WD_REPEATS_REGION domain-containing protein

Overview
NameWD_REPEATS_REGION domain-containing protein
Smed IDSMED30019926
Length (bp)4777
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD_REPEATS_REGION domain-containing protein (SMED30019926) t-SNE clustered cells

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30019926) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD_REPEATS_REGION domain-containing protein (SMED30019926) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30019926) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019926

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019926SMESG000072632.1 dd_Smed_v6_16089_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30019926SMESG000072635.1 dd_Smed_v4_28345_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019926SMESG000072632.1 dd_Smed_v4_16089_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: WDR38 (WD repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:23745])

HSP 1 Score: 60.077 bits (144), Expect = 1.366e-8
Identity = 56/211 (26.54%), Postives = 89/211 (42.18%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLW-----------QGNS-VLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDI----DSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQA---HEAAITCLCVNKDSDNNVWIATGAFDKVVKVW 723
            ++TG+EDG V  WE  +G  +  +  H G V    F     L  S S DCT+ LW           +G+   ++T+ F     +L             S G     +  D QSG ++ +      +IQ SD S  V C+         G +D  + I+D        +  +V+ QA   H A I+CLC +        +A+G++DK + +W
Sbjct:   36 LLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSRQL------------ASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVNCLAT-------GSWDSTVHIWDL-----RMVTPAVSHQALEGHSANISCLCYSASG----LLASGSWDKTIHIW 218          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: WDR38 (WD repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:23745])

HSP 1 Score: 60.077 bits (144), Expect = 1.380e-8
Identity = 56/211 (26.54%), Postives = 89/211 (42.18%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLW-----------QGNS-VLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDI----DSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQA---HEAAITCLCVNKDSDNNVWIATGAFDKVVKVW 723
            ++TG+EDG V  WE  +G  +  +  H G V    F     L  S S DCT+ LW           +G+   ++T+ F     +L             S G     +  D QSG ++ +      +IQ SD S  V C+         G +D  + I+D        +  +V+ QA   H A I+CLC +        +A+G++DK + +W
Sbjct:   36 LLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSRQL------------ASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVNCLAT-------GSWDSTVHIWDL-----RMVTPAVSHQALEGHSANISCLCYSASG----LLASGSWDKTIHIW 218          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: WDR5B (WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:17826])

HSP 1 Score: 53.1434 bits (126), Expect = 2.368e-6
Identity = 46/216 (21.30%), Postives = 94/216 (43.52%), Query Frame = 1
Query:  145 EIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQ---GNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGL-HTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN-NAGKLVHRIDGFSSSII 777
             +V+ ++D  +K W++ +G  + +++ H  +V C  F   + L++S S D T+ +W+   G  +       +P   +  +C    ++ G+  GL   ++    +   +L+D D N  +S +             +     D  L ++D  Y     LK   T   H+    C+  N       WI +G+ D +V +WN    ++V ++ G +  +I
Sbjct:   97 RLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVD-DDNPPVSFVK-----FSPNGKYILTATLDNTLKLWD--YSRGRCLK---TYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVI 301          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: KATNB1 (katanin regulatory subunit B1 [Source:HGNC Symbol;Acc:HGNC:6217])

HSP 1 Score: 50.8322 bits (120), Expect = 5.352e-6
Identity = 45/195 (23.08%), Postives = 84/195 (43.08%), Query Frame = 1
Query:  208 ISSVQAHKGWVTCFVFWKAA-KLMLSCSHDCTISLW---QGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSG-LHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN-NAGKLVHRIDGFSSSI 774
            +  + AH   V+  V  KA+ +L+ +   DC ++LW   + N ++       P   + L+  E  ++ G+ SG +  ++L+  K   +L+   +NI   D              V  G  D  + ++D    G  +       + H  A+ CL  + D     W+A+ A D  VK+W+  AGK++    G +  +
Sbjct:   13 LQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFH-------PYGEFVASGSQDTNIKLWDIRRKGCVF-----RYRGHSQAVRCLRFSPDGK---WLASAADDHTVKLWDLTAGKMMSEFPGHTGPV 192          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: KATNB1 (katanin regulatory subunit B1 [Source:HGNC Symbol;Acc:HGNC:6217])

HSP 1 Score: 52.373 bits (124), Expect = 6.816e-6
Identity = 45/195 (23.08%), Postives = 84/195 (43.08%), Query Frame = 1
Query:  208 ISSVQAHKGWVTCFVFWKAA-KLMLSCSHDCTISLW---QGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSG-LHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN-NAGKLVHRIDGFSSSI 774
            +  + AH   V+  V  KA+ +L+ +   DC ++LW   + N ++       P   + L+  E  ++ G+ SG +  ++L+  K   +L+   +NI   D              V  G  D  + ++D    G  +       + H  A+ CL  + D     W+A+ A D  VK+W+  AGK++    G +  +
Sbjct:   13 LQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFH-------PYGEFVASGSQDTNIKLWDIRRKGCVF-----RYRGHSQAVRCLRFSPDGK---WLASAADDHTVKLWDLTAGKMMSEFPGHTGPV 192          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0331597)

HSP 1 Score: 51.6026 bits (122), Expect = 4.262e-6
Identity = 45/201 (22.39%), Postives = 86/201 (42.79%), Query Frame = 1
Query:  142 HEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLS------GIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN 726
            ++IVT + D     W++ETG  ++S   H G V         K  +S + D +  LW     +    F  P ++  ++    F           +    D  +  L DI ++ +++  S      GI     +   R+   G+D     ++C  + T   + S  +  H+  ++CL V   ++N + +ATG++D  ++VWN
Sbjct:  155 NQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQCKTFVSGACDASAKLWDIREGVCKQTF--PGHESDINAVTFF------PNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDD----FNCNVWDTMKAERSGILAGHDNRVSCLGV---TENGMAVATGSWDSFLRVWN 340          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0074110)

HSP 1 Score: 51.6026 bits (122), Expect = 4.262e-6
Identity = 45/201 (22.39%), Postives = 86/201 (42.79%), Query Frame = 1
Query:  142 HEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLS------GIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN 726
            ++IVT + D     W++ETG  ++S   H G V         K  +S + D +  LW     +    F  P ++  ++    F           +    D  +  L DI ++ +++  S      GI     +   R+   G+D     ++C  + T   + S  +  H+  ++CL V   ++N + +ATG++D  ++VWN
Sbjct:  155 NQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQCKTFVSGACDASAKLWDIREGVCKQTF--PGHESDINAVTFF------PNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDD----FNCNVWDTMKAERSGILAGHDNRVSCLGV---TENGMAVATGSWDSFLRVWN 340          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0074108)

HSP 1 Score: 51.6026 bits (122), Expect = 4.262e-6
Identity = 45/201 (22.39%), Postives = 86/201 (42.79%), Query Frame = 1
Query:  142 HEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLS------GIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN 726
            ++IVT + D     W++ETG  ++S   H G V         K  +S + D +  LW     +    F  P ++  ++    F           +    D  +  L DI ++ +++  S      GI     +   R+   G+D     ++C  + T   + S  +  H+  ++CL V   ++N + +ATG++D  ++VWN
Sbjct:  155 NQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQCKTFVSGACDASAKLWDIREGVCKQTF--PGHESDINAVTFF------PNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDD----FNCNVWDTMKAERSGILAGHDNRVSCLGV---TENGMAVATGSWDSFLRVWN 340          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0074107)

HSP 1 Score: 51.6026 bits (122), Expect = 4.262e-6
Identity = 45/201 (22.39%), Postives = 86/201 (42.79%), Query Frame = 1
Query:  142 HEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLS------GIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN 726
            ++IVT + D     W++ETG  ++S   H G V         K  +S + D +  LW     +    F  P ++  ++    F           +    D  +  L DI ++ +++  S      GI     +   R+   G+D     ++C  + T   + S  +  H+  ++CL V   ++N + +ATG++D  ++VWN
Sbjct:  155 NQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQCKTFVSGACDASAKLWDIREGVCKQTF--PGHESDINAVTFF------PNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDD----FNCNVWDTMKAERSGILAGHDNRVSCLGV---TENGMAVATGSWDSFLRVWN 340          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0346794)

HSP 1 Score: 51.6026 bits (122), Expect = 4.262e-6
Identity = 45/201 (22.39%), Postives = 86/201 (42.79%), Query Frame = 1
Query:  142 HEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLS------GIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN 726
            ++IVT + D     W++ETG  ++S   H G V         K  +S + D +  LW     +    F  P ++  ++    F           +    D  +  L DI ++ +++  S      GI     +   R+   G+D     ++C  + T   + S  +  H+  ++CL V   ++N + +ATG++D  ++VWN
Sbjct:  155 NQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQCKTFVSGACDASAKLWDIREGVCKQTF--PGHESDINAVTFF------PNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDD----FNCNVWDTMKAERSGILAGHDNRVSCLGV---TENGMAVATGSWDSFLRVWN 340          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 53.1434 bits (126), Expect = 2.024e-6
Identity = 49/232 (21.12%), Postives = 83/232 (35.78%), Query Frame = 1
Query:  109 LYNKRWYNIFKHEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSG-----IVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN-NAGKLVHRIDGFSSSIIDVC 786
            +Y   + N +  ++ TG+ D   K W  ETG    + + H   + C  F   + L+ + S D T  LW                                                  D++S  ++S L+G     I  C     +R+  G FD   +++D         +    +  H   I+C+  N D      IAT + DK  KVW+   G+ +  + G +  ++DVC
Sbjct:  137 VYAIAFNNPYGDKVATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLW--------------------------------------------------DVESGEEVSTLAGHFAEIISLCFNTTGDRLVTGSFDHTAILWD-----VPSGRKVHVLSGHRGEISCVQFNWDCS---LIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVC 310          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 53.1434 bits (126), Expect = 2.309e-6
Identity = 49/232 (21.12%), Postives = 83/232 (35.78%), Query Frame = 1
Query:  109 LYNKRWYNIFKHEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSG-----IVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN-NAGKLVHRIDGFSSSIIDVC 786
            +Y   + N +  ++ TG+ D   K W  ETG    + + H   + C  F   + L+ + S D T  LW                                                  D++S  ++S L+G     I  C     +R+  G FD   +++D         +    +  H   I+C+  N D      IAT + DK  KVW+   G+ +  + G +  ++DVC
Sbjct:  137 VYAIAFNNPYGDKVATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLW--------------------------------------------------DVESGEEVSTLAGHFAEIISLCFNTTGDRLVTGSFDHTAILWD-----VPSGRKVHVLSGHRGEISCVQFNWDCS---LIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVC 310          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: nle1 (notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050522-321])

HSP 1 Score: 51.2174 bits (121), Expect = 8.329e-6
Identity = 54/250 (21.60%), Postives = 106/250 (42.40%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDK--QSGSLIDIDSNIQMSDLSGIVRCI----VALDNRVYCGGFDKKLVIYD----CLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNN-AGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGE 864
            + + ++D  ++ W+   G +   +  H   VTC V W    L+ + S D TI +W+                   D  +C  + G +  ++T  L  D   ++G+    ++ I   DL+G +  I    +   N V   G ++ +   D     L+   E  K    +  H+A +  +  + D+     IA+ +FDK +K+W+   GK ++ + G    +  V     S+ +   +  +   V+DIK+G+
Sbjct:  210 LASTSKDCTIRIWDTVLGHYDKILTGHTHSVTC-VKWGGDGLLYTSSQDRTIKVWRAK-----------------DGVQCRTLQGHAHWVNTLALSTDYVLRTGAFEPANATINPQDLTGSLEEIKEKALKRYNSVRGEGHERLVSGSDDFTMFLWNPAEDKKPVARLTGHQALVNEVLFSPDTRL---IASASFDKSIKIWDGKTGKYLNSLRGHVGPVYQVAWSADSRLLVSGSSDSTLKVWDIKTGK 438          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: nle1 (notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050522-321])

