Armadillo repeat protein deleted in velo-cardio-facial syndrome

Overview
NameArmadillo repeat protein deleted in velo-cardio-facial syndrome
Smed IDSMED30019923
Length (bp)2111
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Armadillo repeat protein deleted in velo-cardio-facial syndrome (SMED30019923) t-SNE clustered cells

Violin plots show distribution of expression levels for Armadillo repeat protein deleted in velo-cardio-facial syndrome (SMED30019923) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Armadillo repeat protein deleted in velo-cardio-facial syndrome (SMED30019923) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Armadillo repeat protein deleted in velo-cardio-facial syndrome (SMED30019923) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019923

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019923h1SMcG0009042 SmedASXL_067090SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019923h1SMcG0009042 dd_Smed_v4_8312_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30019923h1SMcG0009042 dd_Smed_v4_8312_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019923h1SMcG0009042 dd_Smed_v4_8312_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30019923h1SMcG0009042 dd_Smed_v4_8312_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Human
Match: ARVCF (ARVCF delta catenin family member [Source:HGNC Symbol;Acc:HGNC:728])

HSP 1 Score: 153.295 bits (386), Expect = 5.706e-38
Identity = 138/511 (27.01%), Postives = 235/511 (45.99%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------------------FNKKTVKH------SRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE +K  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    ++       + E     L NLSS     + +    L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                        F  K  K        +D     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P   G  L+       LNT++ I   +S  L    SLL+      GV   + L++S
Sbjct:  275 RLVRRSPSVD---SARKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKEEWFHQGKKDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVR--------NVRNAQAPPRPGACLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALVAS 749          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Human
Match: ARVCF (ARVCF delta catenin family member [Source:HGNC Symbol;Acc:HGNC:728])

HSP 1 Score: 153.295 bits (386), Expect = 7.546e-38
Identity = 138/511 (27.01%), Postives = 235/511 (45.99%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------------------FNKKTVKH------SRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE +K  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    ++       + E     L NLSS     + +    L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                        F  K  K        +D     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P   G  L+       LNT++ I   +S  L    SLL+      GV   + L++S
Sbjct:  338 RLVRRSPSVD---SARKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKEEWFHQGKKDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVR--------NVRNAQAPPRPGACLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALVAS 812          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Human
Match: ARVCF (ARVCF delta catenin family member [Source:HGNC Symbol;Acc:HGNC:728])

HSP 1 Score: 152.91 bits (385), Expect = 7.999e-38
Identity = 135/505 (26.73%), Postives = 234/505 (46.34%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKK--------TVKHSRDEIQ---------------------FSNPHQMDVGDQM-LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE +K  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    ++       + E     L NLSS     + +    L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y   +         + +  RD+                          P + +      LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P   G  L+       LNT++ I   +S  L    SLL+      GV   + L++S
Sbjct:  275 RLVRRSPSVD---SARKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKGKKDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVR--------NVRNAQAPPRPGACLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALVAS 743          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Human
Match: ARVCF (ARVCF delta catenin family member [Source:HGNC Symbol;Acc:HGNC:728])

HSP 1 Score: 152.525 bits (384), Expect = 1.191e-37
Identity = 135/505 (26.73%), Postives = 234/505 (46.34%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKK--------TVKHSRDEIQ---------------------FSNPHQMDVGDQM-LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE +K  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    ++       + E     L NLSS     + +    L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y   +         + +  RD+                          P + +      LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P   G  L+       LNT++ I   +S  L    SLL+      GV   + L++S
Sbjct:  338 RLVRRSPSVD---SARKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKGKKDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVR--------NVRNAQAPPRPGACLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALVAS 806          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Human
Match: PKP4 (plakophilin 4 [Source:HGNC Symbol;Acc:HGNC:9026])

HSP 1 Score: 144.436 bits (363), Expect = 5.879e-35
Identity = 118/420 (28.10%), Postives = 196/420 (46.67%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLL--QLNAAGVIRNLSNGPN-----IQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEF--VTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLH---------------DILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGDQM--------------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDI 1328
            +P +PE++ +L      +Q+N  A+LQH+ + +  +K  +    GI  ++ LL+  HR+L  Q NA G +RNL  G +     I +K   G   ++ ++   +++       + E    +L NLSSC    + +    LST    V++P  G +     +        D  I F + L     T  L+N+SS   E R  MR CEGL+DS+  +I    NT  ++++TVE+C+C +RNL Y L                D+L        ++ +    + + +   P Q D  D +              +LW+  ++  +L ++  S N  ++E + G++QNL+    K A   R   RK KGLP LV  +    D VV     ALRN++ D RN ELIG + +  ++  LP  + P +
Sbjct:  527 DPELPEVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVCRLGGIKHLVDLLD--HRVLEVQKNACGALRNLVFGKSTDENKIAMKNVGGIPALLRLLRKSIDA------EVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDD--------DHKIKFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSDYDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELDDLLGKESPSKDSEPSCWGKKKKKKKRTP-QEDQWDGVGPIPGLSKSPKGVEMLWHPSVVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNKELIGKYAMRDLVNRLPGGNGPSV 929          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Celegans
Match: jac-1 (Juxtamembrane domain-associated catenin [Source:UniProtKB/Swiss-Prot;Acc:Q9U308])

HSP 1 Score: 148.288 bits (373), Expect = 1.072e-36
Identity = 122/429 (28.44%), Postives = 200/429 (46.62%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGP-----NIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWL-EFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQ----YSFNKKTVKHSRDEIQFSNPHQMD----------VGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYS 1409
            +P + E+++ L++ + D Q N   +LQH+TY +  IKE  R   GIP ++ LL S    +Q NA   ++NLS G       + + +  G   I E++    ++S      + E  AA L NLSS  +    +  S      + V+ P L +              SD +  FGS L +  T  L+N+S+   + R  +R    L++++   +  +      ++ TVE+ +C++RNL Y + +++  ++     +S + K +KH             +          V    +LW   ++ L+L+++  S N  ++EA+ GA+QNLA C+   + E R   R  KGLP LV  +    D VV     ALRNL+ D RN ELIG + L   L  LP P  P    I D  + G  L I  E +  +  Y+
Sbjct:  447 DPSLKEVIEYLSSADKDKQLNASGYLQHLTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKENDANKLAVMEADGVRLIAEVLRTTHDAS------VKEEAAAALWNLSSADMLKPVILESATEILSQQVIAPVLAVGT------------SDPTRHFGSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHAIQKSQVDSPTVENAVCLLRNLSYRIQEVVDPNYDPAAAHSSSSKNMKHVASPKPEKKKKDKEKKKDKNPKNIVTGPSVLWQPHVVKLYLKLLQDSSNIETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLAIDPRNRELIGKYALRDFLDKLPEPGSPRRSAISD-QTIGAVLGILFEIVRSSAAYT 856          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Celegans
Match: jac-1 (Juxtamembrane domain-associated catenin [Source:UniProtKB/Swiss-Prot;Acc:Q9U308])

HSP 1 Score: 148.288 bits (373), Expect = 1.114e-36
Identity = 122/429 (28.44%), Postives = 200/429 (46.62%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGP-----NIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWL-EFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQ----YSFNKKTVKHSRDEIQFSNPHQMD----------VGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYS 1409
            +P + E+++ L++ + D Q N   +LQH+TY +  IKE  R   GIP ++ LL S    +Q NA   ++NLS G       + + +  G   I E++    ++S      + E  AA L NLSS  +    +  S      + V+ P L +              SD +  FGS L +  T  L+N+S+   + R  +R    L++++   +  +      ++ TVE+ +C++RNL Y + +++  ++     +S + K +KH             +          V    +LW   ++ L+L+++  S N  ++EA+ GA+QNLA C+   + E R   R  KGLP LV  +    D VV     ALRNL+ D RN ELIG + L   L  LP P  P    I D  + G  L I  E +  +  Y+
Sbjct:  520 DPSLKEVIEYLSSADKDKQLNASGYLQHLTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKENDANKLAVMEADGVRLIAEVLRTTHDAS------VKEEAAAALWNLSSADMLKPVILESATEILSQQVIAPVLAVGT------------SDPTRHFGSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHAIQKSQVDSPTVENAVCLLRNLSYRIQEVVDPNYDPAAAHSSSSKNMKHVASPKPEKKKKDKEKKKDKNPKNIVTGPSVLWQPHVVKLYLKLLQDSSNIETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLAIDPRNRELIGKYALRDFLDKLPEPGSPRRSAISD-QTIGAVLGILFEIVRSSAAYT 929          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Celegans
Match: jac-1 (Juxtamembrane domain-associated catenin [Source:UniProtKB/Swiss-Prot;Acc:Q9U308])

HSP 1 Score: 148.288 bits (373), Expect = 1.114e-36
Identity = 122/429 (28.44%), Postives = 200/429 (46.62%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGP-----NIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWL-EFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQ----YSFNKKTVKHSRDEIQFSNPHQMD----------VGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYS 1409
            +P + E+++ L++ + D Q N   +LQH+TY +  IKE  R   GIP ++ LL S    +Q NA   ++NLS G       + + +  G   I E++    ++S      + E  AA L NLSS  +    +  S      + V+ P L +              SD +  FGS L +  T  L+N+S+   + R  +R    L++++   +  +      ++ TVE+ +C++RNL Y + +++  ++     +S + K +KH             +          V    +LW   ++ L+L+++  S N  ++EA+ GA+QNLA C+   + E R   R  KGLP LV  +    D VV     ALRNL+ D RN ELIG + L   L  LP P  P    I D  + G  L I  E +  +  Y+
Sbjct:  520 DPSLKEVIEYLSSADKDKQLNASGYLQHLTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKENDANKLAVMEADGVRLIAEVLRTTHDAS------VKEEAAAALWNLSSADMLKPVILESATEILSQQVIAPVLAVGT------------SDPTRHFGSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHAIQKSQVDSPTVENAVCLLRNLSYRIQEVVDPNYDPAAAHSSSSKNMKHVASPKPEKKKKDKEKKKDKNPKNIVTGPSVLWQPHVVKLYLKLLQDSSNIETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLAIDPRNRELIGKYALRDFLDKLPEPGSPRRSAISD-QTIGAVLGILFEIVRSSAAYT 929          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Celegans
Match: jac-1 (Juxtamembrane domain-associated catenin [Source:UniProtKB/Swiss-Prot;Acc:Q9U308])

