWVSWF STI++LI+P+++M++ L+L KI   SS  ++F ++FFYV+SFICQ FM+SVFF KA+VASVSGGILYF FY+ F++F+ L+  +++ MYY+  LL+QV+ SN++ F+ YWEQ  +G+QFSNLF +    L FGVGHC+++M IDS IYLLI WYVE VFPGQ+G++KPWNF   R+YW       N+  +ES     N    N  +N + FE EP +LK+GISI NL K++P +KIP +NNLNLNFY+SQITAFLGHNGAGKTTTISILTG+F+PSSGTA+ILN+DIRT MD IRQK+GLCPQ+N+LF+ LTVEDHIYFYGLLKRMDKN I++++P+II++V LT+KI++L+ +LSGGMKRKLS+A+AF+G+SRVVFLDEPTAGVDPFARRGIWDLL+KYR  DR IILTTHHMDEADYLSDR+AIISQGKLQCCGS VFLK++FG GYYL ++K ++      +N  +I     LKF++ ++ DA+MMEE+R QWTI LPQ++ N  KF +LF NLD+ M ++ I++YGLSDTSLEEVFLKVADDP  ++   KEK               +    +IL ++ +    K E       + ++  F  +  + +L G  L  QQII L IKR+HY +R+ K F+AEL+LPVLMIL II  L IS       PM ISPWLMM K    NLNTFYRKE+ S  +I+ +E+ YRSD+GESG+RCMN ++YRL NY C+  N  N WS      I + SPECDCSKTG Q C+D  SGGP  S RIMTSSD+L N+TGYNISDYLLK F+   +K +GGYQFLLP++F  SS  I  SP WDGI   +N S   N   L FL Y Q FFN+S    N++RIW+NSKG+ SMPAY NI SN+LLRS++    +   YGISVTNYP+  S+T + SQ N  + LEV+LAI+VI  LSFI ASFVIFLI+ERISG+KRQQFVSG+NPY+YW+SNF+WD++KYIIP+ I+++IF+ F+YQSYIG++NA AFI+LL+FYGLAIIPHMYPFSF +S PSTAFV+L+AYNLLVG+ITT++TF LD+++  D + +P N++LKK+FLIFPQYDLGRGM+DLS NY++YN++ G   YD F WE   +KL SLI+LF+ WW ++  IE G+INR +  R+        +++  ED D+ LE+ RM   ++  DVL+VINLTKIYN + N  + CCK    D + +E +K AVNN+CF
Sbjct:    1 MLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYCA---NSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSNQSSLGILAGIVFTDDFQYLTPQNATFLNYRIRMPASRIDSTKNFKVLDRLWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTILILILPIILMTIILKLGKILTFSSPIIIFLILFFYVVSFICQCFMISVFFDKASVASVSGGILYFVFYLPFLIFVNLQDSMTVPMYYAAALLTQVSLSNSINFIAYWEQSTDGIQFSNLFDSAIMDLNFGVGHCMVMMWIDSVIYLLIAWYVETVFPGQFGLSKPWNFPFTRNYWNSICGKSNLDETESFSNSLNEPIPNESLNERGFEHEPAHLKMGISIQNLFKIFPKSKIPAVNNLNLNFYQSQITAFLGHNGAGKTTTISILTGLFAPSSGTAFILNDDIRTNMDRIRQKMGLCPQHNILFEDLTVEDHIYFYGLLKRMDKNMIKNIIPKIIEEVGLTKKISSLTKNLSGGMKRKLSVALAFVGDSRVVFLDEPTAGVDPFARRGIWDLLVKYRCEDRAIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIALPQSENNCSKFPDLFDNLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIE-------EIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFIAELVLPVLMILMIIGLLNISSPLSDAPPMVISPWLMMPKTRLVNLNTFYRKESPSNAIIDSMENVYRSDVGESGVRCMNSAVYRLGNYSCYPENNVNQWSAIPSAPISLSSPECDCSKTGFQFCSDPLSGGPTISSRIMTSSDQLGNITGYNISDYLLKKFKTFIKKQYGGYQFLLPSNFGLSSNSIGSSPIWDGISSYINSSP-NNSNSLGFLNYSQRFFNQSGIKTNYTRIWVNSKGFVSMPAYENIFSNILLRSKLNSFSDISKYGISVTNYPLKFSQTDLQSQLNTQMFLEVSLAIFVIFGLSFIPASFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWSVIFTIESGIINRSICGRIKNYKLKERELQHEEDTDVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICF 1724          

HSP 2 Score: 172.555 bits (436), Expect = 1.072e-42
Identity = 125/422 (29.62%), Postives = 209/422 (49.53%), Query Frame = 1
Query: 1999 SFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLY-PSNKIP-------------------VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRT-IILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVK-IYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKE 3198
            S I L I W+   +F  + G+      +C R   + N K  E   L    + +  +  +      EN+ + + + NL K+Y PS  I                     +NN+     E +    LG NGAGKTTT  +LTG    + G A+I +  I  EM    + +G CPQ++ L   LT E+ +YFY  ++ +  + I+  +   +K++ L      L+  LSGG KRKLS A+A IG  ++VFLDEPT+G+D  ARR +W+++    + ++T +ILT+H+M+E + L  R++I+  G+++C G++  LK KFG+ Y++ +  N   + +         +F + + + D   +    LQ+          S K + +F   +   A   I  Y +S TSL+EVF+  A +  +   N+E