HSP 1 Score: 51.2174 bits (121), Expect = 8.329e-6
Identity = 54/250 (21.60%), Postives = 106/250 (42.40%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDK--QSGSLIDIDSNIQMSDLSGIVRCI----VALDNRVYCGGFDKKLVIYD----CLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNN-AGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGE 864
            + + ++D  ++ W+   G +   +  H   VTC V W    L+ + S D TI +W+                   D  +C  + G +  ++T  L  D   ++G+    ++ I   DL+G +  I    +   N V   G ++ +   D     L+   E  K    +  H+A +  +  + D+     IA+ +FDK +K+W+   GK ++ + G    +  V     S+ +   +  +   V+DIK+G+
Sbjct:  210 LASTSKDCTIRIWDTVLGHYDKILTGHTHSVTC-VKWGGDGLLYTSSQDRTIKVWRAK-----------------DGVQCRTLQGHAHWVNTLALSTDYVLRTGAFEPANATINPQDLTGSLEEIKEKALKRYNSVRGEGHERLVSGSDDFTMFLWNPAEDKKPVARLTGHQALVNEVLFSPDTRL---IASASFDKSIKIWDGKTGKYLNSLRGHVGPVYQVAWSADSRLLVSGSSDSTLKVWDIKTGK 438          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: nle1 (notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050522-321])

HSP 1 Score: 51.2174 bits (121), Expect = 8.329e-6
Identity = 54/250 (21.60%), Postives = 106/250 (42.40%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDK--QSGSLIDIDSNIQMSDLSGIVRCI----VALDNRVYCGGFDKKLVIYD----CLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNN-AGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGE 864
            + + ++D  ++ W+   G +   +  H   VTC V W    L+ + S D TI +W+                   D  +C  + G +  ++T  L  D   ++G+    ++ I   DL+G +  I    +   N V   G ++ +   D     L+   E  K    +  H+A +  +  + D+     IA+ +FDK +K+W+   GK ++ + G    +  V     S+ +   +  +   V+DIK+G+
Sbjct:  210 LASTSKDCTIRIWDTVLGHYDKILTGHTHSVTC-VKWGGDGLLYTSSQDRTIKVWRAK-----------------DGVQCRTLQGHAHWVNTLALSTDYVLRTGAFEPANATINPQDLTGSLEEIKEKALKRYNSVRGEGHERLVSGSDDFTMFLWNPAEDKKPVARLTGHQALVNEVLFSPDTRL---IASASFDKSIKIWDGKTGKYLNSLRGHVGPVYQVAWSADSRLLVSGSSDSTLKVWDIKTGK 438          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: pafah1b1 (platelet activating factor acetylhydrolase 1b regulatory subunit 1 [Source:NCBI gene;Acc:403097])

HSP 1 Score: 54.6842 bits (130), Expect = 9.722e-7
Identity = 60/215 (27.91%), Postives = 97/215 (45.12%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCE-----CFLMCGTSSGLHTYNLDKDKQ---SGSLIDIDSNIQMSDLSGIVRCIVAL---DNRV-----YCGGF-------DKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVW 723
            IV+ + D  +K WE++TG  + +   H+ WV      +   L+ SCS+D T+ +W   +     E  E  ++  ++C        +     ++G  T    K      SGS    D  I+M D+S I  C++ L   DN V     + GG        DK + I+D  Y     +K   T+ AHE  +T L  +K +    ++ TG+ D+ VKVW
Sbjct:  207 IVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELRE--HEHVVECISWAPESSYSTISDATGSETKKSGKPGPFLLSGSR---DKTIKMWDIS-IGMCLMTLVGHDNWVRGVQFHPGGKFILSCADDKTIRIWD--YKNKRCMK---TLNAHEHFVTSLDFHKTAP---YVVTGSVDQTVKVW 407          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: pafah1b1 (platelet activating factor acetylhydrolase 1b regulatory subunit 1 [Source:NCBI gene;Acc:403097])

HSP 1 Score: 54.299 bits (129), Expect = 1.264e-6
Identity = 60/215 (27.91%), Postives = 97/215 (45.12%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCE-----CFLMCGTSSGLHTYNLDKDKQ---SGSLIDIDSNIQMSDLSGIVRCIVAL---DNRV-----YCGGF-------DKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVW 723
            IV+ + D  +K WE++TG  + +   H+ WV      +   L+ SCS+D T+ +W   +     E  E  ++  ++C        +     ++G  T    K      SGS    D  I+M D+S I  C++ L   DN V     + GG        DK + I+D  Y     +K   T+ AHE  +T L  +K +    ++ TG+ D+ VKVW
Sbjct:  211 IVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELRE--HEHVVECISWAPESSYSTISDATGSETKKSGKPGPFLLSGSR---DKTIKMWDIS-IGMCLMTLVGHDNWVRGVQFHPGGKFILSCADDKTIRIWD--YKNKRCMK---TLNAHEHFVTSLDFHKTAP---YVVTGSVDQTVKVW 411          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Katnb1 (katanin p80 (WD40-containing) subunit B 1 [Source:MGI Symbol;Acc:MGI:1921437])

HSP 1 Score: 52.7582 bits (125), Expect = 3.790e-6
Identity = 45/195 (23.08%), Postives = 84/195 (43.08%), Query Frame = 1
Query:  208 ISSVQAHKGWVTCFVFWKAA-KLMLSCSHDCTISLW---QGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSG-LHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN-NAGKLVHRIDGFSSSI 774
            +  + AH   V+  V  KA+ +L+ +   DC ++LW   + N ++       P   + L+  E  ++ G+ SG +  ++L+  K   +L+   +NI   D              V  G  D  + ++D    G  +       + H  A+ CL  + D     W+A+ A D  VK+W+  AGK++    G +  +
Sbjct:   13 LQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFH-------PYGEFVASGSQDTNIKLWDIRRKGCVF-----RYRGHSQAVRCLRFSPDGK---WLASAADDHTVKLWDLTAGKMMSEFPGHTGPV 192          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5JTN6|WDR38_HUMAN (WD repeat-containing protein 38 OS=Homo sapiens OX=9606 GN=WDR38 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 6.629e-8
Identity = 56/211 (26.54%), Postives = 89/211 (42.18%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLW-----------QGNS-VLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDI----DSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQA---HEAAITCLCVNKDSDNNVWIATGAFDKVVKVW 723
            ++TG+EDG V  WE  +G  +  +  H G V    F     L  S S DCT+ LW           +G+   ++T+ F     +L             S G     +  D QSG ++ +      +IQ SD S  V C+         G +D  + I+D        +  +V+ QA   H A I+CLC +        +A+G++DK + +W
Sbjct:   36 LLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSRQL------------ASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVNCLAT-------GSWDSTVHIWDL-----RMVTPAVSHQALEGHSANISCLCYSASG----LLASGSWDKTIHIW 218          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|B5X3C4|LIS1B_SALSA (Lissencephaly-1 homolog B OS=Salmo salar OX=8030 GN=pafah1b1-2 PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 4.832e-7
Identity = 61/214 (28.50%), Postives = 99/214 (46.26%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKL-CL----DCCECFLMCGTSSGLHTYNLDKDKQSGSLI---DIDSNIQMSDLS-GI-VRCIVALDN-----RVYCGGF-------DKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVW 723
            IV+ + D  +K WE+ TG  + +   H+ WV      +   L+ SCS+D T+ +W   S     E  E  + + C+    D     ++  TSS        K+ +SG  +     D  I+M D+S G+ +  +V  DN      V+ GG        DK L I+D  Y     +K   T+ AHE  +T L +++ +    ++ TG+ D+ VKVW
Sbjct:  207 IVSASRDKTIKMWEVATGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVATSKECKAELREHEHVVECIAWAPDTAHPTILEATSS-----ESKKNGKSGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLVHPGGRFIVSCADDKTLRIWD--YKNKRCMK---TLCAHEHFVTSLDMHQTAP---YVVTGSVDQTVKVW 407          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q75BY3|PRP46_ASHGO (Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=PRP46 PE=3 SV=2)

HSP 1 Score: 54.299 bits (129), Expect = 6.150e-6
Identity = 56/272 (20.59%), Postives = 107/272 (39.34%), Query Frame = 1
Query:  604 KASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNNA-GKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGEDVSRFSNNFQIIQSERFKIQLIKHFPEVGMVIATTNRRQILSWRSQISSAVTKLTCGV-PIDSICISTKEPLLIYCGIENGQLIQWEKRESNEASFQHEIIKLSRSMKIMVESKLQSRQF---QTEQSYSKN-----RAQQKLDAKR----NKTNKRFIKMIYCDQKDILIAAAEDGIIYVFGY 1377
            K +  I  H   + C+CV  D  +N W ATG+ D  ++VW+ A GKL   + G   ++ D+C   R   ++ ++   L   +D++    V  F      + S       +   P + ++++      +  W  +  S V  L     PI+ +     +P ++ C              S +A+ +   +   + MK +   K   R      TE S++       R+ + +D +     N      +  + C+Q  +L A  + G +  F Y
Sbjct:  104 KLTRVINGHTGWVRCVCV--DPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHS-------VDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDPQIVSC--------------STDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFSFASACTDDIRSWKLVDGQLLTNFNSEALGIVNTLACNQDGVLFAGGDTGELSFFDY 352          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5RE95|WDR5B_PONAB (WD repeat-containing protein 5B OS=Pongo abelii OX=9601 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 8.955e-6
Identity = 46/216 (21.30%), Postives = 94/216 (43.52%), Query Frame = 1
Query:  145 EIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQ---GNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGL-HTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN-NAGKLVHRIDGFSSSII 777
             +V+ ++D  +K W++ +G  + +++ H  +V C  F   + L++S S D T+ +W+   G  +       +P   +  +C    ++ G+  GL   ++    +   +L+D D N  +S +             +     D  L ++D  Y     LK   T   H+    C+  N       WI +G+ D +V +WN    ++V ++ G +  +I
Sbjct:   97 RLVSASDDKTLKLWDMRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVD-DDNPPVSFVK-----FSPNGKYILTATLDNTLKLWD--YSRGRCLK---TYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVI 301          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: R7T7I8 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_187404 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 5.630e-129
Identity = 205/574 (35.71%), Postives = 325/574 (56.62%), Query Frame = 1
Query:  127 YNIFKHEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLW-QGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASV-TIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNNAGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGEDVSRFSNNFQIIQSERFKIQLIKHFPEVGMVIATTNRRQILSWRSQISSAVTKLTCGVPIDSICISTKEPLLIYCGIENGQLIQWEKRESNEASFQHEIIKLSRSMKIMVESKLQSRQFQTEQSYSKNR----------AQQKLD------------AKRNKTNKRFIKMIYCDQKDILIAAAEDGIIYVFGYD---IAALNAFLEEARAKTASHK------KGEKVLHPLMVDNTISPVTMRITGLACQQVLLEHKSVVSGITIVPCCHGRHEMFMLSCSWDQRICLWSLETFELVTKFQN-NHTGDKEARELAADDVITCIEYC 1746
            YN+ + EI+ G EDG++K WE +TG  I+    HKGW+T F+FW   KLMLS + D  I +W  G   +  I   +P Y + ++     L+CG S G+  +NLD +K+SG  I+ +     ++ + IVRCIV  ++RVY  G+D KL+IYD  Y G E +   V    AH+A I+CL + KD++NN W+ TG+FDKVVK+W+  GK+VH+++GF S+I  +C V R+K IW + G++   +YD KSG++VS F   FQ  +  ++ +Q++K+FPE+  V+ +T+RR ++ W+   S  VT L C   ++S+  + K P+LI+ G  +G + +WE+ +SN   +  E   LS + K   + K++S + + E+   KN+          A +KL             +  N  N   +  ++ ++ D ++AA ED  IYV+G+D   + AL         K    K      +  K+LH + +    S VT R+ G  C+  L EH S V+ + ++   HG    ++L+  WD+RICLW+LE   L  +F+N + T + E  ELAAD +IT + YC
Sbjct:   22 YNLLRREILIGCEDGVIKCWEADTGKLITCHYDHKGWITDFLFWSDMKLMLSSAIDGFIMMWGSGGGCVDKIMLGQPVYCMAINPRRQQLICGVSKGILVFNLDIEKESGHYINTEVKFHATEHTDIVRCIVCHESRVYSAGYDHKLIIYDSSYTGDETMVPIVKNNNAHDAGISCLLLVKDNENNTWVVTGSFDKVVKIWSTDGKMVHKLEGFQSTISGICYVPRNKTIWAAGGTSYAYLYDPKSGDNVSDFIGTFQNHEENKYTLQMLKYFPELNQVVGSTSRRHLIVWKYNPSGCVTALKCRSSLESLAYTKKVPILIFSGDHDGIITKWERMQSNHYMYSKEHFLLSEARKAK-KKKMESLKLE-EEGDKKNKDVMKRPTSQYAHKKLSIPPVTQQEKNKLSAFNHPNTTIVSTLFIEELDYIVAACEDSTIYVWGFDEDAVKALKTMDPPDDDKQLITKYAILLGQESKLLHQIHITEEES-VTNRVAGFVCKHSLSEHTSCVTAMAVIGRAHGFDGTYLLTTGWDRRICLWNLEKGTLHDRFRNPSLTSNMEHVELAADGIITDLTYC 592          