HSP 1 Score: 148.288 bits (373), Expect = 1.259e-36
Identity = 122/429 (28.44%), Postives = 200/429 (46.62%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGP-----NIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWL-EFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQ----YSFNKKTVKHSRDEIQFSNPHQMD----------VGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYS 1409
            +P + E+++ L++ + D Q N   +LQH+TY +  IKE  R   GIP ++ LL S    +Q NA   ++NLS G       + + +  G   I E++    ++S      + E  AA L NLSS  +    +  S      + V+ P L +              SD +  FGS L +  T  L+N+S+   + R  +R    L++++   +  +      ++ TVE+ +C++RNL Y + +++  ++     +S + K +KH             +          V    +LW   ++ L+L+++  S N  ++EA+ GA+QNLA C+   + E R   R  KGLP LV  +    D VV     ALRNL+ D RN ELIG + L   L  LP P  P    I D  + G  L I  E +  +  Y+
Sbjct:  617 DPSLKEVIEYLSSADKDKQLNASGYLQHLTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKENDANKLAVMEADGVRLIAEVLRTTHDAS------VKEEAAAALWNLSSADMLKPVILESATEILSQQVIAPVLAVGT------------SDPTRHFGSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHAIQKSQVDSPTVENAVCLLRNLSYRIQEVVDPNYDPAAAHSSSSKNMKHVASPKPEKKKKDKEKKKDKNPKNIVTGPSVLWQPHVVKLYLKLLQDSSNIETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLAIDPRNRELIGKYALRDFLDKLPEPGSPRRSAISD-QTIGAVLGILFEIVRSSAAYT 1026          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Celegans
Match: jac-1 (Juxtamembrane domain-associated catenin [Source:UniProtKB/Swiss-Prot;Acc:Q9U308])

HSP 1 Score: 147.902 bits (372), Expect = 1.634e-36
Identity = 122/429 (28.44%), Postives = 200/429 (46.62%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGP-----NIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWL-EFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQ----YSFNKKTVKHSRDEIQFSNPHQMD----------VGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYS 1409
            +P + E+++ L++ + D Q N   +LQH+TY +  IKE  R   GIP ++ LL S    +Q NA   ++NLS G       + + +  G   I E++    ++S      + E  AA L NLSS  +    +  S      + V+ P L +              SD +  FGS L +  T  L+N+S+   + R  +R    L++++   +  +      ++ TVE+ +C++RNL Y + +++  ++     +S + K +KH             +          V    +LW   ++ L+L+++  S N  ++EA+ GA+QNLA C+   + E R   R  KGLP LV  +    D VV     ALRNL+ D RN ELIG + L   L  LP P  P    I D  + G  L I  E +  +  Y+
Sbjct:  690 DPSLKEVIEYLSSADKDKQLNASGYLQHLTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKENDANKLAVMEADGVRLIAEVLRTTHDAS------VKEEAAAALWNLSSADMLKPVILESATEILSQQVIAPVLAVGT------------SDPTRHFGSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHAIQKSQVDSPTVENAVCLLRNLSYRIQEVVDPNYDPAAAHSSSSKNMKHVASPKPEKKKKDKEKKKDKNPKNIVTGPSVLWQPHVVKLYLKLLQDSSNIETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLAIDPRNRELIGKYALRDFLDKLPEPGSPRRSAISD-QTIGAVLGILFEIVRSSAAYT 1099          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Fly
Match: p120ctn (gene:FBgn0260799 transcript:FBtr0111114)

HSP 1 Score: 127.487 bits (319), Expect = 4.096e-30
Identity = 111/418 (26.56%), Postives = 189/418 (45.22%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQ-----IKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHD----------------ILQSSHQ------YSFNKK---------------TVKHSRDEIQFSNPHQMDVGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P + E++  L+  +  I++N  A+LQH+ Y ++  K+  R   GIP ++ LL+     +  NA G +RNLS G         IK   G   ++ ++    E+       + E    +L N+SSC     ++    L   V  V+ P  G              +      F +     +  L+N+SS     R  +R CE L++ +  +++ S       N+TVE+C+CI+RNL Y   +                ++ SS +      +  NKK               +  +S+  + +   ++++ G +  LW  E++  +L ++    N  ++EAA GA+QNL+ C  + + + R   RK KGLP LV  +    D VV     ALRNL+ D RN ELIG + +  ++Q LPS
Sbjct:  224 DPNLSEVISFLSNPSSAIKANAAAYLQHLCYMDDPNKQRTRSLGGIPPLVRLLSYDSPEIHKNACGALRNLSYGRQNDENKRGIKNAGGIAALVHLLCRSQET------EVKELVTGVLWNMSSCEDLKRSIIDEALVAVVCSVIKPHSGWDA-----------VCCGETCFSTVFRNASGVLRNVSSAGEHARGCLRNCEHLVECLLYVVRTSIEKNNIGNKTVENCVCILRNLSYRCQEVDDPNYDKHPFITPERVIPSSSKGENLGCFGTNKKKKEANNSDALNEYNISADYSKSSVTY---NKLNKGYEQ-LWQPEVVQYYLSLLQSCSNPETLEAAAGAIQNLSACYWQPSIDIRATVRKEKGLPILVELLRMEVDRVVCAVATALRNLAIDQRNKELIGKYAMRDLVQKLPS 620          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Zebrafish
Match: arvcfb (ARVCF delta catenin family member b [Source:ZFIN;Acc:ZDB-GENE-060526-60])

HSP 1 Score: 162.155 bits (409), Expect = 6.058e-41
Identity = 125/418 (29.90%), Postives = 207/418 (49.52%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------------------FNKKTVKHSRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P +PE++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP+++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + ++                        F  K  K  ++     N   +D+  +        LL+  E++ L+L ++  S+NY ++EAA GA+QNL+  +   +   R   RK KGLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  ++  LPS
Sbjct:  390 DPDLPEVIAMLGHPIDPVKSNAAAYLQHLCYENDKIKKDVRQLKGIPVLVSLLDHPKAEVHRKACGALRNISYGKDHDNKVAIKSCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTMTNEVIIPHSGWEHEPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGKKDMDNKSVENCVCIMRNLSYHVHKEVPGAEKFQDPSALQAPGSAGTQRKKKDDAGCFGGKKAKGRKNGEHDKNYDTLDLPKRTEPTKGFELLYQPEVVRLYLSLLTESQNYNTLEAAAGALQNLSAGQWTWSNYIRATVRKEKGLPILVELLRSDSDKVVRAVAIALRNLSIDRRNKDLIGSYAMRDLVSNLPS 787          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Zebrafish
Match: arvcfb (ARVCF delta catenin family member b [Source:ZFIN;Acc:ZDB-GENE-060526-60])

HSP 1 Score: 162.155 bits (409), Expect = 6.058e-41
Identity = 125/418 (29.90%), Postives = 207/418 (49.52%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------------------FNKKTVKHSRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P +PE++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP+++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + ++                        F  K  K  ++     N   +D+  +        LL+  E++ L+L ++  S+NY ++EAA GA+QNL+  +   +   R   RK KGLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  ++  LPS
Sbjct:  390 DPDLPEVIAMLGHPIDPVKSNAAAYLQHLCYENDKIKKDVRQLKGIPVLVSLLDHPKAEVHRKACGALRNISYGKDHDNKVAIKSCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTMTNEVIIPHSGWEHEPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGKKDMDNKSVENCVCIMRNLSYHVHKEVPGAEKFQDPSALQAPGSAGTQRKKKDDAGCFGGKKAKGRKNGEHDKNYDTLDLPKRTEPTKGFELLYQPEVVRLYLSLLTESQNYNTLEAAAGALQNLSAGQWTWSNYIRATVRKEKGLPILVELLRSDSDKVVRAVAIALRNLSIDRRNKDLIGSYAMRDLVSNLPS 787          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Zebrafish
Match: arvcfb (ARVCF delta catenin family member b [Source:ZFIN;Acc:ZDB-GENE-060526-60])

HSP 1 Score: 157.918 bits (398), Expect = 1.232e-39
Identity = 125/424 (29.48%), Postives = 208/424 (49.06%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS---------------------------------FN--KKTVKHSRDEIQFSNPHQMDVGDQM-LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P +PE++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP+++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + ++                                  FN  +K  +H ++      P + +      LL+  E++ L+L ++  S+NY ++EAA GA+QNL+  +   +   R   RK KGLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  ++  LPS
Sbjct:  365 DPDLPEVIAMLGHPIDPVKSNAAAYLQHLCYENDKIKKDVRQLKGIPVLVSLLDHPKAEVHRKACGALRNISYGKDHDNKVAIKSCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTMTNEVIIPHSGWEHEPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGKKDMDNKSVENCVCIMRNLSYHVHKEVPGAEKFQDPSALQAPGSAGTQRKKKDDAGCFGGKKAKEEWFNQGRKNGEHDKNYDTLDLPKRTEPTKGFELLYQPEVVRLYLSLLTESQNYNTLEAAAGALQNLSAGQWTWSNYIRATVRKEKGLPILVELLRSDSDKVVRAVAIALRNLSIDRRNKDLIGSYAMRDLVSNLPS 768          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Zebrafish
Match: arvcfb (ARVCF delta catenin family member b [Source:ZFIN;Acc:ZDB-GENE-060526-60])

HSP 1 Score: 157.918 bits (398), Expect = 1.489e-39
Identity = 125/424 (29.48%), Postives = 208/424 (49.06%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS---------------------------------FN--KKTVKHSRDEIQFSNPHQMDVGDQM-LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P +PE++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP+++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + ++                                  FN  +K  +H ++      P + +      LL+  E++ L+L ++  S+NY ++EAA GA+QNL+  +   +   R   RK KGLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  ++  LPS
Sbjct:  365 DPDLPEVIAMLGHPIDPVKSNAAAYLQHLCYENDKIKKDVRQLKGIPVLVSLLDHPKAEVHRKACGALRNISYGKDHDNKVAIKSCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTMTNEVIIPHSGWEHEPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGKKDMDNKSVENCVCIMRNLSYHVHKEVPGAEKFQDPSALQAPGSAGTQRKKKDDAGCFGGKKAKEEWFNQGRKNGEHDKNYDTLDLPKRTEPTKGFELLYQPEVVRLYLSLLTESQNYNTLEAAAGALQNLSAGQWTWSNYIRATVRKEKGLPILVELLRSDSDKVVRAVAIALRNLSIDRRNKDLIGSYAMRDLVSNLPS 768          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Zebrafish
Match: pkp4 (plakophilin 4 [Source:ZFIN;Acc:ZDB-GENE-120411-14])