Sbjct: 1619 SLIILFIAWW-SVIFTIESGIIN--RSICGR---IKNYKLKER-ELQHEEDTDVFLERERMTKRKENVDV-LKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFIT---LQYRFNC------SLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNKSSNNENEE 2023          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000032891.1 (SMESG000032891.1)

HSP 1 Score: 1839.7 bits (4764), Expect = 0.000e+0
Identity = 974/1706 (57.09%), Postives = 1259/1706 (73.80%), Query Frame = 1
Query:  193 MVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELV-TNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNN---------NQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXX-----XXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMN--------KLINKEKSYYSYYCNILKMKLRINATKTEIF-----LNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIR-DSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETK-ISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASXXXXXXXXXXXXXXXERGVINRVLYRMLKVSYFNNKIKKT--EDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCCKNKNND-VENENQKFAVNNLCF 5211
            M SMGPIPFL DFLCT NT+CY++TQI+W G N N+F  F+ N+T +Y+       N P    + T  PN+ I+L  S +Y++    PL+  + ++ S N+T  + G   +   ICGS END  LF+++F+ NQ+ KRSL +CQ  F     +S    +MY +LAPLIFGK++Y P+    R++I++AN TFKILD+LRL++VEWRLHF ++ ++Y++N+  IN+++ FCK       ++C  +N   ++ N+ +Y   +S +F+ IE  LNCTEL++F+P+ S  DID L NQS  N  A ++ NE+FQYLT  N TFLSYQIR+P +RID+T KFKVLD +WTP PR NT TDFKY  SGF+ LQEA+DQAFIE+V TNNESI VGSSM IMPYPCY+ D F + L+ ++PFLL++AW PSVT+L+K IVYEKE+RLKE+M+VMGL+N VHW+ WFI+TI +L++P++IM++ LR  KI A SS AV+F ++  YV+SFICQ+FM+SV F KANVASV+GGI+YF  Y+ F VF+ L  +++ +MYY  GLL+QVAF N++ F+ +WEQ  +GVQFSNLF +   +L  GVGHC+++M +DS IYLLI WYVE+VFPGQYGV KPW FL  R YW  N  +S+ I L+ N+         N N  I    FESEP NLK+GISI NLVK YP  K   +++LNLNFY+SQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNED+R++MD IR+K+GLCPQ+N+LF +LTVEDHIYFYGLLK M   EI  +LP+II+DV LT+K+ + S +LSGGMKRKLSIAMAFIG+S+VVFLDEPTAGVDPFARRGIW+LLIKYR+ +RTIILTTHHMDEADYLSDR+AIISQGKLQCCGS VFLK++FG+GYYL L+KN  +      S  + +GE +L F++ +I DA+M+EE+R QWTIVL QN+IN+ KF++LF ++D+ ++ ++I+SYGLSDTSLEEVFLKVADDP          ++  ++    +   N  +   R++      F     LN  P +  +        LL G  LL QQ++ L +KR+HY KR+ KGF+AEL+LP+L+I+ +I F KIS     Q PM+ISPWLMM K    NLNTFYRKEN S  LI+KL   YRSDL E+G RCMN S+YRLD+Y C  R   N W+      IP+++  CDC KTG Q+C++  SGGP NSYR+M S+DKLNNLTGYNISD+L+K F+   +K +GGYQFLLP+ F QS KLI   P WD IR  S + +   N + L FL YFQEFFN S    NF+RIWINSKGYAS+PAY NI SNLLLR+R +   N  NYGISV NYP+  +++  +S+ N  + +EV+LA++VI  LSFI ASFVIFLI+ERI+GSKRQQ VSG+NPYVYW+SNFLWDI+KYI+PI II++IF+AFDYQSYIGSKN  AFI LLIFYGLAIIPHMYPFSF +STPSTAFVVL+AYNLLVGSITT+STF LD+++  DET +P N++LKKVFL+FPQY LGRGM+DLS NY+ +N+++G   YD F W    EKL SL +LF+ WWI+++IIE G+INR L   +K      K  K   ED D+++E+ R+ SE+  DDVL+VI LTK+YN++ N ++ CCK    D +ENE +K AVNNLCF
Sbjct:    1 MASMGPIPFLRDFLCTLNTTCYNKTQIDWSGNNTNDFQTFLNNMTYLYD-----VFNKP----FPTPTPNDIIQLTYSLNYLNSSTYPLLVAMMQIQSGNKTESDKGMKTIEASICGSSENDMNLFVKSFVNNQKSKRSLQSCQNQFIQTLGSSSYGSQMYQVLAPLIFGKIYYTPDSPFTRELIKRANSTFKILDDLRLSAVEWRLHFSSYFVNYMNNSQPINNLRNFCKLNIPGTQQMCIYLNATLDMENILAYNAAISAVFAIIENSLNCTELNKFVPMKSSIDIDNLANQSLTNIYAGLVINESFQYLTRNNATFLSYQIRMPTNRIDTTLKFKVLDSYWTPAPRINTLTDFKYYTSGFMLLQEALDQAFIEIVSTNNESITVGSSMQIMPYPCYVNDNFNKFLSGMMPFLLIIAWMPSVTILLKGIVYEKENRLKEFMQVMGLSNLVHWIGWFITTISILMLPIIIMTLILRYGKILAFSSPAVIFLILLSYVVSFICQSFMISVLFDKANVASVAGGIIYFISYLPFYVFLNLPDDVTDSMYYGVGLLTQVAFCNSINFIAFWEQSTDGVQFSNLFDSTVVNLNVGVGHCMVMMWVDSVIYLLIAWYVESVFPGQYGVGKPWYFLFTRHYWCQN-SASDKITLIDNHYSYESLPIPNINEGILKHGFESEPTNLKVGISIKNLVKTYPGAKTRAVDDLNLNFYQSQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDLRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSIAMAFIGDSKVVFLDEPTAGVDPFARRGIWNLLIKYRNDERTIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLSQNEINNGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITTEDLDSLTDDGNFPRPSSRLSFRDKREFPRFDDLNSIPYESGAP-----SSLLTGSALLCQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVIMIAFSKISSNLNYQPPMEISPWLMMPKARSLNLNTFYRKENSSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYPCSSRT-GNQWTGNPPEPIPLLTAACDCKKTGYQMCSNSSSGGPQNSYRLMASTDKLNNLTGYNISDHLIKKFKSYIKKQYGGYQFLLPSPFGQSCKLIGSLPIWDAIRSQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLLRTRFE--SNGSNYGISVANYPLKYTQSDLLSKLNTQMFIEVSLAVFVIFGLSFIPASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLVGSITTISTFFLDLLQKDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVLIIESGIINRTLCGKIKNRNLKAKEIKDEFEDVDVAVERERIISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDALENEKRKLAVNNLCF 1688          

HSP 2 Score: 188.734 bits (478), Expect = 1.441e-47
Identity = 110/314 (35.03%), Postives = 180/314 (57.32%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDR-TIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDI-NSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA--DDPMNKLI 3189
             +NNL     E +    LG NGAGKTTT  +LTG    + G A+I  + I ++M    + +G CPQ++ L   LT E+ + FY  ++ ++ N+I+SV+   ++++ LT     L+ +LSGG KRKLS A+A IGN +V+FLDEPT+G+D  ARR +W+++ K  + ++  +ILT+H+M+E + L  R++I+  G+++C GS+  LK KFG+ YY+++         ++         VK  I D    E S +  + V  Q    +S K   +F   +    +  I+ Y +S T+L++VF+  A  D P+  LI
Sbjct: 1682 AVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITRGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVTIRMPFGKDHANDNGK------VKAIIEDKFPSEVSFVDGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILDYSVSQTTLDDVFINFARDDKPVKSLI 1989          
The following BLAST results are available for this feature:
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA11.087e-4433.85ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA72.464e-4132.17ATP binding cassette subfamily A member 7 [Source:... [more]
ABCA41.263e-4729.86ATP binding cassette subfamily A member 4 [Source:... [more]
ABCA121.265e-4330.51ATP binding cassette subfamily A member 12 [Source... [more]
ABCA121.111e-4330.51ATP binding cassette subfamily A member 12 [Source... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abt-24.463e-10937.58ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-26.616e-10937.58ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-44.862e-10735.03ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
ced-75.594e-5732.03ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
ced-76.053e-5732.03ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA2.505e-12135.14gene:FBgn0031170 transcript:FBtr0306679[more]
ABCA3.187e-12135.14gene:FBgn0031170 transcript:FBtr0332489[more]
ABCA3.448e-12135.14gene:FBgn0031170 transcript:FBtr0332488[more]
CG60521.387e-10834.57gene:FBgn0036747 transcript:FBtr0075195[more]