HSP 2 Score: 119.783 bits (299), Expect = 5.630e-129
Identity = 57/152 (37.50%), Postives = 92/152 (60.53%), Query Frame = 2
Query: 1814 DQFAYASADFLFHIRKFSLIGTQMVLIKRIDFYENEVTNLSWIGTLNSWITTSEDHMIKIWNCSEDFSCSQSINAGAPVTCMCFDYSSHILIAAVGKEIKLFDVLEERMVQVNCGHSDDIRSLAILPAKNQFVSSGEDGQLLIWNNWCRPKK 2269
            ++FAY+S+D + +IRKF+L G +M+L+  +  +  EV  + W      W+T SED  I+IW+      C Q ++A   VT +C D  +  ++  V + I++FD  + R+VQ N GH+D +RS+  +P +NQ+VSS  D  + IWN W  P+K
Sbjct:  596 NEFAYSSSDKMVYIRKFALEGVEMILLNTLQGHFGEVRCVKWNHLKEKWVTGSEDGTIRIWSGQGMNECEQILSAQGSVTALCIDGLNGAIVVGVQEFIRVFDPEQYRLVQTNRGHTDALRSIIHIPERNQYVSSSWDKTIRIWNAWKPPRK 747          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A1I8ISW5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.703e-126
Identity = 190/556 (34.17%), Postives = 317/556 (57.01%), Query Frame = 1
Query:  127 YNIFKHEIVTGAEDGLVKFWELETGAFISSVQ-AHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNNAGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGEDVSRFSNNF------QIIQSERFKIQLIKHFPEVGMVIATTNRRQILSWRSQISSAVTKLTCGVPIDSICISTKEPLLIYCGIENGQLIQWEKRESNEASFQHEIIKLSRSMKIMVESKLQSRQF-QTEQSYSKNRAQQKLDAKRNKTNKR----------FIKMIYCDQKDILIAAAEDGIIYVFGYDIAALNAFL----EEARAKTASHKKGEKVLHPLMVDNTISPVTMRITGLACQQVLLEHKSVVSGITIVPCCHGRHEMFMLSCSWDQRICLWSLETFELVTKFQNNHTGDKEARELAADDVI 1728
            +N  + E+V G EDG +K WE +   F+  +   H+GWVT  V+W   K  ++   D  I  W GNS++  +  +E  Y + ++  +  L+CGTS+G++ Y LDK K     +D    I+ ++ + IV+C+   D+RV+ GGFD++L+IY+  Y+G   +      +AHEA +  L V +D+++N W+ T AFDK VKVW   GKLVHR+D F+S +  +C + R+K IWV+ G +   +Y+ KSGE+VS F + F      ++  + ++ +QL+ +  +  +V  +TNRR ++ W+   S  VT      PID +  + K P+LI+   + G +++WE++++N  +F  E ++ S SM+ M++ K+  R+  Q ++S  +   +QK + KR K + +          F K+ + ++ D+L+AA ED  +YV G+D  A    +    EEA  K +S+     +     +D+    VT R+ G  C+ VL+EH  VV+   I+P       +++++  WDQRIC+W+LET +LV  F+N  +   E RELAADD I
Sbjct:   22 FNPARREVVLGFEDGTLKVWEADPCKFVQHLSPGHQGWVTSIVYWPEIKTFITAGQDGVIMFWSGNSLVDIVHTEEAIYSMAVNIRKSQLVCGTSTGINLYELDKYKLRRHYVDPHDFIKATEHTDIVKCLAYFDSRVFSGGFDQRLIIYESGYHGVREMTPISVRRAHEAGLNNLIVAQDAEHNSWLITSAFDKCVKVWTTDGKLVHRLDDFASPVTGICFIARNKTIWVAAGYHFAFIYEPKSGENVSEFCDTFLAKEDNEVGAARKYTLQLLAYSADQHLVFGSTNRRNLVVWKYSQSGCVTTFFTETPIDCLTYTNKAPILIFSTDQQGDIVKWERKQTNAFAFSKESLRASESMEKMLQKKIARRRMAQLKKSPQQLLQEQKREGKRAKKDGQEKKKNVHSMGFRKLEFVEELDVLVAACEDSNVYVIGFDEKAFGVLVSMAPEEASYKDSSNSDAASIESTSEMDDQ---VTKRVAGYKCRHVLVEHNGVVTCFAIIPKRDENSCLYLVTSGWDQRICIWNLETGDLVDVFRNVDSKLWEERELAADDAI 574          

HSP 2 Score: 114.39 bits (285), Expect = 1.703e-126
Identity = 56/147 (38.10%), Postives = 87/147 (59.18%), Query Frame = 2
Query: 1814 DQFAYASADFLFHIRKFSLIGTQMVLIKRIDFYENEVTNLSWIGTLNSWITTSEDHMIKIWNCSEDFSCSQSINAGAPVTCMCFDYSSHILIAAVGKEIKLFDVLEERMVQVNCGHSDDIRSLAILPAKNQFVSSGEDGQLLIWNNW 2254
            ++ A +SAD L +IR+FS +G+Q+VL+  +  +  +V  + W    N W+T SED  IK+W+      C  S+NAG PV C+C D  S+ L+ AV   +K+F+     +VQ N GH D IRS+  +P    +V++  DG++ IW  W
Sbjct:  584 NELALSSADNLVYIRRFSPVGSQLVLLGTLQGHTADVNCVKWWAKKNCWVTASEDRSIKLWDSGGVNDCILSLNAGGPVQCVCIDSVSNALVVAVENSLKVFEPDNFDLVQQNDGHFDSIRSIIHIPDNRHYVTASWDGRIGIWQAW 730          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A267DN01 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018091g2 PE=4 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 1.901e-126
Identity = 191/556 (34.35%), Postives = 317/556 (57.01%), Query Frame = 1
Query:  127 YNIFKHEIVTGAEDGLVKFWELETGAFISSVQ-AHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNNAGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGEDVSRFSNNF------QIIQSERFKIQLIKHFPEVGMVIATTNRRQILSWRSQISSAVTKLTCGVPIDSICISTKEPLLIYCGIENGQLIQWEKRESNEASFQHEIIKLSRSMKIMVESKLQSRQF-QTEQSYSKNRAQQKLDAKRNKTNKR----------FIKMIYCDQKDILIAAAEDGIIYVFGYDIAALNAFL----EEARAKTASHKKGEKVLHPLMVDNTISPVTMRITGLACQQVLLEHKSVVSGITIVPCCHGRHEMFMLSCSWDQRICLWSLETFELVTKFQNNHTGDKEARELAADDVI 1728
            +N  + E+V G EDG +K WE +   F+  +   H+GWVT  V+W   K  ++   D  I  W GNS++  +  +E  Y + ++  +  L+CGTS+G++ Y LDK K     ID    I+ ++ + IV+C+   D+RV+ GGFD++L+IY+  Y+G   +      +AHEA +  L V +D+++N W+ T AFDK VKVW   GKLVHR+D F+S +  +C + R+K IWV+ G +   +Y+ KSGE+VS F + F      ++  + ++ +QL+ +  +  +V  +TNRR ++ W+   S  VT      PID +  + K P+LI+   + G +++WE++++N  +F  E ++ S SM+ M++ K+  R+  Q ++S  +   +QK + KR K + +          F K+ + ++ D+L+AA ED  +YV G+D  A    +    EEA  K +S+     +     +D+    VT R+ G  C+ VL+EH  VV+   I+P       +++++  WDQRIC+W+LET +LV  F+N  +   E RELAADD I
Sbjct:   40 FNPARREVVLGFEDGTLKVWEADPCKFVQHLSPGHQGWVTSIVYWPEIKTFITAGQDGVIMFWSGNSLVDIVHTEEAIYSMAVNIRKSQLVCGTSTGINLYELDKYKLRRHYIDPHDFIKATEHTDIVKCLAYFDSRVFSGGFDQRLIIYESGYHGVREMTPISVRRAHEAGLNNLIVAQDAEHNSWLITSAFDKCVKVWTTDGKLVHRLDDFASPVTGICFIARNKTIWVAAGYHFAFIYEPKSGENVSEFCDTFLAKEDDEVETARKYTLQLLAYSADQHLVFGSTNRRNLVVWKYSQSGCVTTFFTETPIDCLTYTNKAPILIFSTDQQGDIVKWERKQTNAFAFSKESLRASESMEKMLQKKIARRRMAQLKKSPQQLLQEQKREGKRAKKDGQEKKKNVHSMGFRKLEFVEELDVLVAACEDSNVYVIGFDEKAFGVLVSMAPEEASYKDSSNSDAASIESTSEMDDQ---VTKRVAGYKCRHVLVEHNGVVTCFAIIPKRDENSCLYLVTSGWDQRICIWNLETGDLVDVFRNVDSKLWEERELAADDAI 592          

HSP 2 Score: 114.39 bits (285), Expect = 1.901e-126
Identity = 56/147 (38.10%), Postives = 87/147 (59.18%), Query Frame = 2
Query: 1814 DQFAYASADFLFHIRKFSLIGTQMVLIKRIDFYENEVTNLSWIGTLNSWITTSEDHMIKIWNCSEDFSCSQSINAGAPVTCMCFDYSSHILIAAVGKEIKLFDVLEERMVQVNCGHSDDIRSLAILPAKNQFVSSGEDGQLLIWNNW 2254
            ++ A +SAD L +IR+FS +G+Q+VL+  +  +  +V  + W    N W+T SED  IK+W+      C  S+NAG PV C+C D  S+ L+ AV   +K+F+     +VQ N GH D IRS+  +P    +V++  DG++ IW  W
Sbjct:  602 NELALSSADNLVYIRRFSPVGSQLVLLGTLQGHTADVNCVKWWAKKNCWVTASEDRSIKLWDSGGVNDCILSLNAGGPVQCVCIDSVSNALVVAVENSLKVFEPDNFDLVQKNDGHFDSIRSIIHIPDNRHYVTASWDGRIGIWQAW 748          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A267F3H6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018091g1 PE=4 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 2.857e-126
Identity = 190/556 (34.17%), Postives = 317/556 (57.01%), Query Frame = 1
Query:  127 YNIFKHEIVTGAEDGLVKFWELETGAFISSVQ-AHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNNAGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGEDVSRFSNNF------QIIQSERFKIQLIKHFPEVGMVIATTNRRQILSWRSQISSAVTKLTCGVPIDSICISTKEPLLIYCGIENGQLIQWEKRESNEASFQHEIIKLSRSMKIMVESKLQSRQF-QTEQSYSKNRAQQKLDAKRNKTNKR----------FIKMIYCDQKDILIAAAEDGIIYVFGYDIAALNAFL----EEARAKTASHKKGEKVLHPLMVDNTISPVTMRITGLACQQVLLEHKSVVSGITIVPCCHGRHEMFMLSCSWDQRICLWSLETFELVTKFQNNHTGDKEARELAADDVI 1728
            +N  + E+V G EDG +K WE +   F+  +   H+GWVT  V+W   K  ++   D  I  W GNS++  +  +E  Y + ++  +  L+CGTS+G++ Y LDK K     +D    I+ ++ + IV+C+   D+RV+ GGFD++L+IY+  Y+G   +      +AHEA +  L V +D+++N W+ T AFDK VKVW   GKLVHR+D F+S +  +C + R+K IWV+ G +   +Y+ KSGE+VS F + F      ++  + ++ +QL+ +  +  +V  +TNRR ++ W+   S  VT      PID +  + K P+LI+   + G +++WE++++N  +F  E ++ S SM+ M++ K+  R+  Q ++S  +   +QK + KR K + +          F K+ + ++ D+L+AA ED  +YV G+D  A    +    EEA  K +S+     +     +D+    VT R+ G  C+ VL+EH  VV+   I+P       +++++  WDQRIC+W+LET +LV  F+N  +   E RELAADD I
Sbjct:   39 FNPARREVVLGFEDGTLKVWEADPCKFVQHLSPGHQGWVTSIVYWPEIKTFITAGQDGVIMFWSGNSLVDIVHTEEAIYSMAVNIRKSQLVCGTSTGINLYELDKYKLRRHYVDPHDFIKATEHTDIVKCLAYFDSRVFSGGFDQRLIIYESGYHGVREMTPISVRRAHEAGLNNLIVAQDAEHNSWLITSAFDKCVKVWTTDGKLVHRLDDFASPVTGICFIARNKTIWVAAGYHFAFIYEPKSGENVSEFCDTFLAKEDNEVGAARKYTLQLLAYSADQHLVFGSTNRRNLVVWKYSQSGCVTTFFTETPIDCLTYTNKAPILIFSTDQQGDIVKWERKQTNAFAFSKESLRASESMEKMLQKKIARRRMAQLKKSPQQLLQEQKREGKRAKKDGQEKKKNVHSMGFRKLEFVEELDVLVAACEDSNVYVIGFDEKAFGVLVSMAPEEASYKDSSNSDAASIESTSEMDDQ---VTKRVAGYKCRHVLVEHNGVVTCFAIIPKRDENSCLYLVTSGWDQRICIWNLETGDLVDVFRNVDSKLWEERELAADDAI 591          