HSP 1 Score: 148.673 bits (374), Expect = 1.338e-36
Identity = 119/409 (29.10%), Postives = 188/409 (45.97%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGP-----NIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLH--------------DIL----QSSHQ-----YSFNKKTVKHSRDEIQFSNPHQM------DVGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLP 1307
            +P +PE++ +L      +Q+N  A++QH+ Y +  IK  +    GI  ++ LL+     +Q NA G +RNL  G       + ++   G   ++ ++    +S       + E    +L NLSSC    + ++   L      V++P  G    P     +L   S L       L   T  L+N+SS   E R  MR CEGL+DS+  II+   NT  ++++ VE+C+C +RNL Y L               D L     SS Q     +   KK  K S  + Q+     +        G +M LW+  ++  +L ++  S N  ++E A G++QNL+    + A   R   RK KGLP LV  +    D VV     ALRN++ D RN ELIG + +  ++  LP
Sbjct:  329 DPELPEVIRMLQHHFPSVQANAAAYIQHLCYGDNRIKAEVCRLGGIRHLVDLLDHKTLEVQRNACGALRNLVYGKATDDNKVCVRNSGGIPALVRLLRKTPDS------EVRELVTGVLWNLSSCDSVKMTITRDALGPLTNTVIIPHSGWGAAPQREDQKLKLHSSLV------LRNTTGCLRNLSSAGEEARRQMRCCEGLIDSLLYIIKTCVNTSDYDSKIVENCVCTLRNLSYRLELEMPPSRLMGTQDLDTLLGPDTSSKQADYSCWGLRKKKKKRSWQDQQWDGVGPIPGFSGSPKGAEM-LWHPSVVKPYLTLLAESSNPATLEGAAGSLQNLSAGTWRFASYIRAAVRKEKGLPILVELLRMDNDRVVCSVATALRNMALDARNKELIGKYAMRDLVTRLP 724          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Xenopus
Match: ARVCF (ARVCF, delta catenin family member [Source:NCBI gene;Acc:100038219])

HSP 1 Score: 157.532 bits (397), Expect = 2.426e-39
Identity = 119/390 (30.51%), Postives = 201/390 (51.54%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVG--------DQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P +PE++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP ++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  N     + ++ S  F    +  +  L+N+SS   E R  +R C+GL+D++   +Q + + +  +N++VE+C+CI+RNL Y +H  +  + ++  N+  +             + D G           LL+  E++ L+L I+  S+NY ++EAA GA+QNL+      +   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG + +  +++ LP 
Sbjct:  322 DPDLPEVIAMLNHPIDPVKSNAAAYLQHLCYENDKIKKDVRYLKGIPTLVGLLDHPKPEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTLTNEVIIPHSGWENEP--NEDSKPRDAEWSTVF----KNTSGCLRNVSSDGAEARRRLRECDGLVDALLHALQSAVSKKDTDNKSVENCVCIMRNLSYHVHKEVPGADRFQENE--LNQQGGIGGQQKKKKDDAGCFGGKKAKGFELLYQPEVVRLYLSILTESQNYNTLEAAAGALQNLSAGNWTWSTYIRATVRKERGLPVLVELLQSDSDKVVRAVAIALRNLSMDRRNKDLIGNYAMGQLVRNLPG 695          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Xenopus
Match: ARVCF (ARVCF, delta catenin family member [Source:NCBI gene;Acc:100038219])

HSP 1 Score: 151.754 bits (382), Expect = 1.911e-37
Identity = 120/418 (28.71%), Postives = 203/418 (48.56%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTV--------------------KHSRDEIQFSNPHQMDVGDQM----------------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P +PE++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP ++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  N     + ++ S  F +     +  L+N+SS   E R  +R C+GL+D++   +Q + + +  +N++VE+C+CI+RNL Y +H  +  + ++  N+                       K +++E         D                     LL+  E++ L+L I+  S+NY ++EAA GA+QNL+      +   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG + +  +++ LP 
Sbjct:  342 DPDLPEVIAMLNHPIDPVKSNAAAYLQHLCYENDKIKKDVRYLKGIPTLVGLLDHPKPEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTLTNEVIIPHSGWENEP--NEDSKPRDAEWSTVFKN----TSGCLRNVSSDGAEARRRLRECDGLVDALLHALQSAVSKKDTDNKSVENCVCIMRNLSYHVHKEVPGADRFQENELNQQGGIGGQQKKKKDDAGCFGGKKAKEEWFNQGKKNGDTDKNFDTLDLPKRSESAKGFELLYQPEVVRLYLSILTESQNYNTLEAAAGALQNLSAGNWTWSTYIRATVRKERGLPVLVELLQSDSDKVVRAVAIALRNLSMDRRNKDLIGNYAMGQLVRNLPG 745          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Xenopus
Match: ARVCF (ARVCF, delta catenin family member [Source:NCBI gene;Acc:100038219])

HSP 1 Score: 151.754 bits (382), Expect = 2.177e-37
Identity = 120/418 (28.71%), Postives = 203/418 (48.56%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTV--------------------KHSRDEIQFSNPHQMDVGDQM----------------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P +PE++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP ++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  N     + ++ S  F +     +  L+N+SS   E R  +R C+GL+D++   +Q + + +  +N++VE+C+CI+RNL Y +H  +  + ++  N+                       K +++E         D                     LL+  E++ L+L I+  S+NY ++EAA GA+QNL+      +   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG + +  +++ LP 
Sbjct:  387 DPDLPEVIAMLNHPIDPVKSNAAAYLQHLCYENDKIKKDVRYLKGIPTLVGLLDHPKPEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTLTNEVIIPHSGWENEP--NEDSKPRDAEWSTVFKN----TSGCLRNVSSDGAEARRRLRECDGLVDALLHALQSAVSKKDTDNKSVENCVCIMRNLSYHVHKEVPGADRFQENELNQQGGIGGQQKKKKDDAGCFGGKKAKEEWFNQGKKNGDTDKNFDTLDLPKRSESAKGFELLYQPEVVRLYLSILTESQNYNTLEAAAGALQNLSAGNWTWSTYIRATVRKERGLPVLVELLQSDSDKVVRAVAIALRNLSMDRRNKDLIGNYAMGQLVRNLPG 790          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Xenopus
Match: ARVCF (ARVCF, delta catenin family member [Source:NCBI gene;Acc:100038219])

HSP 1 Score: 151.369 bits (381), Expect = 2.300e-37
Identity = 120/418 (28.71%), Postives = 203/418 (48.56%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTV--------------------KHSRDEIQFSNPHQMDVGDQM----------------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P +PE++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP ++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  N     + ++ S  F    +  +  L+N+SS   E R  +R C+GL+D++   +Q + + +  +N++VE+C+CI+RNL Y +H  +  + ++  N+                       K +++E         D                     LL+  E++ L+L I+  S+NY ++EAA GA+QNL+      +   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG + +  +++ LP 
Sbjct:  322 DPDLPEVIAMLNHPIDPVKSNAAAYLQHLCYENDKIKKDVRYLKGIPTLVGLLDHPKPEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTLTNEVIIPHSGWENEP--NEDSKPRDAEWSTVF----KNTSGCLRNVSSDGAEARRRLRECDGLVDALLHALQSAVSKKDTDNKSVENCVCIMRNLSYHVHKEVPGADRFQENELNQQGGIGGQQKKKKDDAGCFGGKKAKEEWFNQGKKNGDTDKNFDTLDLPKRSESAKGFELLYQPEVVRLYLSILTESQNYNTLEAAAGALQNLSAGNWTWSTYIRATVRKERGLPVLVELLQSDSDKVVRAVAIALRNLSMDRRNKDLIGNYAMGQLVRNLPG 725          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Xenopus
Match: ARVCF (ARVCF, delta catenin family member [Source:NCBI gene;Acc:100038219])

HSP 1 Score: 151.369 bits (381), Expect = 2.355e-37
Identity = 119/413 (28.81%), Postives = 203/413 (49.15%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNK-------------------------------KTVKHSRDEIQFSNPHQMDVGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P +PE++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP ++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  N     + ++ S  F +     +  L+N+SS   E R  +R C+GL+D++   +Q + + +  +N++VE+C+CI+RNL Y +H  +  + ++  N+                                    + D +      +   G + LL+  E++ L+L I+  S+NY ++EAA GA+QNL+      +   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG + +  +++ LP 
Sbjct:  316 DPDLPEVIAMLNHPIDPVKSNAAAYLQHLCYENDKIKKDVRYLKGIPTLVGLLDHPKPEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTLTNEVIIPHSGWENEP--NEDSKPRDAEWSTVFKN----TSGCLRNVSSDGAEARRRLRECDGLVDALLHALQSAVSKKDTDNKSVENCVCIMRNLSYHVHKEVPGADRFQENELNQQGGIGGQQKKKKDDAGCFGGKKAKGKKNGDTDKNFDTLDLPKRSESAKGFE-LLYQPEVVRLYLSILTESQNYNTLEAAAGALQNLSAGNWTWSTYIRATVRKERGLPVLVELLQSDSDKVVRAVAIALRNLSMDRRNKDLIGNYAMGQLVRNLPG 713          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Mouse
Match: Arvcf (armadillo repeat gene deleted in velocardiofacial syndrome [Source:MGI Symbol;Acc:MGI:109620])

HSP 1 Score: 153.295 bits (386), Expect = 4.806e-38
Identity = 138/510 (27.06%), Postives = 235/510 (46.08%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS----------------------FNKKTVKH------SRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE IK  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    ++       + E     L NLSS     + +    L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                       F  K  K        +D     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P     +L+       LNT++ I   +S  L    SLL+      GV   + L++S
Sbjct:  276 RVVRRSPSVD---STRKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGIKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGIPGSTTSQRRRKDDASCFGGKKAKEEWFHQGKKDAEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWTWATYIRATVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDQRNKDLIGSYAMTELVR--------NVRNAQAPAHPSAHLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALVAS 749          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Mouse
Match: Arvcf (Armadillo repeat protein deleted in velo-cardio-facial syndrome homolog [Source:UniProtKB/Swiss-Prot;Acc:P98203])

HSP 1 Score: 152.91 bits (385), Expect = 6.142e-38
Identity = 138/510 (27.06%), Postives = 235/510 (46.08%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS----------------------FNKKTVKH------SRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE IK  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    ++       + E     L NLSS     + +    L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                       F  K  K        +D     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P     +L+       LNT++ I   +S  L    SLL+      GV   + L++S
Sbjct:  340 RVVRRSPSVD---STRKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGIKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGIPGSTTSQRRRKDDASCFGGKKAKEEWFHQGKKDAEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWTWATYIRATVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDQRNKDLIGSYAMTELVR--------NVRNAQAPAHPSAHLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALVAS 813          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Mouse
Match: Arvcf (Armadillo repeat protein deleted in velo-cardio-facial syndrome homolog [Source:UniProtKB/Swiss-Prot;Acc:P98203])

HSP 1 Score: 152.91 bits (385), Expect = 6.142e-38
Identity = 138/510 (27.06%), Postives = 235/510 (46.08%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS----------------------FNKKTVKH------SRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE IK  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    ++       + E     L NLSS     + +    L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                       F  K  K        +D     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P     +L+       LNT++ I   +S  L    SLL+      GV   + L++S
Sbjct:  340 RVVRRSPSVD---STRKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGIKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGIPGSTTSQRRRKDDASCFGGKKAKEEWFHQGKKDAEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWTWATYIRATVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDQRNKDLIGSYAMTELVR--------NVRNAQAPAHPSAHLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALVAS 813          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Mouse
Match: Arvcf (armadillo repeat gene deleted in velocardiofacial syndrome [Source:MGI Symbol;Acc:MGI:109620])

HSP 1 Score: 152.91 bits (385), Expect = 6.142e-38
Identity = 138/510 (27.06%), Postives = 235/510 (46.08%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS----------------------FNKKTVKH------SRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE IK  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    ++       + E     L NLSS     + +    L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                       F  K  K        +D     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P     +L+       LNT++ I   +S  L    SLL+      GV   + L++S
Sbjct:  340 RVVRRSPSVD---STRKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGIKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGIPGSTTSQRRRKDDASCFGGKKAKEEWFHQGKKDAEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWTWATYIRATVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDQRNKDLIGSYAMTELVR--------NVRNAQAPAHPSAHLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALVAS 813          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Mouse
Match: Arvcf (armadillo repeat gene deleted in velocardiofacial syndrome [Source:MGI Symbol;Acc:MGI:109620])

HSP 1 Score: 152.91 bits (385), Expect = 6.142e-38
Identity = 138/510 (27.06%), Postives = 235/510 (46.08%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS----------------------FNKKTVKH------SRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE IK  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    ++       + E     L NLSS     + +    L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                       F  K  K        +D     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P     +L+       LNT++ I   +S  L    SLL+      GV   + L++S
Sbjct:  340 RVVRRSPSVD---STRKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGIKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGIPGSTTSQRRRKDDASCFGGKKAKEEWFHQGKKDAEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWTWATYIRATVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDQRNKDLIGSYAMTELVR--------NVRNAQAPAHPSAHLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALVAS 813          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. UniProt/SwissProt
Match: sp|O00192|ARVC_HUMAN (Armadillo repeat protein deleted in velo-cardio-facial syndrome OS=Homo sapiens OX=9606 GN=ARVCF PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 3.624e-37
Identity = 138/511 (27.01%), Postives = 235/511 (45.99%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------------------FNKKTVKH------SRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE +K  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    ++       + E     L NLSS     + +    L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                        F  K  K        +D     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P   G  L+       LNT++ I   +S  L    SLL+      GV   + L++S
Sbjct:  338 RLVRRSPSVD---SARKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKEEWFHQGKKDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVR--------NVRNAQAPPRPGACLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALVAS 812          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. UniProt/SwissProt
Match: sp|P98203|ARVC_MOUSE (Armadillo repeat protein deleted in velo-cardio-facial syndrome homolog OS=Mus musculus OX=10090 GN=Arvcf PE=1 SV=2)

HSP 1 Score: 152.91 bits (385), Expect = 4.296e-37
Identity = 138/510 (27.06%), Postives = 235/510 (46.08%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS----------------------FNKKTVKH------SRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE IK  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    ++       + E     L NLSS     + +    L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                       F  K  K        +D     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P     +L+       LNT++ I   +S  L    SLL+      GV   + L++S
Sbjct:  340 RVVRRSPSVD---STRKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGIKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGIPGSTTSQRRRKDDASCFGGKKAKEEWFHQGKKDAEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWTWATYIRATVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDQRNKDLIGSYAMTELVR--------NVRNAQAPAHPSAHLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALVAS 813          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. UniProt/SwissProt
Match: sp|Q9U308|JAC1_CAEEL (Juxtamembrane domain-associated catenin OS=Caenorhabditis elegans OX=6239 GN=jac-1 PE=1 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 2.079e-35
Identity = 122/429 (28.44%), Postives = 200/429 (46.62%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGP-----NIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWL-EFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQ----YSFNKKTVKHSRDEIQFSNPHQMD----------VGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYS 1409
            +P + E+++ L++ + D Q N   +LQH+TY +  IKE  R   GIP ++ LL S    +Q NA   ++NLS G       + + +  G   I E++    ++S      + E  AA L NLSS  +    +  S      + V+ P L +              SD +  FGS L +  T  L+N+S+   + R  +R    L++++   +  +      ++ TVE+ +C++RNL Y + +++  ++     +S + K +KH             +          V    +LW   ++ L+L+++  S N  ++EA+ GA+QNLA C+   + E R   R  KGLP LV  +    D VV     ALRNL+ D RN ELIG + L   L  LP P  P    I D  + G  L I  E +  +  Y+
Sbjct:  690 DPSLKEVIEYLSSADKDKQLNASGYLQHLTYTDNQIKEETREYGGIPKLIALLRSDTPRIQKNACACLKNLSFGKENDANKLAVMEADGVRLIAEVLRTTHDAS------VKEEAAAALWNLSSADMLKPVILESATEILSQQVIAPVLAVGT------------SDPTRHFGSTLFKNSTGVLRNVSAASQQARRRLRDIPNLIEALVHFLTHAIQKSQVDSPTVENAVCLLRNLSYRIQEVVDPNYDPAAAHSSSSKNMKHVASPKPEKKKKDKEKKKDKNPKNIVTGPSVLWQPHVVKLYLKLLQDSSNIETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLAIDPRNRELIGKYALRDFLDKLPEPGSPRRSAISD-QTIGAVLGILFEIVRSSAAYT 1099          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. UniProt/SwissProt
Match: sp|Q8AXM9|CTND1_XENLA (Catenin delta-1 OS=Xenopus laevis OX=8355 GN=ctnnd1 PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 3.514e-35
Identity = 116/393 (29.52%), Postives = 188/393 (47.84%), Query Frame = 3
Query:  186 PGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGP----NIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDP-LTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQY---------------------SFNKKTVKHSRDEIQFSNPHQ-MDVGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGL 1283
            P +PE+L +L+     ++ N  A+LQH++Y NE++K  +   +GIP ++ LL  P   ++L A G ++NLS GP     + +K   G   +  ++  + E   G    L E     L NLSS     + L    L T  + +L+P  G   D  + +RV   +     + +   L   T  L+N+SS  +E R  MR CEGL+DSV  I++   +    +++ +E+ +C++RN+ Y +H  +  + +Y                        KK  + + D + F  P Q M      LL+  E++ L++ ++  S     +EA+ GA+QNL           R   R+ KGL SL  H+ +  + VV+    ALRNL  D RN ELIG H L
Sbjct:  288 PELPEVLAMLSYTLDAVRLNAAAYLQHLSYRNEDVKREVCRLRGIPPLISLLEDPRAPIRLAACGALKNLSYGPARENKMAVKNCDGVPALARLLRRRGEGIEGR--ELAECVTGTLWNLSSLDSVKMELVDQALYTLTQEILVPHSGWQQDGGMQDRV---EGKPRHVEWEPALVNTTGCLRNISSERSEARRKMRECEGLVDSVVHILRSEVSHGLVDSKLLENVVCLLRNISYHVHREIPHAEKYMESPQNASAETQNPSCFGVRRGKGKKASEEAVDTVDF--PKQTMPAQGYDLLFQPEIVRLYISLVKSSHTPAVLEASAGAIQNLCAGNWVYGRCIRAAVRQEKGLSSLADHLTHESERVVRAICGALRNLCGDNRNRELIGKHAL 673          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. UniProt/SwissProt
Match: sp|Q68FH0|PKP4_MOUSE (Plakophilin-4 OS=Mus musculus OX=10090 GN=Pkp4 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 9.800e-35
Identity = 119/420 (28.33%), Postives = 196/420 (46.67%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLL--QLNAAGVIRNLSNGPN-----IQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEF--VTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLH---------------DILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGDQM--------------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDI 1328
            +P +PE++ +L      +Q+N  A+LQH+ + +  +K  +    GI  ++ LL+  HR+L  Q NA G +RNL  G +     I +K   G   ++ ++   +++       + E    +L NLSSC    + +    LST    V++P  G +     +        D  I F + L     T  L+N+SS   E R  MR CEGL+DS+  +I    NT  ++++TVE+C+C +RNL Y L                D+L        ++ +    + + +   P Q D  D +              +LW+  ++  +L ++  S N  ++E + G++QNL+    K A   R   RK KGLP LV  +    D VV     ALRN++ D RN ELIG + +  ++  LP  + P I
Sbjct:  526 DPELPEVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVYRLGGIKHLVDLLD--HRVLEVQKNACGALRNLVFGKSTDENKIAMKNVGGIPALLRLLRKSIDA------EVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDD--------DHKIKFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSDYDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELDDLLGKESPSKDSEPSCWGKKKKKKKRTP-QEDQWDGVGPIPGLSKSPKGVEMLWHPSVVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNKELIGKYAMRDLVNRLPGGNGPSI 928          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. TrEMBL
Match: A0A481CDG3 (Armadillo repeat protein deleted in velo-cardio-facial syndrome OS=Sus scrofa OX=9823 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.946e-39
Identity = 147/539 (27.27%), Postives = 242/539 (44.90%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------------------FNKKTVKHSRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVW 1613
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE IK  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    +S       + E     L NLSS     + +    L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                        F  K  K  RD     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++ + S   P +         G  L   EE   +  + +I   +S  L    SLL+      GV   + L                G A  + +    A+ +LQ VW
Sbjct:   47 RAVRRSPSVD---SARKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGIKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDSDNKAAIRDCGGVPALVRLLRAARDSE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPHSGWEPEPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIVRNLSYHVHKEVPGADRYQEAEPGPPGGAVGSQRRRRDDAGCFGGKKAKGKRDGEVDHNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWVWATYIRATVRKERGLPVLVELLQSDTDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRSAQAPALP--------GARL---EEDTVVAVLNTIHEIVSDSLDNARSLLQA----RGVPALVAL----------------GSASQSAREAKAASHVLQTVW 533          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. TrEMBL
Match: A0A452EPW6 (ARVCF delta catenin family member OS=Capra hircus OX=9925 GN=ARVCF PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.199e-38
Identity = 140/499 (28.06%), Postives = 233/499 (46.69%), Query Frame = 3
Query:  135 PSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------------------FNKKTVKHSRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE +K  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    +S       + E     L NLSS     + +    L T    V++PS G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                        F  K  K  RD     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P   G  L+       LNT++ I   +S  L    SLL+      GV   + L +S
Sbjct:  337 PSAD---SARKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEAVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDADNKAAIRDCGGVPALVRLLRAARDSE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPSSGWEPEPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIVRNLSYHVHKEVPGAERYQEAEPGPPGGSGSAQRWSREDAGCFGGKKAKGKRDGEMDQNSDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWVWATYIRAAVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVR--------NVRSAQAPTRPGARLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALGAS 799          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. TrEMBL
Match: A0A452EPN7 (ARVCF delta catenin family member OS=Capra hircus OX=9925 GN=ARVCF PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.402e-38
Identity = 141/505 (27.92%), Postives = 234/505 (46.34%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------------------FNKKTVKHSRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R     PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE +K  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    +S       + E     L NLSS     + +    L T    V++PS G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                        F  K  K  RD     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++        +++    P   G  L+       LNT++ I   +S  L    SLL+      GV   + L +S
Sbjct:  331 RAARRSPSAD---SARKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEAVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDADNKAAIRDCGGVPALVRLLRAARDSE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPSSGWEPEPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIVRNLSYHVHKEVPGAERYQEAEPGPPGGSGSAQRWSREDAGCFGGKKAKGKRDGEMDQNSDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWVWATYIRAAVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVR--------NVRSAQAPTRPGARLEEDTVVAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALGAS 799          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. TrEMBL
Match: F6QX40 (ARVCF delta catenin family member OS=Bos taurus OX=9913 GN=ARVCF PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.486e-38
Identity = 143/508 (28.15%), Postives = 240/508 (47.24%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------------------FNKKTVKHSRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS---PSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE +K  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    +S       + E     L NLSS     + +    L T    V++P+ G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                        F  K  K  RD     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++ + S   P+RP ++  L+ D+             LNT++ I   +S  L    SLL+      GV   + L +S
Sbjct:  275 RVVRRSPSAD---SARKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEAVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDADNKAAIRDCGGVPALVRLLRAARDSE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPNSGWEPEPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIVRNLSYHVHKEVPGAERYQEAEPGPPGGSGSAQRRSREDAGCFGGKKAKGKRDGEMDQNSDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWVWATYIRAAVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRSAQAPARPGVR--LEEDTV---------VAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALGAS 743          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. TrEMBL
Match: E1BPV1 (ARVCF delta catenin family member OS=Bos taurus OX=9913 GN=ARVCF PE=4 SV=3)