CG428166.248e-7533.05gene:FBgn0261998 transcript:FBtr0307890[more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca1b5.068e-4732.83ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4a3.669e-4132.27ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca121.478e-4129.10ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1a1.768e-17438.17ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1a1.768e-17438.17ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA15.820e-4332.10ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA16.039e-4434.15ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA14.906e-4333.43ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA14.699e-4433.33ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA15.639e-4433.04ATP binding cassette subfamily A member 1 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abca12.730e-4533.83ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca47.616e-4530.58ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca124.939e-4630.83ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca132.440e-16228.26ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca23.000e-15835.84ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95477|ABCA1_HUMAN5.220e-4433.85Phospholipid-transporting ATPase ABCA1 OS=Homo sap... [more]
sp|P41233|ABCA1_MOUSE1.910e-4433.83Phospholipid-transporting ATPase ABCA1 OS=Mus musc... [more]
sp|Q8IZY2|ABCA7_HUMAN1.183e-4032.17Phospholipid-transporting ATPase ABCA7 OS=Homo sap... [more]
sp|O35600|ABCA4_MOUSE5.328e-4430.58Retinal-specific phospholipid-transporting ATPase ... [more]
sp|Q7TNJ2|ABCA7_RAT1.750e-4331.76ATP-binding cassette sub-family A member 7 OS=Ratt... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W5LAQ71.231e-4532.72ATP binding cassette subfamily A member 1 OS=Astya... [more]
N1PB023.587e-4535.81Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A3P9L2N44.953e-4733.59Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
A0A3P9L2H44.870e-4733.71Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
A0A0U2QQ099.282e-4933.85ATP-binding cassette transporter subfamily A membe... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016919.24.663e-4932.72pep primary_assembly:Astyanax_mexicanus-2.0:8:9912... [more]
abca4a2.555e-4033.50retinal-specific ATP-binding cassette transporter-... [more]
abca4a2.605e-4032.31retinal-specific ATP-binding cassette transporter-... [more]
abca4a3.346e-4032.12retinal-specific ATP-binding cassette transporter-... [more]
ENSAMXT00000022236.26.583e-3134.41pep primary_assembly:Astyanax_mexicanus-2.0:21:133... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002495.10.000e+036.24pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene... [more]
abca121.749e-10231.47ATP-binding cassette, sub-family A (ABC1), member ... [more]
ENSPMAT00000004117.15.642e-8837.02pep scaffold:Pmarinus_7.0:GL489716:190:6182:-1 gen... [more]
ENSPMAT00000006988.11.371e-6933.15pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-... [more]
ENSPMAT00000006855.14.768e-4731.68pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ATM15.864e-1627.16Mitochondrial inner membrane ATP-binding cassette ... [more]
YOL075C_mRNA1.803e-1526.15Putative ABC transporter [Source:SGD;Acc:S00000543... [more]
ADP11.082e-1428.29Putative ATP-dependent permease of the ABC transpo... [more]
STE63.931e-1426.01Plasma membrane ATP-binding cassette (ABC) transpo... [more]