HSP 2 Score: 114.39 bits (285), Expect = 2.857e-126
Identity = 56/147 (38.10%), Postives = 87/147 (59.18%), Query Frame = 2
Query: 1814 DQFAYASADFLFHIRKFSLIGTQMVLIKRIDFYENEVTNLSWIGTLNSWITTSEDHMIKIWNCSEDFSCSQSINAGAPVTCMCFDYSSHILIAAVGKEIKLFDVLEERMVQVNCGHSDDIRSLAILPAKNQFVSSGEDGQLLIWNNW 2254
            ++ A +SAD L +IR+FS +G+Q+VL+  +  +  +V  + W    N W+T SED  IK+W+      C  S+NAG PV C+C D  S+ L+ AV   +K+F+     +VQ N GH D IRS+  +P    +V++  DG++ IW  W
Sbjct:  601 NELALSSADNLVYIRRFSPVGSQLVLLGTLQGHTADVNCVKWWAKKNCWVTASEDRSIKLWDSGGVNDCILSLNAGGPVQCVCIDSVSNALVVAVENSLKVFEPDNFDLVQQNDGHFDSIRSIIHIPDNRHYVTASWDGRIGIWQAW 747          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: K1R128 (Vegetative incompatibility protein HET-E-1 OS=Crassostrea gigas OX=29159 GN=CGI_10025443 PE=4 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 4.125e-125
Identity = 199/599 (33.22%), Postives = 324/599 (54.09%), Query Frame = 1
Query:  127 YNIFKHEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQ-GNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKA-SVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNNAGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGEDVSRFSNNFQIIQSERFKIQLIKHFPEVGMVIATTNRRQILSWRSQISSAVTKLTCGVPIDSICISTKEPLLIYCGIENGQLIQWEKRESNEASFQHEIIKL------------SRSMKIMVESKLQ---SRQFQTEQSYSKNRAQQKLDAKR----------------NKTNKRFIKMIYCDQKDILIAAAEDGIIYVFGYDIAALNAF-------LEEARAKTASHKKGEKVLHPLMVDNTI-------------------SPVTMRITGLACQQVLLEHKSVVSGITIVPCCHGRHEMFMLSCSWDQRICLWSLETFELVTKFQNNHTGDK-EARELAADDVITCIEY 1743
            YN  + EI+ G EDG++KFWE E G  + +   HKGWVT F+FW + KLMLS ++D  I  W  G +V   I    P Y + ++     L+CG +  +  Y+LD+DK+SG +I+ +      + + IVRCI+  ++R+Y  G+D+K+VIYD  Y     L       +AH+A I C+ + KD +NN W+ TG+FDK VK+W+  GK  H++D F ++I  +C V R+K +WV+ G++   ++D KSG++VS F   FQ  + E++++Q++K+ PE+  VIA+T+RR ++ W+   S  +T L C   ++S+C + K P+LI+ G   G +I+WE+ +SN   +  E+ +L            S++ ++++E +L    S+ +   QS     A+QK++  R                N  N   +K+++ ++ D +IAA+ED  IYV+ +D  A+ A        +E+  AK +     +  L P    NT+                     VT R+ G  C+ V  EH S V+ + ++   HG    ++LS  WD+RIC+W LE   L   F+N   G   E+ E A D VI  ++Y
Sbjct:   22 YNPARREILIGCEDGVIKFWEAEAGKLVMTAYEHKGWVTDFLFWASPKLMLSAANDGNIIAWSTGGTVCDKIPIGMPVYCMAINYRREQLVCGVNGSVRVYDLDEDKESGHVINTEVLYVAREHTDIVRCILCHESRIYSAGYDQKIVIYDSSYTRDNSLAPLHQHPKAHDAGICCMRLEKDHENNQWLMTGSFDKTVKIWSIDGKFTHKLDNFLATISGICYVPRNKTVWVAGGTSYASLFDPKSGDNVSDFIGTFQQQEEEKYQLQILKYIPELNEVIASTSRRHLVVWKYNPSGCITALKCSSNLESLCYTKKVPILIFSGDNEGVIIKWERMQSNHFMYSKELYQLSDNKLKKQKKVGSKARELLLEQQLNQSPSKLYHDTQSSKVEAAKQKINNVRSHYAYNKPLIPPPSVHNHPNTTILKIVFVERFDYIIAASEDSNIYVWAFDSDAVKALKDMKPMDMEKLVAKYSILLDPDSELLPQNRPNTLEVETADEEEEEISSVKSESDSVTNRVAGFVCKFVFAEHMSCVTSMVVIGKEHGMDTTYLLSGGWDKRICIWDLEKGTLEGTFRNTAPGASYESLEFACDGVILDMDY 620          

HSP 2 Score: 124.79 bits (312), Expect = 4.125e-125
Identity = 61/152 (40.13%), Postives = 91/152 (59.87%), Query Frame = 2
Query: 1817 QFAYASADFLFHIRKFSLIGTQMVLIKRIDFYENEVTNLSW-IGTLNSWITTSEDHMIKIWNCSEDFSCSQSINAGAPVTCMCFDYSSHILIAAVGKEIKLFDVLEERMVQVNCGHSDDIRSLAILPAKNQFVSSGEDGQLLIWNNWCRPKK 2269
            +FAYAS+D + +IRKFS  G +M L+  +  +E EVT + W I    SW+T SED  I+IW+ S    C Q + A   V CMC D  +  ++A +   I+++D    R+VQ N GH D +RS+  +P +NQ+VS   D  + +WN W +PK+
Sbjct:  626 EFAYASSDKMVYIRKFSTNGAKMTLVNTLQGHEGEVTCVRWNIHGKGSWVTGSEDGTIRIWSGSGLNECEQILAAQGGVCCMCIDKLNGSIVAGIQNTIRVYDCEHYRLVQTNVGHIDAVRSIIHIPERNQYVSCSWDQTIRVWNAWKKPKR 777          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:103035445])

HSP 1 Score: 60.8474 bits (146), Expect = 6.803e-9
Identity = 59/253 (23.32%), Postives = 109/253 (43.08%), Query Frame = 1
Query:  127 YNIFKHEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKA-AKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCE--CFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALD-----NRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN-NAGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKS 858
            +N      +TG+ D   K W+  +G  + +++ HK  V    F       + + S D T  LW       ++E  + FY       E  C      S+ + T ++D   +   L D++S +++S LSG    I++L      +R+  G FD  + ++D         +    ++ H   I+ +  N DS     I T + DK  KVW+   G+ +  + G +  ++DVC   + + I  ++      VYD ++
Sbjct:  100 FNKSGSSFITGSYDRTCKIWDTASGTELHTLEGHKNVVYAVAFNNPYGDKIATGSFDKTCRLW-------SVETGQCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTVK---LWDVESGVEVSTLSGHSAEIISLSFNTVGSRLVTGSFDHTVSVWD-----VPSGRLVHNLKGHRGEISSVNFNWDSS---LIVTASMDKTCKVWDAEGGRCLATLTGHNDEVLDVCFNFKGQLIATASADGTSRVYDAQT 334          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: pafah1b1b (lissencephaly-1 homolog B [Source:NCBI gene;Acc:103047044])

HSP 1 Score: 51.9878 bits (123), Expect = 3.476e-6
Identity = 58/238 (24.37%), Postives = 105/238 (44.12%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLW--QGNSVLQTIE-FDEPFYKLCLDCCECFLMCGTSSGLHTY-NLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN-NAGKLVHRIDGFSSSIIDV-----------CAVDRSKQIW 813
            +V+ +ED  +K W+ E G F  +++ H   V    F +  KL+ SCS D TI LW  QG   ++T+  +   F+   L C + F      +G   +  + +  Q G+L+   SN Q       VR  VA          + + V+ +C+ +  E    ++ ++A     T     K      ++ +G+ DK +K+W+ + G  +  + G  + +  V           CA D++ +IW
Sbjct:  123 MVSASEDATIKVWDYEAGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHVYRFTFFFHLLYCVKTF------TGHREWVRMVRPNQDGTLLASCSNDQ------TVRVWVAATKECKAELREHEHVV-ECISWAPESAHPTI-LEA-----TGSENKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHPGGKFIVSCADDKTLRIW 341          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: gnb1a (G protein subunit beta 1 [Source:NCBI gene;Acc:103044197])

HSP 1 Score: 50.8322 bits (120), Expect = 6.282e-6
Identity = 45/203 (22.17%), Postives = 84/203 (41.38%), Query Frame = 1
Query:  142 HEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVL--QTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLS------GIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN 726
            ++IVT + D     W++ETG   ++   H G V         +L +S + D +  LW     +  QT    E           CF   G +     +    D  +  L D+ ++ ++   S      GI     +   R+   G+D     ++C  + T     +  +  H+  ++CL V   +D+ + +ATG++D  +K+WN
Sbjct:  142 NQIVTSSGDTTCALWDIETGQQTTTFAGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAI-----CFFPNGNA-----FATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDD----FNCNVWDTLKADRAGVLAGHDNRVSCLGV---TDDGMAVATGSWDSFLKIWN 327          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: gnb1a (G protein subunit beta 1 [Source:NCBI gene;Acc:103044197])

HSP 1 Score: 51.2174 bits (121), Expect = 6.355e-6
Identity = 45/203 (22.17%), Postives = 84/203 (41.38%), Query Frame = 1
Query:  142 HEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVL--QTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLS------GIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN 726
            ++IVT + D     W++ETG   ++   H G V         +L +S + D +  LW     +  QT    E           CF   G +     +    D  +  L D+ ++ ++   S      GI     +   R+   G+D     ++C  + T     +  +  H+  ++CL V   +D+ + +ATG++D  +K+WN
Sbjct:  155 NQIVTSSGDTTCALWDIETGQQTTTFAGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAI-----CFFPNGNA-----FATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDD----FNCNVWDTLKADRAGVLAGHDNRVSCLGV---TDDGMAVATGSWDSFLKIWN 340          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:103029566])