HSP 1 Score: 164.851 bits (416), Expect = 1.528e-38
Identity = 143/508 (28.15%), Postives = 240/508 (47.24%), Query Frame = 3
Query:  117 RQIIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKEL----GKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------------------FNKKTVKHSRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS---PSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS 1511
            R +   PS D   S   +    +P +PE+L +L      +++N  A+LQH+ +ENE +K  +R  +G+PL++ LL+ P   ++  A G +RNLS G +   K  +    G   ++ ++    +S       + E     L NLSS     + +    L T    V++P+ G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +Y                        F  K  K  RD     N   +D+  +        LL+  E++ L+L ++  S+N+ ++EAA GA+QNL+      A   R   RK +GLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  +++ + S   P+RP ++  L+ D+             LNT++ I   +S  L    SLL+      GV   + L +S
Sbjct:  333 RVVRRSPSAD---SARKEPRWRDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEAVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSYGRDADNKAAIRDCGGVPALVRLLRAARDSE------VRELVTGTLWNLSSYEPLKMVIIDHGLQTLTHEVIVPNSGWEPEPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIVRNLSYHVHKEVPGAERYQEAEPGPPGGSGSAQRRSREDAGCFGGKKAKGKRDGEMDQNSDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWVWATYIRAAVRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRSAQAPARPGVR--LEEDTV---------VAVLNTIHEI---VSDSLDNARSLLQA----RGVPALVALGAS 801          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Cavefish
Match: arvcfa (armadillo repeat protein deleted in velo-cardio-facial syndrome homolog [Source:NCBI gene;Acc:103031401])

HSP 1 Score: 147.902 bits (372), Expect = 1.598e-36
Identity = 141/525 (26.86%), Postives = 238/525 (45.33%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQS-----SHQYSFNKKTVKH--SRDEIQ-----------FSNPHQMDVGDQM-----------------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS-PSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSF----ISFLLQANESLLEVFVKRNG-----VKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAA 1592
            +P + E++ +L+     ++SN  A+LQH+ YEN+ +K+ +R  +GIP+++ L++ P   +   A G +RN+S G +    + IK   G   ++ ++    +SS   +  LV      L NLSS     + + +  L T    +++P  G+  DP               T     E+ T+F      L+N+SS   E R  +R CEGL+D++   +  +      NN++VE+C+CI+RNL Y +H  +       SH  +   K   H   +DE             F+   +    D+                  LL+  E++ L+L ++  S N  ++EAA GA+QNL+  +   +   R   RK KGLP LV  + +  D VV+   +ALRNL+ D +N +LIG++ +  ++  LPS   RP            +NLD       LNT++ I +       FL+Q       V + R        K   ++L +   Y+D       G    A+  PV++ 
Sbjct:  305 DPNLREVIAMLSHPMDPVKSNAAAYLQHLCYENDKVKQDVRQLRGIPVLVGLMDHPKPEVYRKACGALRNISFGRDHFNKVAIKNSDGIPALLRLLR---KSSDMEVRELV---TGTLWNLSSHEPLKMVVINHGLQTLTDEIIIPHSGLRGDPN------------DPTRPGDPEWTTVFKNTSGCLRNVSSDGAEARQRLRECEGLVDALLHALYSAVAKRDMNNKSVENCVCILRNLSYHVHKEVPGAERFYSHPAAPTTKPRSHPKKKDETDCFGGRGTKEEWFNQCRKHGASDKSYSTLEMPKRTLPTKGLELLYQPEVVRLYLSLLKLSHNQNTLEAAAGALQNLSAGQWAWSNYIRATVRKEKGLPILVELLHSDADKVVRAIAIALRNLAIDHKNKDLIGSYAMRDLVSNLPSGQQRP-----------AKNLDGDTVVAILNTIHEIITDNLENARFLIQGQGVQKLVSINRTSQSVRETKAASHVLQAVWAYKDLRHTLTKGGWNKAHFKPVVSG 800          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Cavefish
Match: pkp4 (plakophilin 4 [Source:ZFIN;Acc:ZDB-GENE-120411-14])

HSP 1 Score: 144.821 bits (364), Expect = 1.741e-35
Identity = 118/409 (28.85%), Postives = 187/409 (45.72%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGP-----NIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLH--------------DIL----QSSHQ-----YSFNKKTVKHSRDEIQFSNPHQM------DVGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLP 1307
            +P +PE++ +L      +Q+N  A++QH+ Y +  IK  +    GI  ++ LL+     +Q +A G +RNL  G       + ++   G   ++ ++    E+       + E    +L NLSSC    + +    L      V++P  G    P     +L   S L       L   T  L+N+SS   E R  MR CEGL+DS+  II+   NT  F+++ VE+C+C +RNL Y L               D L     S+ Q     +   KK  K S  + Q+     +        G +M LW+  ++  +L ++  S N  ++E A G++QNL+    + A   R   RK KGLP LV  +    D VV     ALRN++ D RN ELIG + +  ++  LP
Sbjct:  174 DPELPEVIRMLQHHFPSVQANAAAYVQHLCYRDNRIKSEVCRLGGIQHLVDLLDHKTLEVQRSACGALRNLVFGKATDDNKVCVRNAGGIPALLRLLRKTAETE------VRELVTGVLWNLSSCDSVKMTIVRDALGPLTNTVIIPHSGWGAAPQREDHKLKLHSSLV------LRNTTGCLRNLSSAGEEARRQMRCCEGLIDSLLYIIKTCINTSDFDSKIVENCVCTLRNLSYRLELEMPPSRLMGTQDLDTLLGNDPSNKQVDYSCWGLRKKKKKRSWQDQQWDGVGPIPGFSGSPKGAEM-LWHPSVVKPYLTLLAESSNPATLEGAAGSLQNLSAGSWRFAAYIRAAVRKEKGLPILVELLRMDNDRVVCSVATALRNMALDARNKELIGKYAMPDLVTRLP 569          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Cavefish
Match: ctnnd2b (catenin (cadherin-associated protein), delta 2b [Source:ZFIN;Acc:ZDB-GENE-070912-532])