MDL23.778e-1231.12Mitochondrial inner membrane half-type ABC transpo... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468786.668e-4936.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388795.294e-17534.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489511.714e-13137.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320701.970e-8034.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320717.039e-4633.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045391.14.187e-5034.79ATP-binding cassette sub-family A member 1-like [S... [more]
ENSORLT00000046301.13.782e-5034.91ATP-binding cassette sub-family A member 1-like [S... [more]
abca1a4.590e-4932.32ATP-binding cassette sub-family A member 1 [Source... [more]
zgc:1723024.557e-4631.60ATP-binding cassette sub-family A member 1 [Source... [more]
abca4a4.395e-4132.17retinal-specific ATP-binding cassette transporter ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029537.11.348e-4799.94SMESG000029537.1[more]
SMESG000029534.12.938e-4657.11SMESG000029534.1[more]
SMESG000032861.14.979e-4856.84SMESG000032861.1[more]
SMESG000068605.11.072e-4255.68SMESG000068605.1[more]
SMESG000032891.11.441e-4757.09SMESG000032891.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019931 ID=SMED30019931|Name=ATP-binding cassette sub-family A member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5212bp
TTTTTTATGAATTCGTTAATTTCCAATCAACTTCGTACATTATTATGGAA
AAACTTTCGACTAAAAAGGAGAAAATGGAAAATATTATTAATAGAATTAA
CGGTTCCTCTTATAATGGTTTTTATTCTATTTGCAGTAAGGTCTTCACAG
GCTAAATATAAAATGGATTTATGTTCGTTTAAAGAGAAAAGAATGGTCTC
GATGGGTCCAATTCCATTTCTAACAGATTTTTTATGCACTTTCAATACAA
GTTGTTATGATCAAACGCAAATAAATTGGTTAGGGACTAATTTGAACGAA
TTTCATGTATTTATAGGTAATATTACTGAAATTTACAACAGTTTACCAAG
TGGGGCTCTAAATGTCCCTAAATTCATGAAATGGATTACATCGAATCCAA
ATGAATTTATTCGCCTTCAGAATAGTTTTTCATACATTTCTAAACGAATA
GTTCCTTTAATTTCTACTGTTAATAAAGTCATGTCGGAAAATGAAACAAC
AATTGAAAGCGGTTATAATGAACTTGGTGAAATTATATGCGGTTCGCCTG
AAAATGATTTTAAACTATTTATGCGTAATTTTATCAAAAATCAAAGAAGA
AAAAGATCACTTTTAACTTGCCAATTAATATTTCAATCTTTCTTTCAAAA
TAGCATTGTAAAATTTGAAATGTATAATATGCTGGCTCCTTTGATTTTCG
GGAAAGTATTTTATTTTCCAAATGTGTTAATTATTCGACAAATTATTGAA
AAGGCTAACTTAACCTTTAAAATTCTTGACAATTTACGATTGGCTTCAGT
TGAATGGAGATTACATTTTCAAACCTTTTTATTGGATTATATTTCCAACA
ATGTTTTCATCAATGACGTGAAAAAGTTTTGCAAAGCATATTATTCAGCA
AATCCAAAGATATGTGACGCTGTTAACACTTTATTTAATATTACCAATGT
CAAATCATATATTGATGGTGTTTCGAAATTGTTTTCATGGATTGAGAGAG
GATTGAACTGTACCGAATTGGATAGATTTATTCCATTGGATTCATTAAAG
GACATTGATAAACTAACCAATCAATCTTTCAGAAATTTTCTGGCTGTGAT
TATTTTCAATGAAACATTTCAATATCTTACTCCTAAAAATACGACATTTT
TAAGTTATCAAATTCGCATACCACTCAGTCGAATTGATTCAACGTACAAA
TTCAAAGTTCTGGATAGATTTTGGACACCTTATCCAAGACGAAACACGTT
TACGGATTTTAAATATGTTTTAAGTGGTTTTATTTTTCTTCAAGAAGCGA
TTGATCAGGCGTTTATTGAGTTGGTAACAAATAATGAATCTATTGAAGTT
GGCTCAAGTATGCATATAATGCCGTATCCGTGTTATTTAATTGACAAATT
TCTTCAAAGATTAGCTAATTTGTTACCCTTTTTATTAGTAATGGCATGGG
GCCCCTCGGTTACTGTGTTAATTAAAAGCATTGTATATGAAAAAGAAAGC
CGACTGAAGGAATACATGAAAGTAATGGGTTTAAATAATTTCGTTCATTG
GGTTAGTTGGTTCATATCAACAATTGTTGTATTGATCATTCCTGTTGTGA
TAATGTCTGTGACTCTACGACTCAGTAAGATAACTGCCATGTCCTCTTTA
GCAGTTGTTTTTGCTGTCATATTTTTTTATGTCATTTCCTTTATATGTCA
AACATTCATGGTCAGTGTTTTCTTCAGTAAAGCCAATGTTGCAAGTGTTT
CGGGTGGAATACTTTATTTCACTTTTTATATGGTTTTTGTTGTTTTTATC
AAACTAGAAGGTGAATTGAGTTTAACCATGTACTATTCTTGTGGACTTTT
ATCTCAAGTGGCATTTAGTAATGCTGTAAAATTCATGATTTATTGGGAAC
AACTGTACGAAGGCGTACAATTTTCTAATCTTTTTCAAAATCCAGGTGAA
AGTCTTCCTTTTGGTGTAGGTCATTGTATCATTTTAATGATAATAGATAG