HSP 1 Score: 51.6026 bits (122), Expect = 7.837e-6
Identity = 44/211 (20.85%), Postives = 88/211 (41.71%), Query Frame = 1
Query:  157 GAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLW---QGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSG-LHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN-NAGKLVHRIDGFSSSI 774
             A D    +W+L+       + AH   V+  V  K+ +L+ +   DC +++W   + N ++       P   +     E  ++ G+ SG L  ++L+  K   +L+   +NI   D              +  G  D  + ++D    G  +       + H  A+ C+  + D     W+A+ + D  +K+W+  AGKL+      +S++
Sbjct:   39 AASDVTKMWWKLQ------DMVAHSSKVSSLVLGKSGRLLATGGEDCRVNIWAVNKPNCIMSLTGHTSPVQCVQFSSTEEQVVAGSESGSLRVWDLEAAKILRTLMGHKANICSLDFH-------PFGEHIASGSVDTNIKLWDVRRKGCVF-----RYKGHTQAVRCISFSPDGK---WLASASDDSTIKLWDLTAGKLITEFTAHTSAV 228          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Match: CAF4 (WD40 repeat-containing protein associated with the CCR4-NOT complex; interacts in a Ccr4p-dependent manner with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p and plays a role in mitochondrial fission; CAF4 has a paralog, MDV1, that arose from the whole genome duplication [Source:SGD;Acc:S000001744])

HSP 1 Score: 49.6766 bits (117), Expect = 3.641e-6
Identity = 24/106 (22.64%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  136 FKHEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLW--QGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQ 447
            +   + TG +DG+V+ W+L  G  +  ++ H   +T   F   ++ +++ S D ++ +W  + +S+L  I +D P   L  D  +   +     G++ +N+++D+ 
Sbjct:  498 YNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKF--DSEKLVTGSMDNSVRIWDLRTSSILDVIAYDLPVSSLDFD-GKLITVGANEGGVNVFNMERDEH 600          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO28570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T637])

HSP 1 Score: 105.531 bits (262), Expect = 3.061e-41
Identity = 51/146 (34.93%), Postives = 88/146 (60.27%), Query Frame = 2
Query: 1814 DQFAYASADFLFHIRKFSLIGTQMVLIKRIDFYENEVTNLSWIGTLNSWITTSEDHMIKIWNCSEDFSCSQSINAGAPVTCMCFDYSSHILIAAVGKEIKLFDVLEERMVQVNCGHSDDIRSLAILPAKNQFVSSGEDGQLLIWNN 2251
            D+FAYAS+D L +IR+FS  G +M L+  +  +E +VT + W    N W+T SED  I++WN ++  SC   ++A   V+ +C D  +  ++A + + I+++D    ++VQ N GH+D +R +  +P ++Q V   +D Q +  NN
Sbjct:  228 DEFAYASSDKLVYIRRFSDKGREMKLLAVLQGHEADVTQVRWSSVRNKWVTGSEDGTIRVWN-ADGMSCELVLSAQGAVSALCIDQVNGCIVAGIQEVIRVYDPETRKIVQKNVGHTDSVRCVMHIPERSQVV---KDQQKITRNN 369          

HSP 2 Score: 83.5741 bits (205), Expect = 3.061e-41
Identity = 51/165 (30.91%), Postives = 84/165 (50.91%), Query Frame = 1
Query: 1285 TNKRFIKMIYCDQKDILIAAAEDGIIYVFGYDIAALNAFLEEARAKTASHKK-----GEKVLHPLMVDNTI------SPVTMRITGLACQQVLLEHKSVVSGITIVPCCHGRHEMFMLSCSWDQRICLWSLETFELVTKFQN-NHTGDKEARELAADDVITCIEY 1743
            +N   ++ ++ +  D+L+ A+ED  IYV+G+D+ A++       A  +   K     G+KV  P      +        VT R+ G  C+ VL +H + V+G+ +V    G    F++S  WD+RI LW LET  L   F+N +     E+ ELA+D +I  + Y
Sbjct:   61 SNIALLRSVFVEDLDLLVVASEDHNIYVWGFDMDAVSVLQNMRPADESLIFKYAILLGDKV--PRAEQENVEGSKDQDSVTNRVAGFICRNVLTQHTNCVTGLAVVGKDAGYGTTFLISAGWDRRILLWDLETVRLHDSFRNTDSNASSESEELASDGIILDLTY 223          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO35396 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLN7])

HSP 1 Score: 83.9593 bits (206), Expect = 2.591e-23
Identity = 51/165 (30.91%), Postives = 84/165 (50.91%), Query Frame = 1
Query: 1285 TNKRFIKMIYCDQKDILIAAAEDGIIYVFGYDIAALNAFLEEARAKTASHKK-----GEKVLHPLMVDNTI------SPVTMRITGLACQQVLLEHKSVVSGITIVPCCHGRHEMFMLSCSWDQRICLWSLETFELVTKFQN-NHTGDKEARELAADDVITCIEY 1743
            +N   ++ ++ +  D+L+ A+ED  IYV+G+D+ A++       A  +   K     G+KV  P      +        VT R+ G  C+ VL +H + V+G+ +V    G    F++S  WD+RI LW LET  L   F+N +     E+ ELA+D +I  + Y
Sbjct:   61 SNIALLRSVFVEDLDLLVVASEDHNIYVWGFDMDAVSVLQNMRPADESLIFKYAILLGDKV--PRAKQENVEGSKDQDSVTNRVAGFICRNVLTQHTNCVTGLAVVGKDAGYGTTFLISAGWDRRILLWDLETVRLHDSFRNTDSNASSESEELASDGIILDLTY 223          

HSP 2 Score: 44.669 bits (104), Expect = 2.591e-23
Identity = 28/103 (27.18%), Postives = 49/103 (47.57%), Query Frame = 2
Query: 1814 DQFAYASADFLFHIRKFSLIGTQMVLIKRIDFYENEVTNLSWIGTLNSWITTSEDHMIKIWNCSEDFSCSQSINAGAPVTCMCFDYSSHILIAAVGKEIKLFD 2122
            D+FAYAS+D L +IR+FS  G +M L+  +  +E +VT                         ++  SC   ++A   V+ +C D  +  ++A + + I+L D
Sbjct:  228 DEFAYASSDKLVYIRRFSDKGREMKLLAVLQGHEADVT-----------------------QNADGMSCELVLSAQGAVSALCIDQVNGCIVAGIQEVIRLHD 307          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO35398 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLP1])

HSP 1 Score: 94.7449 bits (234), Expect = 1.842e-21
Identity = 57/210 (27.14%), Postives = 91/210 (43.33%), Query Frame = 1
Query:  127 YNIFKHEIVTGAEDGLVKFWEL---ETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLW-QGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTY---------------------------------------------NLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCL--YYGTEYL 603
            YN  KHEI+ G EDG++K W+    E G  + +V  H GWVTCF+FW  AKL+ S ++D T   W  G +V   I    P Y +  +     L+    + +  +                                             N D  ++SG +ID   ++   + + +V+C+V  ++RVY  G D++L++YD    Y+G   L
Sbjct:   22 YNPMKHEILIGCEDGVIKVWDYSAGEPGKLLRTVHEHDGWVTCFLFWAEAKLLFSAANDGTFIAWGSGGAVHDRISIGSPIYSMAWNTRRNQLVAAVGTTVQVFTLRDPGNIGDQLVVEVGGTVQVFPLRDPDNVGDQVVVAVDWGFQVNQDAGRESGHVIDPKGDVS-REHTDLVKCVVCHESRVYSAGNDQRLIVYDSAFSYHGKNTL 230          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO31117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYV4])

HSP 1 Score: 66.6254 bits (161), Expect = 8.035e-11
Identity = 56/247 (22.67%), Postives = 106/247 (42.91%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLW--QGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCI--VALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN-NAGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGEDVS 873
            IV+ ++D L+K W  E+     ++  H  W++C       K ++S S+D  + +W   GN+  Q I          LD   C ++     G+   N D  K    + D+ +   +      V C+  VA   +V  G  D ++ ++DC+          VTI  H+ A+TC  V +D    V  +    D  +++W+   G+    + G ++ ++ +      K I   +      V+++ +G+ VS
Sbjct: 1164 IVSASKDDLLKVWRTESWVCTQTLIGHSSWISCVAMTTDGKTIISGSNDKNVKMWYTHGNAHAQAIGVPSDHIMHHLDQPRCVMVDFGRKGVSGANEDNLK----IWDMRTQECIITKPASVSCVTRVATSPKVVTGSSDGEMKLWDCV------TGECVTIARHDGAVTCAQVTQDGTQVVSGSADGTDSTIRLWDLTKGECKQVMQGHTNEVLCLSVTSNDKTIVSGSNDFTARVWNVATGKCVS 1400          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO37328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG41])

HSP 1 Score: 55.8398 bits (133), Expect = 3.313e-8
Identity = 59/258 (22.87%), Postives = 108/258 (41.86%), Query Frame = 1
Query:  145 EIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQ---GNSVLQTIEFDEPFYKLCLDCCECFLMCGT----------SSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDC---LYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNN-AGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPI-VYDIKSGE 864
             +VTG +D LVK W+ +TG  + +++ H G + C  F    KL  S ++D  + +W+   G  V             C      FL  G+           +G+ TY L+K +          N+       I  C  + D++    G       +DC   L++  E   A   +  H++ +  L   K    N  +A+G++D  +++W++  G+L+H + G  S  +  C+   S  +  S   +  + V+D  +G 
Sbjct:   13 RVVTGGDDDLVKIWDSKTGKVLFTLEHHDGAIKCVCFSSDGKLFASAAYDHLVMVWEAATGKQVFCLQGHTHSVETCCFSPNGAFLCSGSWDNTAIIWSLKNGMPTYVLNKHR----------NV-------IQTCAFSHDSKTVATG------SWDCTVRLWHLVEGDMAVKCLDGHKSNVHSLAFAK----NHMLASGSWDMTIRLWDSKTGELIHLLTGH-SGWVQACSFSGSGDLLASASDDQTVRVWDTSTGR 242          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: poc1b (POC1 centriolar protein B [Source:NCBI gene;Acc:101164214])

HSP 1 Score: 57.7658 bits (138), Expect = 7.883e-8
Identity = 62/252 (24.60%), Postives = 106/252 (42.06%), Query Frame = 1
Query:  145 EIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDC-CECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQ---AHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWN-NAGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIV-----YDIKSGEDV 870
             +VT ++D  VK W ++  +FI S+  H  WV C  F    +L++SC  D T+ LW  ++            K CL+C  +C   CG+S               + +D +SN           CI +        G D  L I+D        ++ +  IQ    H   I     +    +N ++ TG+ D  VKV +   G+L++ + G   ++  V A  ++  ++ S G +  I+     +D  S +DV
Sbjct:  116 RLVTASDDKSVKVWSVDRQSFIYSLNQHTNWVRCARFSPDGRLIVSCGDDRTVRLWDTST------------KHCLNCFSDC---CGSS---------------TFVDFNSNGT---------CIGS-------SGADSSLNIWD--------IRTNKLIQHYKVHSEGINSFSFHP---SNNFLITGSSDHTVKVLDLLEGRLIYTLHGHKGAVTSV-AFSQAGDLFASGGGDRQILLWRTNFDSNSYQDV 309          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: POC1A (POC1 centriolar protein A [Source:NCBI gene;Acc:101161307])

HSP 1 Score: 56.6102 bits (135), Expect = 1.135e-7
Identity = 53/199 (26.63%), Postives = 84/199 (42.21%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDL---SGIVRCIV--ALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNN 729
            +VT + D  +K W +    F+ S   H  WV C  F    +L++SCS D TI LW  NS        E F +L  +  + F   GT     + +      S  L DI +N  +      SG V  +      N +     D  + I D L     Y     T+  H++++TC+  ++  D   + ++G  D+ V VW +
Sbjct:  113 LVTASNDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLWDKNS-------RELFRRLYANHVD-FHPSGTCIAAASTD-----SSVKLWDIRTNKMLQHYQVHSGAVNSLSFHPAGNFLITTSSDSTVKILDLLEGKLLY-----TLHGHQSSVTCVAFSRTGD---YFSSGGADEQVMVWKS 290          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: POC1A (POC1 centriolar protein A [Source:NCBI gene;Acc:101161307])