HSP 1 Score: 139.813 bits (351), Expect = 7.901e-34
Identity = 122/436 (27.98%), Postives = 195/436 (44.72%), Query Frame = 3
Query:  123 IIFQPSTD*SVSEMTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLN--AAGVIRNLSNGP-----NIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNK-----------------------KTVKHSRDEIQFSNPHQMDVGDQ----MLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEE-------FRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLP 1307
            ++  PS D    +  +    +P +PE++ +L      +QSN  A+LQH+ + +  IK  IR + GI L++ LL+  HR+  ++  A G +RNL  G       I +K   G   ++ ++    +        + E    +L NLSSC    + +    L+     +++P  G    PL +  +L       +     L   T  L+N+SS   E R  MR CEGL D++  +IQ +  +   +++T+E+C+CI+RNL Y L        Q    +                       K  K S D+     P   D GD      +LW+  ++  +L +++   N  ++E A GA+QNLA    KV           R   RK KGLP LV  +    D VV     ALRN++ D RN ELIG + +  ++  LP
Sbjct:  248 LVRSPSVDSIQKDPREFGWRDPELPEVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKSEIRRQGGIQLLVDLLD--HRMTDVHRSACGALRNLVYGKANDDNKIALKNCGGIPALVRLLRKTTDV------EIRELLTGVLWNLSSCDALKMPIIQDALAVLTNTIIIPHSGWDSSPLQDERKLH------LHSSQVLRNATGCLRNVSSAGEEARRRMRECEGLTDALLYVIQTALGSSEIDSKTIENCVCILRNLSYRLAAETSQGQQLGSEELDGVLCTDASGKDAESSGCWGKKKKKKKSHDQWDGVGPFP-DSGDPPKGLQMLWHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKVGPTPKPWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLP 668          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Cavefish
Match: ctnnd1 (catenin delta 1 [Source:NCBI gene;Acc:103033760])

HSP 1 Score: 138.272 bits (347), Expect = 2.144e-33
Identity = 131/516 (25.39%), Postives = 231/516 (44.77%), Query Frame = 3
Query:  171 SSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------FNKKT----VKHSRDEIQFSNPHQMDVG---------------DQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAG-ILQLVW 1613
            +S  +P +PE++ +L      ++SN  A+LQH+T++N+ +K  +R  KGIP ++ +L++P + +  +A G ++N+S G +    I IK   G   ++ ++    +        L +     L NLSS     + +    L      V++P  G       N           + + + L      L+N+SS   E R  +R C GL+DS+  I+Q   N +  +N+ VE+ +C++RNL Y +H  +    +Y             N+KT     +  +DE  FS   + D G                  LL+  E++ ++  ++  SKN   +EAA GAVQNL   +       R   R+ KGLP +   + +G D VV+    +LRNL+ D RN EL+G H + +++  LP                GQ+  +R   LS  T+ S+ S ++ ++ ++    +      G++  + +                 +  N +   V  AG +LQ+VW
Sbjct:  272 ASWRQPELPEVIAMLNYRLDPVKSNAAAYLQHLTFKNDKVKSEVRRLKGIPALVSMLDNPKKEVHHSACGALKNISYGRDPDNKIAIKNCDGIPALVRLLRKTRDQD------LTDTITGTLWNLSSHDSVKMEIVDHALHALSDEVMVPHSGWE---RGNDGGEESCKPRHLEWETALTNTAGCLRNVSSERIEARRKLRECSGLVDSLMYIVQSQINCKDVDNKLVENSVCLLRNLSYQVHREVPGCERYQETAPVNQGPTPANQKTGCFSSRKGKDEW-FSKGRKDDDGTLDTIDIPKRTTPAKGYELLFQPEVVRVYTSLLRESKNPSVLEAAAGAVQNLCAGRWTYGRYIRAVMRQEKGLPMMTELLAHGNDRVVRAMSGSLRNLAIDARNRELLGKHAVPNLVANLP--------------GGGQSQPVRA--LSEETVVSVLSTLAEVVGSSVDSAKTLRSSQGIERLVLI----------------NKEGNRSDREVRGAGLVLQIVW 745          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Cavefish
Match: arvcfb (ARVCF delta catenin family member b [Source:ZFIN;Acc:ZDB-GENE-060526-60])

HSP 1 Score: 137.887 bits (346), Expect = 2.668e-33
Identity = 120/413 (29.06%), Postives = 197/413 (47.70%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSI-IQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------------------FNKKTVKHSRDEIQFSNPHQMDVGDQM-------LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P +PE++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP+++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  +     K  D         E+ T+F KN S              G L +V+S   + +   +  +N++VE+C+CI+RNL Y +H  +  + ++                        F  K  K  R+     N   +D+  +        LL+  E++ L+L ++  S+NY ++EAA GA+QNL+  +   +   R   RK KGLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  ++  LPS
Sbjct:  303 DPDLPEVIAMLGHPIDPVKSNAAAYLQHLCYENDKIKKDVRQLKGIPVLVGLLDHPKAEVHRKACGALRNISYGKDNDNKVAIKNCDGIPALIRLLRKTNDME--------VRELVTGTLWNLSSYEPLKMVIINHGLQTMTNEVIIPHSGWEPEPNED----SKPRD--------AEWTTVF-KNTS--------------GCLRNVSSDGAESAVGKKDMDNKSVENCVCIMRNLSYHVHKEVPGADKFQDPSGLQAPGSAGPQRKKKDDAGCFGGKKAKGRRNGENDKNYDTLDLPKRTEPTKGYELLYQPEVVRLYLSLLTESQNYNTLEAAAGALQNLSAGQWTWSNYIRATVRKEKGLPILVELLRSDSDKVVRAVAIALRNLSIDRRNKDLIGSYAMRDLVSNLPS 680          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008642.1 (pep scaffold:Pmarinus_7.0:GL477625:357396:400748:1 gene:ENSPMAG00000007810.1 transcript:ENSPMAT00000008642.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 5.266e-35
Identity = 124/425 (29.18%), Postives = 193/425 (45.41%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFG---SWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS-----------------------------------------FNKKTVKHSRDEIQFSN----PHQMDV--GDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLP 1307
            +P + E++ +L      IQ N  A+LQH+ Y + NIK  +R   GIPL++ LL  P   +Q NA G ++NL  G N   KK L +   +  +   +  +  +  + +     +L NLSSC    +A+    LS  V  V++P  G++ D  +    L      S T G     L   T  L+NMSS   E R  MR C+GL++S+  II+   +TE    + VE+C+C++RNL Y L       H ++                                         + KK  K   DE Q+      P   D   G + L  +  +++ +L ++    N  ++E A GA+QNLA    K+++  R   R+ KGLP LV  +    D VV     ALRN++ D  + ELIG + +  ++Q LP
Sbjct:    7 DPDLLEVIQMLQHNLPSIQGNAAAYLQHLCYRDSNIKTEVRRLGGIPLLVDLLGHPKADVQKNACGSLKNLVYG-NDDNKKALRQAGGVPALATLLRRTGDAELQELATTTGLLWNLSSCEALKMAMVTDALSALVASVVVPCAGLARDGESASAPLA-----SPTQGIQSQVLRNATGCLRNMSSAGEEARRQMRECDGLVESLLHIIETCLDTEDVGGKVVENCVCVLRNLSYRLAAETLRGHDWASGGGSGGGTSAQDGGAAGPGGGGGAGGGRTGRARQKEKPSCWGKKRKKKPLDE-QWDGVGPIPECPDPPRGPERLF-HPSVVNPYLGLLKKCANPATLEGAAGALQNLAAGGWKLSKYVRAMVRREKGLPVLVELLRMDSDRVVCAVATALRNMAMDVLSKELIGKYAMRDLVQRLP 423          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004698.1 (pep scaffold:Pmarinus_7.0:GL479318:180257:182606:1 gene:ENSPMAG00000004277.1 transcript:ENSPMAT00000004698.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.792e-11
Identity = 47/141 (33.33%), Postives = 65/141 (46.10%), Query Frame = 3
Query:  516 AILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLH--------DILQSSHQY 914
              L NLSSC      L H  L   V   ++P  G  V  + N +     SD  I + +     T  L+N+SS   E R  MR CEGL++S++   + +  +     RTVE+C+C +RNL Y L         DILQ    Y
Sbjct:  115 GALWNLSSCEELKQQLLHEVLDPLVERGVVPHSG--VGNVANTLN----SDPEIFYNA-----TGCLRNLSSAGVEARKQMRECEGLVESLSLFTENAVTSGKLEERTVENCVCTLRNLSYQLGEEAPNRYADILQEPPSY 244          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Nematostella
Match: EDO39592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9K2])

HSP 1 Score: 121.324 bits (303), Expect = 3.782e-29
Identity = 109/410 (26.59%), Postives = 184/410 (44.88%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLS-----NGPNIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDL--SITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVG-----------DQ-------------MLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSR 1319
            EP + +L++ L T ++++  N   ++QH+ Y +E +K  IR   GIP ++ LLN  H  +   AA  +RN+S     +   + I +  G E ++ +++   +        + E    +L NLSSC      +   CL   V  +++P  G   +       LF+       I + +     +  L+N+SS   E R  MR C GL+D    I+         +N++VE+ +C++RNL Y L D +             +  +D++   +P     G           D+              LLW  E++  +L I+  + N  ++E   GA+ NL  C  + A   R   RK KGLP LV  +    D VV+     LRNL+ D RN +LIG + +  +++ LP P +
Sbjct:    1 EPDLQDLIEYLQTDDINLVVNSAYYIQHLCYNDEAVKGKIRELGGIPALVHLLNHDHYEVHRAAASCLRNVSFSKERDENKLAIAECDGIETLLRLLQRTPKDE------VKELVLGVLWNLSSCEALKYRIIRLCLIIIVTTIIIPYSGWDKN-------LFQSGKPIPPIKWSTVFRNASGILRNLSSAGLEARREMRACAGLVDCFVWIVHAPIGKSDVDNKSVENSVCVLRNLSYRLEDEIDRELHPDAPLPNEEKKKDKVASEHPPSCFAGCGGMRKGKAPKDKKEPTVKRDPVEGVALLWQPEIVKPYLSIMAEASNPETLEGVAGALHNLMACDWRWAVVIRSAVRKDKGLPILVELLRIDNDPVVRAVATCLRNLAIDPRNKDLIGKYAMRDLVRRLPDPEK 397          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Nematostella
Match: EDO49843 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RES5])