CTTCATATATCTGTTAATAACATGGTATGTTGAAGCAGTTTTTCCCGGCC
AGTATGGGGTTGCTAAGCCATGGAACTTTCTTTGTGCAAGGAGTTATTGG
GTATATAATATTAAAAGTTCCGAATCTATTCCTTTGATGCGTAATAACAA
TCAAAATTGTGAAATTAATCACCAAGCATTTGAATCGGAGCCTGAAAATT
TGAAATTGGGAATATCTATTCATAATTTGGTAAAGTTATACCCCAGTAAT
AAGATCCCTGTCATAAATAACTTAAATTTGAATTTTTATGAATCACAGAT
TACGGCATTTCTTGGTCATAATGGAGCCGGGAAAACAACCACTATTTCAA
TATTAACCGGGATTTTTTCTCCATCTTCCGGTACGGCTTACATATTAAAT
GAAGACATTCGAACTGAAATGGATAGCATTAGACAGAAAATAGGTTTATG
TCCTCAATATAATGTATTATTCGATAGTTTAACGGTAGAAGATCATATTT
ACTTTTACGGACTACTTAAAAGAATGGATAAAAATGAAATAGAATCTGTT
TTGCCAAGAATAATAAAAGATGTCGATTTAACTGAGAAAATTAATGCATT
ATCAATGCATCTTTCCGGTGGAATGAAACGAAAATTAAGCATTGCAATGG
CATTTATTGGGAATTCCCGAGTTGTGTTTTTGGATGAACCGACTGCTGGG
GTTGATCCATTTGCTAGACGGGGAATATGGGATTTATTGATCAAATACCG
TAGTCATGATAGAACAATAATTCTCACAACCCATCATATGGATGAAGCGG
ATTATCTCAGTGACAGGGTTGCTATTATTTCTCAAGGAAAACTTCAATGT
TGTGGGTCTTTGGTGTTTTTGAAAAGAAAATTTGGAGAAGGCTATTATCT
GAGTTTGTTAAAAAATCAGAATAATCACTCAAATAGCAATAGAAATGGTG
AAAATATCTTAAAATTCGTAAAAATCTATATAGCTGATGCTAGAATGATG
GAAGAATCAAGATTACAGTGGACAATTGTTTTGCCACAAAACGATATCAA
TAGCAGGAAATTTACTGAACTTTTTAAGAATCTTGATCAACACATGGCTG
AAATGAGTATAATTTCATATGGCTTATCTGATACTTCTCTTGAGGAGGTG
TTTTTAAAAGTCGCTGATGACCCTATGAATAAATTAATTAATAAAGAGAA
ATCCTATTATTCATATTATTGCAATATTTTAAAGATGAAGTTACGTATTA
ATGCTACGAAAACTGAGATTTTCTTAAATCAAAATCCAGATCAAAAGCAA
TCAAAGTTTCTAGATCAGTCAGATCATTTACTTAAAGGATTTCCTTTACT
TCAACAACAAATAATTGCGCTTCATATAAAGAGATACCACTATGCAAAGA
GAGATTTTAAAGGATTTCTTGCTGAGTTAATTTTACCGGTTTTGATGATT
TTATTCATTATATTATTTTTGAAAATAAGCATTTTACCAAAGAAACAAAT
TCCAATGCAGATTTCCCCATGGCTAATGATGTCCAAAATGGGTAAAGAAA
ATTTGAATACTTTCTATCGGAAAGAGAACATATCTCTTGGATTGATAAAT
AAGTTGGAAAGCGAATACCGATCCGATCTAGGAGAATCCGGGATAAGGTG
CATGAACCCATCAATCTATCGATTGGACAATTATCAGTGCTTTTATAGGA
ATGAAAACAACATGTGGTCACCCGCTTCTATTTTAGATATTCCAATGGTT
AGTCCAGAATGTGATTGCTCGAAAACTGGAAATCAGATCTGCAATGATCT
TCGCAGCGGTGGTCCACCGAATTCATACCGAATAATGACCAGTAGTGATA
AACTGAACAATTTAACCGGATATAATATATCGGATTATTTATTGAAAAAT
TTTCAAAGGTTATCGAGAAAAATTTTTGGAGGTTACCAATTTTTATTGCC
AAATGATTTTGCACAGTCATCGAAATTAATTGCTCAGTCCCCAACATGGG
ATGGAATACGTGATTCCGTAAATCAATCTCAACCACAAAACCTGGAGCCA
TTAAGGTTTTTAAAATACTTTCAAGAGTTTTTCAATAAGTCTAGCAAGAC
GATGAATTTTTCACGAATCTGGATAAATTCTAAAGGATACGCATCAATGC
CAGCGTACGCAAATATTCTGAGCAATTTGTTGTTGCGATCTAGAATAAAA
TTATCACAAAATTCTTGGAACTATGGGATTTCCGTTACAAATTACCCAAT
TGCAGATAGTGAAACAAAGATTTCTCAGTTTAATAATTTAATATTATTAG
AAGTTACTTTGGCAATTTACGTAATATTGGCGCTGTCATTTATATCAGCC
AGTTTTGTTATTTTTCTAATAGACGAACGAATTAGTGGCTCCAAGCGGCA
GCAATTCGTGTCGGGAATTAACCCCTACGTGTATTGGGTATCCAATTTCT
TGTGGGACATCATGAAATACATCATTCCCATTATTATCATCATAATAATT
TTTATTGCCTTTGATTATCAATCATATATCGGCAGTAAAAATGCTCTTGC
TTTCATTCTTCTTTTAATTTTCTACGGATTAGCTATTATTCCCCATATGT
ATCCATTTAGCTTCTTCATTTCCACACCAAGCACCGCATTTGTGGTGTTA
AATGCCTACAATTTATTAGTGGGTTCGATAACTACAATGTCCACTTTCAT
TCTAGACATAATAGAAGACACTGATGAAACGTTTAGGCCTACAAATGAAA
TCTTGAAGAAAGTATTTTTGATATTTCCTCAATACGATTTAGGTAGAGGA
ATGATAGATTTATCTTCAAATTATATAAAGTACAACATGACGGATGGGTA
TGCAAAATATGATGCATTTGATTGGGAAGTTGCTAGTGAAAAGTTGGCAT
CTCTTATCTTATTATTTTTATTATGGTGGATCATTTTGATAATAATAGAA
AGGGGCGTAATAAATCGAGTTCTTTACCGGATGTTAAAAGTATCTTATTT
TAATAATAAGATTAAAAAAACAGAAGATTTCGATATTTCTTTGGAAAAAA
ATCGAATGAATTCTGAACAAAAGTTTGATGATGTGTTGCAAGTTATCAAT
TTGACTAAAATATACAATAGGACTTTCAATTTTAGAAGTGTTTGTTGTAA
AAATAAAAATAATGATGTCGAAAATGAAAATCAAAAATTTGCTGTTAATA
ATCTGTGTTTTG
back to top

protein sequence of SMED30019931-orf-1