HSP 1 Score: 56.6102 bits (135), Expect = 1.624e-7
Identity = 53/204 (25.98%), Postives = 84/204 (41.18%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSV--LQTIEFDEPFYKLCLD---CCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDL---SGIVRCIV--ALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNN 729
            +VT + D  +K W +    F+ S   H  WV C  F    +L++SCS D TI LW  NS   +Q+  F+   Y   +D      C     T S +             L DI +N  +      SG V  +      N +     D  + I D L     Y     T+  H++++TC+  ++  D   + ++G  D+ V VW +
Sbjct:  117 LVTASNDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRECIQSF-FEHAGYANHVDFHPSGTCIAAASTDSSV------------KLWDIRTNKMLQHYQVHSGAVNSLSFHPAGNFLITTSSDSTVKILDLLEGKLLY-----TLHGHQSSVTCVAFSRTGD---YFSSGGADEQVMVWKS 299          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: POC1A (POC1 centriolar protein A [Source:NCBI gene;Acc:101161307])

HSP 1 Score: 56.6102 bits (135), Expect = 1.797e-7
Identity = 53/204 (25.98%), Postives = 84/204 (41.18%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSV--LQTIEFDEPFYKLCLD---CCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDL---SGIVRCIV--ALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNN 729
            +VT + D  +K W +    F+ S   H  WV C  F    +L++SCS D TI LW  NS   +Q+  F+   Y   +D      C     T S +             L DI +N  +      SG V  +      N +     D  + I D L     Y     T+  H++++TC+  ++  D   + ++G  D+ V VW +
Sbjct:  117 LVTASNDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRECIQSF-FEHAGYANHVDFHPSGTCIAAASTDSSV------------KLWDIRTNKMLQHYQVHSGAVNSLSFHPAGNFLITTSSDSTVKILDLLEGKLLY-----TLHGHQSSVTCVAFSRTGD---YFSSGGADEQVMVWKS 299          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: POC1A (POC1 centriolar protein A [Source:NCBI gene;Acc:101161307])

HSP 1 Score: 56.225 bits (134), Expect = 1.961e-7
Identity = 53/204 (25.98%), Postives = 84/204 (41.18%), Query Frame = 1
Query:  148 IVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSV--LQTIEFDEPFYKLCLD---CCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDL---SGIVRCIV--ALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNN 729
            +VT + D  +K W +    F+ S   H  WV C  F    +L++SCS D TI LW  NS   +Q+  F+   Y   +D      C     T S +             L DI +N  +      SG V  +      N +     D  + I D L     Y     T+  H++++TC+  ++  D   + ++G  D+ V VW +
Sbjct:  117 LVTASNDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRECIQSF-FEHAGYANHVDFHPSGTCIAAASTDSSV------------KLWDIRTNKMLQHYQVHSGAVNSLSFHPAGNFLITTSSDSTVKILDLLEGKLLY-----TLHGHQSSVTCVAFSRTGD---YFSSGGADEQVMVWKS 299          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000072635.1 (SMESG000072635.1)

HSP 1 Score: 1282.32 bits (3317), Expect = 0.000e+0
Identity = 649/659 (98.48%), Postives = 652/659 (98.94%), Query Frame = 1
Query: 2671 MNENFPDLSVDQNTFSPIANSTVYRDPKRNDKKIRADISEDNDHYERVPSCFIKKTEKDFPSATVIEFSTEITETPKKRPQDISKLTILDKLLENKSDSVNVTRFANEYIEKAYPKNKENPVVEDSIKLFAKTTSLFWIGVNLNERTTKELIIVTKSSTTLQAKISTIAENFSFIQDRKLSSAIDVSLLPKVENRITVVFLPTDHWYCSGNIVVECQSKKFKVHLFGYACPAKIVFQEPKRLLYXXXXXXXXXXVEMSLTNVSPRTAFIYFYDVYKCGITFRPRKFLVHPDETRSVEIILPRIEKQYEYGVLYVDEGLRRATKEYCNKDPQKMPKLFNDLRIFFPCPGESDRNYEKWRSTNYVPELKKQIEKNFFEKTIELSKIKYLSREDCRLLDSVDVSTMDGLTTVSFPNLKVDEDKYNNVVITNYIKNLRTSSKGQLTNVLIEKNEYEFPETPIKSKSVIGIVIQNPNGNPLSWSIVHINPHDYMAVIGESKGTMSDNKVIPIQFQPPSVGKFVSEFIVRVWNNDDYSQIENLIKMTGFCTSTAATQLGQSCVPPRIPGFKAEREIVFEIQKHKTPRKISKPIKISNDTKYVMEIFTWAQSPFQIKRHIKLEVHKQSXXXXXXXXXXTKDFSSHKLIFFDIDGNASVTTLFVRET 4647
            MNENF DLSVDQNTFSPIANSTVYRDPKRNDKKIRADISEDNDHYERVPSCFIKKTEKDFPSATVIEFSTE TETPKKRPQDISKLTILDKLLENKSDSVNVTRFANEYIEKAYPKNKENPVVEDSIKLFAKTTSL WIGVNLNERTTKELIIVTKSSTTLQAKISTIAENFSFIQ RKLSSAIDVSLLPKVENRITVVFLPTDHWYCSGNIVVECQSKKFKVHLFGYACPAKIVFQEPKRLLYNSENEESNRSVEMSLTNVSPRTAFIYFYDVYK GITFRPRKFLVHPDETRSVEIILPRIEKQYEYGVLYVDEGLRRATKEYCNKDPQKMPKLFNDLRIFFPCPGESDRNYEKWRSTNYVPEL KQIEKNFFEKTIELSKIKYLSREDCRLLDSVDV TMDGLTTVSFPNLKVDEDKYNNVVITNYIKNLRTSSKG+LTNVLIEKNEYEFPETPIKSKSVIGIVIQNPNGNPLSWSIVHINPHDYMAVIGESKGTMSDNKVIPIQFQPPSVGKFVSEFIVRVWNNDDYSQIENLIKMTGFCTSTAATQLGQSCVPPRIPGFKA+REIVFEIQKHKTPRKISKPIKISNDTK+VMEIFTWAQSPFQIKRHIKLEVHKQSVKVVLNVKNLTKDFSSHKLIFFDIDGNASVTTLFVRET
Sbjct:    1 MNENFHDLSVDQNTFSPIANSTVYRDPKRNDKKIRADISEDNDHYERVPSCFIKKTEKDFPSATVIEFSTETTETPKKRPQDISKLTILDKLLENKSDSVNVTRFANEYIEKAYPKNKENPVVEDSIKLFAKTTSLLWIGVNLNERTTKELIIVTKSSTTLQAKISTIAENFSFIQGRKLSSAIDVSLLPKVENRITVVFLPTDHWYCSGNIVVECQSKKFKVHLFGYACPAKIVFQEPKRLLYNSENEESNRSVEMSLTNVSPRTAFIYFYDVYKSGITFRPRKFLVHPDETRSVEIILPRIEKQYEYGVLYVDEGLRRATKEYCNKDPQKMPKLFNDLRIFFPCPGESDRNYEKWRSTNYVPELNKQIEKNFFEKTIELSKIKYLSREDCRLLDSVDVFTMDGLTTVSFPNLKVDEDKYNNVVITNYIKNLRTSSKGELTNVLIEKNEYEFPETPIKSKSVIGIVIQNPNGNPLSWSIVHINPHDYMAVIGESKGTMSDNKVIPIQFQPPSVGKFVSEFIVRVWNNDDYSQIENLIKMTGFCTSTAATQLGQSCVPPRIPGFKAKREIVFEIQKHKTPRKISKPIKISNDTKHVMEIFTWAQSPFQIKRHIKLEVHKQSVKVVLNVKNLTKDFSSHKLIFFDIDGNASVTTLFVRET 659          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000072632.1 (SMESG000072632.1)

HSP 1 Score: 1110.52 bits (2871), Expect = 0.000e+0
Identity = 536/543 (98.71%), Postives = 539/543 (99.26%), Query Frame = 1
Query:  127 YNIFKHEIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNNAGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGEDVSRFSNNFQIIQSERFKIQLIKHFPEVGMVIATTNRRQILSWRSQISSAVTKLTCGVPIDSICISTKEPLLIYCGIENGQLIQWEKRESNEASFQHEIIKLSRSMKIMVESKLQSRQFQTEQSYSKNRAQQKLDAKRNKTNKRFIKMIYCDQKDILIAAAEDGIIYVFGYDIAALNAFLEEARAKTASHKKGEKVLHPLMVDNTISPVTMRITGLACQQVLLEHKSVVSGITIVPCCHGRHEMFMLSCSWDQRICLWSLETFELVTKFQNNHTGDKEARELAADDVITCIEYCDCQ 1755
            YNIFKHEIVTGAEDGLVKFWELETGAFISSVQAH+GWVTCFVFWKAAKLMLS SHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNNAGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGEDVSRFSNNFQIIQSERFKIQLIKHFPEVGMVIATTNRRQILSWRSQISSAVTKLTCGVPIDSICISTKEPLLIYCGIENGQLIQWEKRESNEASFQHEIIKLSRSMKIMVESKLQSRQFQTEQSYSKNRAQQK+DAKRN+TNKRFIKMIYCDQKDILIAAAEDGIIYVFGYDIAALNAFLEEARAKTAS KKGEKV HPLMVDNTISPVTMRITGLACQQVLLEHKSVVSGITIVPCCHGRHEMFMLSCSWDQRICLWSLETFELVTKFQNNHTGDKEARELAADDVITCIEYCDC 
Sbjct:   20 YNIFKHEIVTGAEDGLVKFWELETGAFISSVQAHQGWVTCFVFWKAAKLMLSSSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHTYNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIYDCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVWNNAGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGEDVSRFSNNFQIIQSERFKIQLIKHFPEVGMVIATTNRRQILSWRSQISSAVTKLTCGVPIDSICISTKEPLLIYCGIENGQLIQWEKRESNEASFQHEIIKLSRSMKIMVESKLQSRQFQTEQSYSKNRAQQKIDAKRNRTNKRFIKMIYCDQKDILIAAAEDGIIYVFGYDIAALNAFLEEARAKTASQKKGEKVPHPLMVDNTISPVTMRITGLACQQVLLEHKSVVSGITIVPCCHGRHEMFMLSCSWDQRICLWSLETFELVTKFQNNHTGDKEARELAADDVITCIEYCDCH 562          

HSP 2 Score: 205.682 bits (522), Expect = 3.897e-55
Identity = 98/100 (98.00%), Postives = 99/100 (99.00%), Query Frame = 2
Query: 1814 DQFAYASADFLFHIRKFSLIGTQMVLIKRIDFYENEVTNLSWIGTLNSWITTSEDHMIKIWNCSEDFSCSQSINAGAPVTCMCFDYSSHILIAAVGKEIK 2113
            DQFAYASADFLFHIRKFSLIGTQMVLIKRIDFYENEVTNLSWIGTLNSWITTSEDHMIKIWN SEDFSCSQSINAGAPVTCMCFD+SSHILIAAVGKEIK
Sbjct:  563 DQFAYASADFLFHIRKFSLIGTQMVLIKRIDFYENEVTNLSWIGTLNSWITTSEDHMIKIWNSSEDFSCSQSINAGAPVTCMCFDHSSHILIAAVGKEIK 662          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000000384.1 (SMESG000000384.1)