HSP 1 Score: 103.605 bits (257), Expect = 2.381e-23
Identity = 114/513 (22.22%), Postives = 210/513 (40.94%), Query Frame = 3
Query:  186 PGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN-----IQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFV---TLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDIL----QSSHQYSFNKKTVKHSRDE----------------------------------------------IQFSNPHQMDVGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS--PSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERS 1544
            P IP+LLD + +GNVD   +   +LQH+ Y ++++K  +R+  GIP+++  L+  +  ++  AA V+RNLS+G       ++I    G E++IE+++   +  S              C L                  +  +++ +       +  R       D     G W E +   T  ++N+SS   + R+ MR  E L+D +  II+ S   + +N+  VE+C+C +RNL Y L   L     +  +   +K  VK  + +                                              I F N  Q       LL+    +  +  ++  +KN  ++E + GA+ NL  C  K A + R + R+ + +P+++  +    D  ++ + + LRNLS D  N  +IG  G   ++  LP+  P  P +                   ++  T+ SI   +  L Q +E   ++  K  G++  + +  S   Y D + R+
Sbjct:    2 PDIPDLLDYMQSGNVDKMIHAGFYLQHLCYNDDDVKNKVRILGGIPIVVRCLSHQNDQVRFAAACVLRNLSSGTKSDQNKLEIADCDGIEKLIEMLQRSDKPES--------------CELGFVLQTLRLRILRLCLHMLVIIIIKTYSGWDRNVAQR-------DPPKMDGQWSELLRHATRIVRNLSSAGLQAREDMRNEEYLIDCLVWIIRTSVKNKNWNDECVENCVCTMRNLSYRLESELDRDIHTDDEVQLDKAVVKEQQSQGCFAGCGGGKSKKKKKNAKNSDMSPMTNKVKSCTQKILVKERRRFIISFGNTLQF--FGAALLYQGTTVRQYFILLKNAKNNETLEGSAGALHNLTACSWKWAIKIRGDTRREQVIPNVISLLRIDYDPTIRASAILLRNLSVDRENKRIIGEKGTGPLVNRLPTGEPREPRV-------------------INDATIVSIMCALYQLGQKSEKNAKILRKTTGIRRMVRIAKSQERYDDRVVRT 472          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Medaka
Match: ARVCF (ARVCF delta catenin family member [Source:NCBI gene;Acc:101156416])

HSP 1 Score: 160.614 bits (405), Expect = 1.697e-40
Identity = 123/399 (30.83%), Postives = 203/399 (50.88%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGDQ-----------MLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P + E++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP+++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + +  F   +   +      + PH+    D             LL+  E++ L+L ++  S+NY ++EAA GA+QNL+  +   +   R   RK KGLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  ++  LPS
Sbjct:  449 DPDLSEVIAMLGHPIDPVKSNAAAYLQHLCYENDKIKKDVRQLKGIPVLVGLLDHPKSEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTMTNEVIIPHSGWEHEPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGKKDMDNKSVENCVCIMRNLSYHVHKEVPGAER--FQDPSAPQAPGS---AGPHRKKKDDAGCFGGKKAKGFELLYQPEVVRLYLSLLTESQNYNTLEAAAGALQNLSAGQWMWSNYIRATVRKEKGLPVLVELLRSDSDKVVRAVAIALRNLSIDRRNKDLIGSYAMRDLVSNLPS 822          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Medaka
Match: ARVCF (ARVCF delta catenin family member [Source:NCBI gene;Acc:101156416])

HSP 1 Score: 152.525 bits (384), Expect = 5.941e-38
Identity = 121/418 (28.95%), Postives = 207/418 (49.52%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS---------------------------------FN--KKTVKHSRDEIQFSNPHQMDVGDQM-LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P + E++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP+++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  N     + ++ +  F +     +  L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + ++                                  FN  KK  ++ ++      P + +      LL+  E++ L+L ++  S+NY ++EAA GA+QNL+  +   +   R   RK KGLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  ++  LPS
Sbjct:  315 DPDLSEVIAMLGHPIDPVKSNAAAYLQHLCYENDKIKKDVRQLKGIPVLVGLLDHPKSEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTMTNEVIIPHSGWEHEP--NEDSKPRDAEWTTVFKN----TSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGKKDMDNKSVENCVCIMRNLSYHVHKEVPGAERFQDPSAPQAPGSAGPHRKKKDDAGCFGGKKAKEEWFNQGKKNGENDKNYDTLDLPKRTEPSKGFELLYQPEVVRLYLSLLTESQNYNTLEAAAGALQNLSAGQWMWSNYIRATVRKEKGLPVLVELLRSDSDKVVRAVAIALRNLSIDRRNKDLIGSYAMRDLVSNLPS 718          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Medaka
Match: ARVCF (ARVCF delta catenin family member [Source:NCBI gene;Acc:101156416])

HSP 1 Score: 152.525 bits (384), Expect = 6.511e-38
Identity = 124/424 (29.25%), Postives = 207/424 (48.82%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS---------------------------------FN--KKTVKHSRDEIQFSNPHQMDVGDQM-LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P + E++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP+++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  +     K  D         E+ T+F      L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + ++                                  FN  KK  ++ ++      P + +      LL+  E++ L+L ++  S+NY ++EAA GA+QNL+  +   +   R   RK KGLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  ++  LPS
Sbjct:  340 DPDLSEVIAMLGHPIDPVKSNAAAYLQHLCYENDKIKKDVRQLKGIPVLVGLLDHPKSEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTMTNEVIIPHSGWEHEPNED----SKPRDA--------EWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGKKDMDNKSVENCVCIMRNLSYHVHKEVPGAERFQDPSAPQAPGSAGPHRKKKDDAGCFGGKKAKEEWFNQGKKNGENDKNYDTLDLPKRTEPSKGFELLYQPEVVRLYLSLLTESQNYNTLEAAAGALQNLSAGQWMWSNYIRATVRKEKGLPVLVELLRSDSDKVVRAVAIALRNLSIDRRNKDLIGSYAMRDLVSNLPS 743          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Medaka
Match: arvcfa (armadillo repeat protein deleted in velo-cardio-facial syndrome homolog [Source:NCBI gene;Acc:101157472])

HSP 1 Score: 152.14 bits (383), Expect = 7.304e-38
Identity = 121/394 (30.71%), Postives = 203/394 (51.52%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLF------LKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLH------DILQSSHQ---YSFNKKTVKHSRDEIQFSNPHQMDVGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLP 1307
            +P + E++ +L+     ++SN  A+LQH+ YEN+ IK+ +R   G+P+++ LL+ P   +   A G +RN+S G +    I IK   G + ++ ++    +SSS  +  L       L NLSS     + + +  L T    +++P  G          R    +D S    +  E+ T+F      L+N+SS   E R  +R CEGL+ ++   +Q +   +  +N++VE+C+CI+RNL Y +H      + LQ  H     S   +  K+  D +    P  ++     LL+  E++ L+L ++  S N+ ++EAA GA+QNLA  +   +   RV  RK KGLP LV  + +  D VV+   +ALRNL+ D RN +LI  + L  ++  LP
Sbjct:  314 DPNLHEVISMLSHPLDPVKSNAAAYLQHLCYENDRIKQEVRQLNGVPILVALLDHPKAEVHRKACGALRNISYGKDHNNKIAIKNCGGIQALVRLLR---KSSSMEVKELA---TGTLWNLSSHEPLKMMVINQGLQTLTDEIIIPHSGW---------RRRDSADSSKLQSA--EWTTVFKNTSGCLRNVSSDGAEARQRLRECEGLVAALLHALQSAVINKDTDNKSVENCVCILRNLSYHVHKEVPGTERLQEPHACHLRSVGLQKKKNEPDSLAGKRPKGLE-----LLYQPEVVRLYLSLLTCSHNHNTLEAAAGALQNLAAGQWAWSSYIRVTVRKEKGLPVLVELLRSDVDKVVRAVAIALRNLAIDKRNKDLIANYALRELVGNLP 685          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Medaka
Match: ARVCF (ARVCF delta catenin family member [Source:NCBI gene;Acc:101156416])

HSP 1 Score: 152.525 bits (384), Expect = 7.703e-38
Identity = 121/418 (28.95%), Postives = 207/418 (49.52%), Query Frame = 3
Query:  183 EPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPN----IQIKKELGKERIIEIIE--NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYS---------------------------------FN--KKTVKHSRDEIQFSNPHQMDVGDQM-LLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPS 1310
            +P + E++ +L      ++SN  A+LQH+ YEN+ IK+ +R  KGIP+++ LL+ P   +   A G +RN+S G +    + IK   G   +I ++   N ME        + E     L NLSS     + + +  L T    V++P  G   +P  N     + ++ +  F +     +  L+N+SS   E R  +R CEGL+D++   +Q +   +  +N++VE+C+CI+RNL Y +H  +  + ++                                  FN  KK  ++ ++      P + +      LL+  E++ L+L ++  S+NY ++EAA GA+QNL+  +   +   R   RK KGLP LV  + +  D VV+   +ALRNLS D RN +LIG++ +  ++  LPS
Sbjct:  449 DPDLSEVIAMLGHPIDPVKSNAAAYLQHLCYENDKIKKDVRQLKGIPVLVGLLDHPKSEVHRKACGALRNISYGKDNENKVAIKNCDGIPALIRLLRKTNDME--------VRELITGTLWNLSSYEPLKMVIINHGLQTMTNEVIIPHSGWEHEP--NEDSKPRDAEWTTVFKN----TSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAVGKKDMDNKSVENCVCIMRNLSYHVHKEVPGAERFQDPSAPQAPGSAGPHRKKKDDAGCFGGKKAKEEWFNQGKKNGENDKNYDTLDLPKRTEPSKGFELLYQPEVVRLYLSLLTESQNYNTLEAAAGALQNLSAGQWMWSNYIRATVRKEKGLPVLVELLRSDSDKVVRAVAIALRNLSIDRRNKDLIGSYAMRDLVSNLPS 852          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Planmine SMEST
Match: SMESG000072739.1 (SMESG000072739.1)

HSP 1 Score: 1141.72 bits (2952), Expect = 0.000e+0
Identity = 588/595 (98.82%), Postives = 593/595 (99.66%), Query Frame = 3
Query:  162 MTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVWXXXXXXXXXXXXXXGCEDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHLPKIIVTRDEEDPDRADDNGYQGPFQKSQTGKETPNSRRLNDTLEP 1946
            MTQSSTLEPGIPELLD+LATGNVDIQSNVLAFLQHITY+NENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPNIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDL+ITFGSWLEFVTLFLKNMSSGPNETRD+MRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVG QMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSK+AEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSI SFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVWEKSKYSKKFKKEKFGCEDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHLPKIIVTRDEEDPDRADDNGYQGPFQKSQTGKETPNSRRLNDTLEP
Sbjct:    1 MTQSSTLEPGIPELLDVLATGNVDIQSNVLAFLQHITYDNENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPNIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLNITFGSWLEFVTLFLKNMSSGPNETRDMMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGGQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKLAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSILSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVWEKSKYSKKFKKEKFGCEDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHLPKIIVTRDEEDPDRADDNGYQGPFQKSQTGKETPNSRRLNDTLEP 595          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Planmine SMEST
Match: SMESG000072739.1 (SMESG000072739.1)