>SMED30019931-orf-1 ID=SMED30019931-orf-1|Name=SMED30019931-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1737bp
FFMNSLISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQ
AKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNE
FHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRI
VPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNFIKNQRR
KRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIE
KANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSA
NPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLK
DIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYK
FKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEV
GSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKES
RLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSL
AVVFAVIFFYVISFICQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFI
KLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGE
SLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYW
VYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSN
KIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILN
EDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESV
LPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAG
VDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQC
CGSLVFLKRKFGEGYYLSLLKNQNNHSNSNRNGENILKFVKIYIADARMM
EESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEV
FLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQ
SKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAELILPVLMI
LFIILFLKISILPKKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLIN
KLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMV
SPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKN
FQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEP
LRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIK
LSQNSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISA
SFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIII
FIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVL
NAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRG
MIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASLILLFLLWWIILIIIE
RGVINRVLYRMLKVSYFNNKIKKTEDFDISLEKNRMNSEQKFDDVLQVIN
LTKIYNRTFNFRSVCCKNKNNDVENENQKFAVNNLCF
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000240body wall musculature
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR026082ABCA
IPR033113PLipase_A2_His_AS
IPR003593AAA+_ATPase
IPR003439ABC_transporter-like
IPR027417P-loop_NTPase
IPR017871ABC_transporter_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0016887ATPase activity
GO:0000166nucleotide binding
GO:0005102signaling receptor binding
GO:0005215transporter activity
GO:0005515protein binding
GO:0005543phospholipid binding
GO:0005548phospholipid transporter activity
GO:0008509anion transmembrane transporter activity
GO:0015485cholesterol binding
GO:0017127cholesterol transporter activity
GO:0019905syntaxin binding
GO:0031267small GTPase binding
GO:0034185apolipoprotein binding
GO:0034186apolipoprotein A-I binding
GO:0034188apolipoprotein A-I receptor activity
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0051117ATPase binding
GO:0090554phosphatidylcholine-translocating ATPase activity
GO:0090556phosphatidylserine-translocating ATPase activity
Vocabulary: biological process
TermDefinition
GO:0002790peptide secretion
GO:0006497protein lipidation
GO:0006629lipid metabolic process
GO:0006810transport