HSP 1 Score: 113.62 bits (283), Expect = 4.698e-25
Identity = 134/524 (25.57%), Postives = 224/524 (42.75%), Query Frame = 1
Query: 2902 KRPQDISKLTILDKLLENKSDSV--NVTRFANEYIEKAYPKNKENPVVEDSIK---LFAKTTSLFWIGVNLNERTTKELIIVTKSSTTLQAKISTIAE----NFSFIQDRKLSSAIDVSLLPKVENRITVVFLPTDHWYCSGNIVVECQSKKFKVHLFGYACPAKIVF---------QEPKRLLYXXXXXXXXXXVEMSLTNVSPRTAFIYFYDVYKCGITFRPRKFLVHPDETRSVEIILPRIEKQYEYGVLYVDEGLRRATKEYCNKDP-QKMPKLFNDLRIFFPCPGESDRNYEKWRSTNYVPELKKQIEKNFFEKTIELS-KIKYLSREDCRLLDSVDVS-TMDGLTTVSFPNLKVDEDKY-NNVVITNYIKNLRT------------SSKGQLTNVLIEKNEYEFPETPIKSKSVIGIVIQNPNGNPLSWSIVHI-------NPH----------------DYMAVIGESKGTM--SDNKVIPIQFQPPSVGKFVSEFIVRVWNNDDYSQIENLIKMTG 4296
            ++ Q    +T +D +++N  D+   +VT+ A E   +    N+    V  + K   + +    L W GV +     K   +  K+     A+I  I+     +F+         +I   L P  + +  VVF PT+  Y   +IVV  + K+FK++LFGYA  A++           Q P +LL   +    NRS ++ L N    T F+ FY  ++  + F+PR FL+    T+ +++          +  LY DE LRRA +  C   P Q    LFN   IF   P E D    K    ++ P L +Q++ +     I L   I   +R +C   D  D   T++  ++V   + +  +     N  +TN I+NL +             S   LT ++I+KNE  FP T I   S  G++I+N N   + W I  +       +P                 D    +   KGT+   D+ ++P+ F+P  VG+   +  V+V  ++  S +E  +   G
Sbjct:  215 EQQQSAINMTYIDNIMDNNEDTKLHDVTKLAYEL--QNIDNNRLQAGVGQASKPLTVLSNRIHLIWTGVPVQNNDIKSFKLHLKAEKPQFAEIRIISPSTPFHFTNQSGTNYQKSITGLLEPYKDRKFYVVFHPTNSSYHMAHIVVTLEDKRFKMYLFGYAEAARVELLHFQPSSNPQNPAKLLLIRDFVNDNRSKKIQLFNSGAHTGFVSFYS-HQQQVRFQPRSFLMVSKTTKEIKVTSISPVDVITFFFLYCDEELRRACRISCTTFPHQDKYNLFNVAHIFTILPEEKDIQQCKLPEFDWRPSLIRQLDGSVCYCNINLMPAISKSTRPNCVDFDITDFKLTLNEASSVRTIDRQTSQSSVTGNSTLTN-IENLNSKPMYMNSVSSYIDSINSLTAIVIQKNENYFPPTVIYRTSYTGVLIRNDNIFQVQWVISDMFLMSSNNSPDTCSSRYSLSSWSGTIPDSCMTVTMFKGTLKPGDSVLVPVAFKPTVVGRLKCKCNVKVLKDNSDSFMEKELDFYG 734          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000000384.1 (SMESG000000384.1)

HSP 1 Score: 107.457 bits (267), Expect = 4.728e-23
Identity = 111/405 (27.41%), Postives = 178/405 (43.95%), Query Frame = 1
Query: 3232 LLPKVENRITVVFLPTDHWYCSGNIVVECQSKKFKVHLFGYACPAKIVF---------QEPKRLLYXXXXXXXXXXVEMSLTNVSPRTAFIYFYDVYKCGITFRPRKFLVHPDETRSVEIILPRIEKQYEYGVLYVDEGLRRATKEYCNKDP-QKMPKLFNDLRIFFPCPGESDRNYEKWRSTNYVPELKKQIEKNFFEKTIELS-KIKYLSREDCRLLDSVDVS-TMDGLTTVSFPNLKVDEDKY-NNVVITNYIKNLRT------------SSKGQLTNVLIEKNEYEFPETPIKSKSVIGIVIQNPNGNPLSWSIVHI-------NPH----------------DYMAVIGESKGTM--SDNKVIPIQFQPPSVGKFVSEFIVRVWNNDDYSQIENLIKMTG 4296
            L P  + +  VVF PT+  Y   +IVV  + K+FK++LFGYA  A++           Q P +LL   +    NRS ++ L N    T F+ FY  ++  + F+PR FL+    T+ +++          +  LY DE LRRA +  C   P Q    LFN   IF   P E D    K    ++ P L +Q++ +     I L   I   +R +C   D  D   T++  ++V   + +  +     N  +TN I+NL +             S   LT ++I+KNE  FP T I   S  G++I+N N   + W I  +       +P                 D    +   KGT+   D+ ++P+ F+P  VG+   +  V+V  ++  S +E  +   G
Sbjct:  349 LEPYKDRKFYVVFHPTNSSYHMAHIVVTLEDKRFKMYLFGYAEAARVELLHFQPSSNPQNPAKLLLIRDFVNDNRSKKIQLFNSGAHTGFVSFYS-HQQQVRFQPRSFLMVSKTTKEIKVTSISPVDVITFFFLYCDEELRRACRISCTTFPHQDKYNLFNVAHIFTILPEEKDIQQCKLPEFDWRPSLIRQLDGSVCYCNINLMPAISKSTRPNCVDFDITDFKLTLNEASSVRTIDRQTSQSSVTGNSTLTN-IENLNSKPMYMNSVSSYIDSINSLTAIVIQKNENYFPPTVIYRTSYTGVLIRNDNIFQVQWVISDMFLMSSNNSPDTCSSRYSLSSWSGTIPDSCMTVTMFKGTLKPGDSVLVPVAFKPTVVGRLKCKCNVKVLKDNSDSFMEKELDFYG 751          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 52.373 bits (124), Expect = 2.574e-6
Identity = 23/56 (41.07%), Postives = 32/56 (57.14%), Query Frame = 1
Query:  145 EIVTGAEDGLVKFWELETGAFISSVQAHKGWVTCFVFWKAAKLMLSCSHDCTISLW 312
            E+VTG++D  +K W++    F  S+  HK WV C  F    +L+ S S D TI LW
Sbjct:  112 EMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLW 167          
The following BLAST results are available for this feature:
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR381.366e-826.54WD repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR381.380e-826.54WD repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR5B2.368e-621.30WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:1... [more]
KATNB15.352e-623.08katanin regulatory subunit B1 [Source:HGNC Symbol;... [more]
KATNB16.816e-623.08katanin regulatory subunit B1 [Source:HGNC Symbol;... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gbeta13F4.262e-622.39gene:FBgn0001105 transcript:FBtr0331597[more]
Gbeta13F4.262e-622.39gene:FBgn0001105 transcript:FBtr0074110[more]
Gbeta13F4.262e-622.39gene:FBgn0001105 transcript:FBtr0074108[more]
Gbeta13F4.262e-622.39gene:FBgn0001105 transcript:FBtr0074107[more]
Gbeta13F4.262e-622.39gene:FBgn0001105 transcript:FBtr0346794[more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daw12.024e-621.12dynein assembly factor with WDR repeat domains 1 [... [more]
daw12.309e-621.12dynein assembly factor with WDR repeat domains 1 [... [more]
nle18.329e-621.60notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:... [more]
nle18.329e-621.60notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:... [more]
nle18.329e-621.60notchless homolog 1 (Drosophila) [Source:ZFIN;Acc:... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pafah1b19.722e-727.91platelet activating factor acetylhydrolase 1b regu... [more]
pafah1b11.264e-627.91platelet activating factor acetylhydrolase 1b regu... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Katnb13.790e-623.08katanin p80 (WD40-containing) subunit B 1 [Source:... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q5JTN6|WDR38_HUMAN6.629e-826.54WD repeat-containing protein 38 OS=Homo sapiens OX... [more]
sp|B5X3C4|LIS1B_SALSA4.832e-728.50Lissencephaly-1 homolog B OS=Salmo salar OX=8030 G... [more]
sp|Q75BY3|PRP46_ASHGO6.150e-620.59Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii ... [more]
sp|Q5RE95|WDR5B_PONAB8.955e-621.30WD repeat-containing protein 5B OS=Pongo abelii OX... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7T7I85.630e-12935.71Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1I8ISW51.703e-12634.17Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DN011.901e-12634.35Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267F3H62.857e-12634.17Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
K1R1284.125e-12533.22Vegetative incompatibility protein HET-E-1 OS=Cras... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daw16.803e-923.32dynein assembly factor with WD repeats 1 [Source:N... [more]
pafah1b1b3.476e-624.37lissencephaly-1 homolog B [Source:NCBI gene;Acc:10... [more]
gnb1a6.282e-622.17G protein subunit beta 1 [Source:NCBI gene;Acc:103... [more]
gnb1a6.355e-622.17G protein subunit beta 1 [Source:NCBI gene;Acc:103... [more]
katnb17.837e-620.85katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CAF43.641e-622.64WD40 repeat-containing protein associated with the... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO285703.061e-4134.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353962.591e-2330.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353981.842e-2127.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311178.035e-1122.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373283.313e-822.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
poc1b7.883e-824.60POC1 centriolar protein B [Source:NCBI gene;Acc:10... [more]
POC1A1.135e-726.63POC1 centriolar protein A [Source:NCBI gene;Acc:10... [more]
POC1A1.624e-725.98POC1 centriolar protein A [Source:NCBI gene;Acc:10... [more]
POC1A1.797e-725.98POC1 centriolar protein A [Source:NCBI gene;Acc:10... [more]
POC1A1.961e-725.98POC1 centriolar protein A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072635.10.000e+098.48SMESG000072635.1[more]
SMESG000072632.13.897e-5598.71SMESG000072632.1[more]
SMESG000000384.14.698e-2525.57SMESG000000384.1[more]
SMESG000000384.14.728e-2327.41SMESG000000384.1[more]
SMESG000024482.12.574e-641.07SMESG000024482.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019926 ID=SMED30019926|Name=WD_REPEATS_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4777bp
ATTTGTTGATTTTGTTTAAATAAATTGTCTCTTAGCTTTTTAATTTTTAA
TAAATTTCAATTAAATTTTAATGCAATTTTACTTTAAAATAAATGATGCC
CATTTGCGCTTTATAACAAGCGTTGGTACAACATTTTCAAGCACGAAATT
GTTACTGGAGCGGAAGATGGATTGGTGAAATTCTGGGAATTAGAAACTGG
AGCATTTATTTCATCGGTTCAAGCCCACAAAGGATGGGTTACTTGTTTTG
TGTTCTGGAAAGCCGCTAAATTGATGTTGTCATGCAGTCACGATTGTACA
ATCTCATTGTGGCAAGGCAACTCGGTGTTACAAACTATTGAATTCGATGA
ACCGTTTTATAAATTGTGTTTAGATTGTTGTGAATGCTTTCTAATGTGTG
GCACATCGAGTGGGCTGCACACGTACAATTTGGACAAAGACAAACAATCC
GGATCTCTCATTGACATTGACAGCAACATACAAATGAGCGATCTCTCAGG
CATTGTTCGATGCATTGTCGCGTTGGACAATCGAGTCTATTGTGGGGGGT
TTGATAAGAAGCTTGTCATCTACGATTGTCTTTATTATGGAACTGAATAT
TTAAAGGCAAGCGTAACGATTCAGGCTCACGAGGCGGCAATCACATGCCT
GTGTGTTAATAAGGATTCTGACAACAACGTATGGATCGCGACTGGGGCGT
TCGATAAGGTTGTCAAGGTGTGGAATAACGCGGGGAAACTGGTCCACCGC
ATTGACGGATTCAGCTCCTCAATTATCGACGTGTGCGCCGTTGACAGGTC
GAAACAGATTTGGGTTTCAACCGGCTCAAACCTCCCAATCGTTTATGACA
TCAAGAGCGGGGAGGATGTCAGCAGATTCAGCAACAATTTCCAGATTATT
CAGTCTGAGAGATTCAAGATCCAGCTGATAAAGCATTTCCCGGAAGTTGG
AATGGTGATTGCAACGACAAATCGAAGGCAAATTCTCTCTTGGCGATCTC
AGATATCGTCGGCGGTTACGAAATTGACTTGTGGAGTTCCAATTGACTCG
ATTTGTATTTCTACCAAAGAACCCCTTCTAATATATTGCGGAATTGAGAA
TGGGCAACTTATTCAATGGGAGAAACGAGAATCTAATGAGGCATCCTTTC
AACACGAGATTATAAAACTCTCAAGGTCAATGAAAATCATGGTGGAGAGC
AAACTCCAATCAAGACAATTTCAAACGGAACAATCATACTCAAAAAACCG
AGCCCAGCAAAAATTAGATGCCAAAAGAAATAAAACAAACAAGCGATTCA
TTAAAATGATCTATTGCGATCAGAAAGATATCCTCATTGCTGCGGCAGAA
GATGGGATTATATACGTTTTTGGATACGATATTGCCGCTCTAAACGCATT
TCTAGAAGAGGCAAGGGCTAAAACTGCTTCACATAAGAAAGGTGAAAAGG
TTCTCCATCCACTGATGGTGGATAACACTATTAGCCCCGTTACCATGAGG
ATTACCGGCCTGGCTTGCCAGCAAGTCCTGCTTGAGCACAAAAGTGTCGT
TTCTGGCATCACAATTGTTCCTTGTTGTCATGGTAGACATGAAATGTTCA
TGCTAAGTTGTTCCTGGGATCAGAGAATCTGTTTGTGGAGTTTAGAAACA
TTCGAATTGGTAACAAAATTTCAGAACAATCATACGGGCGATAAGGAGGC
GCGAGAATTAGCGGCCGACGATGTCATAACGTGCATTGAGTACTGTGATT
GCCAGTTAATCATGAATATCTACATAATGATAATACTTATTATTATTGCA
TTATTTCTCTAGCGATCAATTCGCATATGCGAGTGCAGATTTCCTTTTCC
ATATCCGAAAGTTTTCATTAATTGGTACTCAAATGGTCCTGATCAAGCGA
ATCGATTTCTACGAAAACGAAGTGACAAATCTTTCTTGGATTGGAACGTT
GAACAGTTGGATTACGACATCTGAGGATCATATGATTAAAATATGGAATT
GCAGTGAAGATTTCTCCTGCAGCCAGTCCATCAATGCTGGAGCTCCTGTG
ACTTGCATGTGTTTTGACTACTCCAGTCATATCCTGATAGCTGCTGTTGG
TAAGGAAATCAAATTATTTGATGTTCTCGAAGAACGGATGGTTCAGGTAA
ACTGTGGACACAGTGACGACATAAGAAGCCTCGCAATTCTTCCTGCAAAA
AATCAGTTTGTTTCATCTGGTGAGGATGGCCAGCTGCTTATCTGGAACAA
TTGGTGTCGACCGAAGAAATACACTGGATCTAGATTCATTGACCGGTGAC
GTCGAATTGGATCTTGATGCCAATGTTTTCTTTCAAATTAAATATATTCA
TTGAGCTTTGAGTTATTATTTGATATTGTGACTTTGTTTTGCTTGTTGCC
TAGGCAGCCATTATATTTTAGATAATCCAATTTTGGTCCATCCGCCTGTA
ACGGGTGAGAAGGTATTATAGAAGGATAAATACCGGAAATTTGTCTCACG
GAGATCAACGTTAAGGTTATTAAGAAAATACAAACATTAAAATGTAAAAT
GACAGAGAAAGAAGGAGCATGGAGTCATGGAAAACTTTACCCTATAGATG
AATACATAAAACTCCAATAAGATACATTTTCATAAATCTGGATTTCAGCC
ATTTTTAAGATGGCTGCAAAATGAATGAAAATTTCCCTGATCTAAGTGTA
GACCAAAACACTTTCTCCCCAATAGCTAACTCCACGGTTTATAGGGATCC
AAAACGCAATGACAAAAAAATACGCGCAGACATAAGTGAAGATAACGATC
ATTATGAAAGGGTTCCCTCATGCTTCATTAAGAAAACAGAAAAGGATTTC
CCAAGTGCTACAGTTATTGAATTTAGTACGGAAATCACGGAAACACCAAA
AAAACGGCCACAGGACATTTCAAAGCTGACAATTCTGGACAAATTATTAG
AGAACAAAAGCGACTCAGTCAACGTCACTCGATTTGCAAACGAATATATC
GAGAAAGCCTATCCTAAAAATAAGGAAAATCCAGTTGTAGAAGACTCGAT
AAAGCTATTTGCCAAAACGACATCCCTTTTTTGGATTGGAGTTAATCTCA
ACGAAAGAACGACAAAAGAGCTGATAATCGTAACCAAATCCTCGACAACT
CTACAAGCAAAAATTTCAACAATTGCCGAAAATTTCTCATTCATTCAAGA
CAGGAAATTATCATCGGCAATTGACGTTAGCTTGCTCCCAAAGGTCGAGA
ATCGTATCACTGTCGTATTCCTACCGACAGACCATTGGTATTGTTCTGGA
AATATTGTCGTCGAGTGCCAATCCAAGAAATTCAAAGTCCATCTGTTTGG
TTATGCGTGTCCCGCTAAAATTGTTTTCCAAGAACCAAAAAGGCTATTGT
ATAATTCTGAAAATGAAGAATCCAATAGGTCAGTTGAAATGTCTCTCACA
AATGTTTCTCCAAGGACGGCATTCATTTATTTTTATGACGTCTATAAATG
TGGAATTACATTTCGACCGAGAAAGTTCTTGGTTCATCCTGATGAAACTA
GATCCGTAGAAATAATTCTTCCGAGAATCGAAAAACAGTATGAATATGGG
GTTCTCTATGTTGATGAAGGGCTTCGACGTGCTACTAAAGAATATTGCAA
TAAGGATCCACAGAAAATGCCTAAACTTTTCAATGACCTGAGAATATTTT
TTCCTTGTCCTGGAGAGAGCGACAGAAACTATGAGAAATGGCGGTCAACA
AATTATGTTCCCGAGTTGAAAAAACAAATAGAAAAGAATTTCTTTGAGAA
AACAATAGAATTAAGCAAAATTAAGTATTTGAGTCGGGAAGACTGTCGAT
TACTGGATTCCGTTGATGTCTCTACTATGGATGGACTGACTACCGTGAGT
TTTCCAAACCTAAAAGTTGATGAGGATAAATATAATAACGTTGTTATTAC
TAATTATATTAAAAACCTGAGAACTTCATCCAAAGGACAACTGACAAATG
TTCTAATAGAAAAAAATGAATACGAATTTCCCGAGACACCTATCAAGTCC
AAATCAGTAATAGGAATAGTTATTCAGAATCCCAATGGGAATCCTCTGAG
CTGGAGCATCGTCCATATAAATCCCCATGACTATATGGCAGTCATCGGGG
AGAGCAAAGGCACAATGTCAGATAATAAAGTAATACCGATCCAGTTTCAA
CCGCCATCAGTCGGGAAATTCGTATCTGAATTCATTGTGAGGGTTTGGAA
TAACGATGACTATTCACAAATAGAAAATTTGATCAAAATGACAGGATTTT
GTACAAGTACAGCCGCAACTCAGCTTGGACAAAGTTGTGTTCCTCCAAGG
ATTCCCGGATTCAAAGCGGAACGGGAAATTGTTTTTGAAATCCAGAAACA
CAAGACTCCAAGAAAGATTTCCAAACCCATCAAGATATCCAACGACACAA
AGTATGTCATGGAGATTTTCACATGGGCACAGTCACCGTTTCAGATAAAA
CGACATATAAAGCTAGAAGTACACAAGCAGTCTGTAAAAGTCGTCCTAAA
TGTGAAAAATTTAACCAAAGATTTTTCCAGTCACAAATTAATATTTTTTG
ACATAGATGGAAACGCCTCAGTCACGACATTATTTGTCCGGGAAACATAA
CAAGATCTTCGGAAAGGATCATAATTTATATTTTCTTTCGCCCAGATTAT
TTAATAGATTTTATTCTTTATGGCTTCTATTTATCCTTTGGGTAGCAGAC
CAACCATTTGGCAGCATTTTTCAAAAC
back to top