GO:0006911phagocytosis, engulfment
GO:0007040lysosome organization
GO:0007186G-protein coupled receptor signaling pathway
GO:0007584response to nutrient
GO:0008202steroid metabolic process
GO:0008203cholesterol metabolic process
GO:0010745negative regulation of macrophage derived foam cell differentiation
GO:0010875positive regulation of cholesterol efflux
GO:0010887negative regulation of cholesterol storage
GO:0015914phospholipid transport
GO:0015917aminophospholipid transport
GO:0016197endosomal transport
GO:0030301cholesterol transport
GO:0030819positive regulation of cAMP biosynthetic process
GO:0032367intracellular cholesterol transport
GO:0032489regulation of Cdc42 protein signal transduction
GO:0033344cholesterol efflux
GO:0033700phospholipid efflux
GO:0034380high-density lipoprotein particle assembly
GO:0034616response to laminar fluid shear stress
GO:0038027apolipoprotein A-I-mediated signaling pathway
GO:0042157lipoprotein metabolic process
GO:0042158lipoprotein biosynthetic process
GO:0042493response to drug
GO:0042632cholesterol homeostasis
GO:0043691reverse cholesterol transport
GO:0045332phospholipid translocation
GO:0050702interleukin-1 beta secretion
GO:0055085transmembrane transport
GO:0055091phospholipid homeostasis
GO:0055098response to low-density lipoprotein particle
GO:0060155platelet dense granule organization
GO:0071222cellular response to lipopolysaccharide
GO:0071300cellular response to retinoic acid
GO:0071397cellular response to cholesterol
GO:0090107regulation of high-density lipoprotein particle assembly
GO:0098656anion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0009897external side of plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030139endocytic vesicle
GO:0034364high-density lipoprotein particle
GO:0043231intracellular membrane-bounded organelle
GO:0045121membrane raft
GO:0045335phagocytic vesicle
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 764..947
e-value: 7.4E-9
score: 45.4
NoneNo IPR availablePFAMPF12698ABC2_membrane_3coord: 1137..1647
e-value: 1.2E-31
score: 110.1
coord: 434..676
e-value: 7.8E-19
score: 68.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 728..977
e-value: 8.6E-63
score: 214.1
NoneNo IPR availablePANTHERPTHR19229:SF185coord: 151..1715
NoneNo IPR availableCDDcd03263ABC_subfamily_Acoord: 738..958
e-value: 8.46535E-104
score: 329.08
NoneNo IPR availableTMHMMTMhelixcoord: 1517..1539
NoneNo IPR availableTMHMMTMhelixcoord: 1138..1157
NoneNo IPR availableTMHMMTMhelixcoord: 544..566
NoneNo IPR availableTMHMMTMhelixcoord: 1480..1502
NoneNo IPR availableTMHMMTMhelixcoord: 517..539
NoneNo IPR availableTMHMMTMhelixcoord: 578..600
NoneNo IPR availableTMHMMTMhelixcoord: 1632..1654
NoneNo IPR availableTMHMMTMhelixcoord: 1435..1457
NoneNo IPR availableTMHMMTMhelixcoord: 28..46
NoneNo IPR availableTMHMMTMhelixcoord: 474..496
NoneNo IPR availableTMHMMTMhelixcoord: 1546..1568
NoneNo IPR availableTMHMMTMhelixcoord: 654..676
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 756..899
e-value: 3.4E-28
score: 98.9
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 738..970
score: 19.901
IPR026082ABC transporter APANTHERPTHR19229ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A ABCAcoord: 151..1715
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 871..885
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 738..954