protein sequence of SMED30019926-orf-1

>SMED30019926-orf-1 ID=SMED30019926-orf-1|Name=SMED30019926-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=139bp
MVLIKRIDFYENEVTNLSWIGTLNSWITTSEDHMIKIWNCSEDFSCSQSI
NAGAPVTCMCFDYSSHILIAAVGKEIKLFDVLEERMVQVNCGHSDDIRSL
AILPAKNQFVSSGEDGQLLIWNNWCRPKKYTGSRFIDR*
back to top

protein sequence of SMED30019926-orf-2

>SMED30019926-orf-2 ID=SMED30019926-orf-2|Name=SMED30019926-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=513bp
MLSCSHDCTISLWQGNSVLQTIEFDEPFYKLCLDCCECFLMCGTSSGLHT
YNLDKDKQSGSLIDIDSNIQMSDLSGIVRCIVALDNRVYCGGFDKKLVIY
DCLYYGTEYLKASVTIQAHEAAITCLCVNKDSDNNVWIATGAFDKVVKVW
NNAGKLVHRIDGFSSSIIDVCAVDRSKQIWVSTGSNLPIVYDIKSGEDVS
RFSNNFQIIQSERFKIQLIKHFPEVGMVIATTNRRQILSWRSQISSAVTK
LTCGVPIDSICISTKEPLLIYCGIENGQLIQWEKRESNEASFQHEIIKLS
RSMKIMVESKLQSRQFQTEQSYSKNRAQQKLDAKRNKTNKRFIKMIYCDQ
KDILIAAAEDGIIYVFGYDIAALNAFLEEARAKTASHKKGEKVLHPLMVD
NTISPVTMRITGLACQQVLLEHKSVVSGITIVPCCHGRHEMFMLSCSWDQ
RICLWSLETFELVTKFQNNHTGDKEARELAADDVITCIEYCDCQLIMNIY
IMIILIIIALFL*
back to top

protein sequence of SMED30019926-orf-3

>SMED30019926-orf-3 ID=SMED30019926-orf-3|Name=SMED30019926-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=660bp
MNENFPDLSVDQNTFSPIANSTVYRDPKRNDKKIRADISEDNDHYERVPS
CFIKKTEKDFPSATVIEFSTEITETPKKRPQDISKLTILDKLLENKSDSV
NVTRFANEYIEKAYPKNKENPVVEDSIKLFAKTTSLFWIGVNLNERTTKE
LIIVTKSSTTLQAKISTIAENFSFIQDRKLSSAIDVSLLPKVENRITVVF
LPTDHWYCSGNIVVECQSKKFKVHLFGYACPAKIVFQEPKRLLYNSENEE
SNRSVEMSLTNVSPRTAFIYFYDVYKCGITFRPRKFLVHPDETRSVEIIL
PRIEKQYEYGVLYVDEGLRRATKEYCNKDPQKMPKLFNDLRIFFPCPGES
DRNYEKWRSTNYVPELKKQIEKNFFEKTIELSKIKYLSREDCRLLDSVDV
STMDGLTTVSFPNLKVDEDKYNNVVITNYIKNLRTSSKGQLTNVLIEKNE
YEFPETPIKSKSVIGIVIQNPNGNPLSWSIVHINPHDYMAVIGESKGTMS
DNKVIPIQFQPPSVGKFVSEFIVRVWNNDDYSQIENLIKMTGFCTSTAAT
QLGQSCVPPRIPGFKAEREIVFEIQKHKTPRKISKPIKISNDTKYVMEIF
TWAQSPFQIKRHIKLEVHKQSVKVVLNVKNLTKDFSSHKLIFFDIDGNAS
VTTLFVRET*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0000776kinetochore
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005819spindle
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005875microtubule associated complex
GO:0005938cell cortex
GO:0016020membrane
GO:0031965nuclear membrane
GO:1904115axon cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0000132establishment of mitotic spindle orientation
GO:0006629lipid metabolic process
GO:0006810transport
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0007097nuclear migration
GO:0007275multicellular organism development
GO:0007281germ cell development
GO:0007399nervous system development
GO:0008090retrograde axonal transport
GO:0016042lipid catabolic process
GO:0022008neurogenesis
GO:0030154cell differentiation
GO:0031023microtubule organizing center organization
GO:0047496vesicle transport along microtubule
GO:0051301cell division
GO:2000574regulation of microtubule motor activity