HSP 1 Score: 1141.72 bits (2952), Expect = 0.000e+0
Identity = 588/595 (98.82%), Postives = 593/595 (99.66%), Query Frame = 3
Query:  162 MTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVWXXXXXXXXXXXXXXGCEDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHLPKIIVTRDEEDPDRADDNGYQGPFQKSQTGKETPNSRRLNDTLEP 1946
            MTQSSTLEPGIPELLD+LATGNVDIQSNVLAFLQHITY+NENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPNIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDL+ITFGSWLEFVTLFLKNMSSGPNETRD+MRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVG QMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSK+AEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSI SFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVWEKSKYSKKFKKEKFGCEDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHLPKIIVTRDEEDPDRADDNGYQGPFQKSQTGKETPNSRRLNDTLEP
Sbjct:    1 MTQSSTLEPGIPELLDVLATGNVDIQSNVLAFLQHITYDNENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPNIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLNITFGSWLEFVTLFLKNMSSGPNETRDMMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGGQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKLAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSILSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVWEKSKYSKKFKKEKFGCEDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHLPKIIVTRDEEDPDRADDNGYQGPFQKSQTGKETPNSRRLNDTLEP 595          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Planmine SMEST
Match: SMESG000072739.1 (SMESG000072739.1)

HSP 1 Score: 1135.55 bits (2936), Expect = 0.000e+0
Identity = 588/598 (98.33%), Postives = 593/598 (99.16%), Query Frame = 3
Query:  162 MTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIK---KELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVWXXXXXXXXXXXXXXGCEDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHLPKIIVTRDEEDPDRADDNGYQGPFQKSQTGKETPNSRRLNDTLEP 1946
            MTQSSTLEPGIPELLD+LATGNVDIQSNVLAFLQHITY+NENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPNIQIK   KELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDL+ITFGSWLEFVTLFLKNMSSGPNETRD+MRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVG QMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSK+AEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSI SFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVWEKSKYSKKFKKEKFGCEDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHLPKIIVTRDEEDPDRADDNGYQGPFQKSQTGKETPNSRRLNDTLEP
Sbjct:    1 MTQSSTLEPGIPELLDVLATGNVDIQSNVLAFLQHITYDNENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPNIQIKTLLKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLNITFGSWLEFVTLFLKNMSSGPNETRDMMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGGQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKLAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSILSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVWEKSKYSKKFKKEKFGCEDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHLPKIIVTRDEEDPDRADDNGYQGPFQKSQTGKETPNSRRLNDTLEP 598          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Planmine SMEST
Match: SMESG000072739.1 (SMESG000072739.1)

HSP 1 Score: 1044.65 bits (2700), Expect = 0.000e+0
Identity = 543/550 (98.73%), Postives = 548/550 (99.64%), Query Frame = 3
Query:  162 MTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGDQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVWXXXXXXXXXXXXXXGCEDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHL 1811
            MTQSSTLEPGIPELLD+LATGNVDIQSNVLAFLQHITY+NENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPNIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDL+ITFGSWLEFVTLFLKNMSSGPNETRD+MRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVG QMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSK+AEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSI SFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVWEKSKYSKKFKKEKFGCEDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHL
Sbjct:    1 MTQSSTLEPGIPELLDVLATGNVDIQSNVLAFLQHITYDNENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPNIQIKKELGKERIIEIIENQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPSLGMSVDPLTNRVRLFKISDLNITFGSWLEFVTLFLKNMSSGPNETRDMMRMCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQYSFNKKTVKHSRDEIQFSNPHQMDVGGQMLLWNSEMIDLFLEIINFSKNYLSIEAAIGAVQNLACCKSKLAEEFRVNFRKRKGLPSLVMHVINGPDIVVKVAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQNLDIREEYLSLNTMYSILSFISFLLQANESLLEVFVKRNGVKICIYLLSSDLFYQDHLERSNSGQAENANKLPVIAAGILQLVWEKSKYSKKFKKEKFGCEDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHL 550          
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Planmine SMEST
Match: SMESG000072739.1 (SMESG000072739.1)

HSP 1 Score: 139.428 bits (350), Expect = 5.926e-39
Identity = 85/87 (97.70%), Postives = 87/87 (100.00%), Query Frame = 3
Query:  162 MTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEXXXXXXXXXXXXXXXNSPHRLLQLNAAGVIRNLSNGPNIQIK 422
            MTQSSTLEPGIPELLD+LATGNVDIQSNVLAFLQHITY+NENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPNIQIK
Sbjct:    1 MTQSSTLEPGIPELLDVLATGNVDIQSNVLAFLQHITYDNENIKEIIRLKKGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPNIQIK 87          
The following BLAST results are available for this feature:
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARVCF5.706e-3827.01ARVCF delta catenin family member [Source:HGNC Sym... [more]
ARVCF7.546e-3827.01ARVCF delta catenin family member [Source:HGNC Sym... [more]
ARVCF7.999e-3826.73ARVCF delta catenin family member [Source:HGNC Sym... [more]
ARVCF1.191e-3726.73ARVCF delta catenin family member [Source:HGNC Sym... [more]
PKP45.879e-3528.10plakophilin 4 [Source:HGNC Symbol;Acc:HGNC:9026][more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jac-11.072e-3628.44Juxtamembrane domain-associated catenin [Source:U... [more]
jac-11.114e-3628.44Juxtamembrane domain-associated catenin [Source:U... [more]
jac-11.114e-3628.44Juxtamembrane domain-associated catenin [Source:U... [more]
jac-11.259e-3628.44Juxtamembrane domain-associated catenin [Source:U... [more]
jac-11.634e-3628.44Juxtamembrane domain-associated catenin [Source:U... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
p120ctn4.096e-3026.56gene:FBgn0260799 transcript:FBtr0111114[more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arvcfb6.058e-4129.90ARVCF delta catenin family member b [Source:ZFIN;A... [more]
arvcfb6.058e-4129.90ARVCF delta catenin family member b [Source:ZFIN;A... [more]
arvcfb1.232e-3929.48ARVCF delta catenin family member b [Source:ZFIN;A... [more]
arvcfb1.489e-3929.48ARVCF delta catenin family member b [Source:ZFIN;A... [more]
pkp41.338e-3629.10plakophilin 4 [Source:ZFIN;Acc:ZDB-GENE-120411-14][more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARVCF2.426e-3930.51ARVCF, delta catenin family member [Source:NCBI ge... [more]
ARVCF1.911e-3728.71ARVCF, delta catenin family member [Source:NCBI ge... [more]
ARVCF2.177e-3728.71ARVCF, delta catenin family member [Source:NCBI ge... [more]
ARVCF2.300e-3728.71ARVCF, delta catenin family member [Source:NCBI ge... [more]
ARVCF2.355e-3728.81ARVCF, delta catenin family member [Source:NCBI ge... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arvcf4.806e-3827.06armadillo repeat gene deleted in velocardiofacial ... [more]
Arvcf6.142e-3827.06Armadillo repeat protein deleted in velo-cardio-fa... [more]
Arvcf6.142e-3827.06Armadillo repeat protein deleted in velo-cardio-fa... [more]
Arvcf6.142e-3827.06armadillo repeat gene deleted in velocardiofacial ... [more]
Arvcf6.142e-3827.06armadillo repeat gene deleted in velocardiofacial ... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O00192|ARVC_HUMAN3.624e-3727.01Armadillo repeat protein deleted in velo-cardio-fa... [more]
sp|P98203|ARVC_MOUSE4.296e-3727.06Armadillo repeat protein deleted in velo-cardio-fa... [more]
sp|Q9U308|JAC1_CAEEL2.079e-3528.44Juxtamembrane domain-associated catenin OS=Caenorh... [more]
sp|Q8AXM9|CTND1_XENLA3.514e-3529.52Catenin delta-1 OS=Xenopus laevis OX=8355 GN=ctnnd... [more]
sp|Q68FH0|PKP4_MOUSE9.800e-3528.33Plakophilin-4 OS=Mus musculus OX=10090 GN=Pkp4 PE=... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A481CDG33.946e-3927.27Armadillo repeat protein deleted in velo-cardio-fa... [more]
A0A452EPW61.199e-3828.06ARVCF delta catenin family member OS=Capra hircus ... [more]
A0A452EPN71.402e-3827.92ARVCF delta catenin family member OS=Capra hircus ... [more]
F6QX401.486e-3828.15ARVCF delta catenin family member OS=Bos taurus OX... [more]
E1BPV11.528e-3828.15ARVCF delta catenin family member OS=Bos taurus OX... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arvcfa1.598e-3626.86armadillo repeat protein deleted in velo-cardio-fa... [more]
pkp41.741e-3528.85plakophilin 4 [Source:ZFIN;Acc:ZDB-GENE-120411-14][more]
ctnnd2b7.901e-3427.98catenin (cadherin-associated protein), delta 2b [S... [more]
ctnnd12.144e-3325.39catenin delta 1 [Source:NCBI gene;Acc:103033760][more]
arvcfb2.668e-3329.06ARVCF delta catenin family member b [Source:ZFIN;A... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000008642.15.266e-3529.18pep scaffold:Pmarinus_7.0:GL477625:357396:400748:1... [more]
ENSPMAT00000004698.11.792e-1133.33pep scaffold:Pmarinus_7.0:GL479318:180257:182606:1... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO395923.782e-2926.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498432.381e-2322.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARVCF1.697e-4030.83ARVCF delta catenin family member [Source:NCBI gen... [more]
ARVCF5.941e-3828.95ARVCF delta catenin family member [Source:NCBI gen... [more]
ARVCF6.511e-3829.25ARVCF delta catenin family member [Source:NCBI gen... [more]
arvcfa7.304e-3830.71armadillo repeat protein deleted in velo-cardio-fa... [more]
ARVCF7.703e-3828.95ARVCF delta catenin family member [Source:NCBI gen... [more]
back to top
BLAST of Armadillo repeat protein deleted in velo-cardio-facial syndrome vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072739.10.000e+098.82SMESG000072739.1[more]
SMESG000072739.10.000e+098.82SMESG000072739.1[more]
SMESG000072739.10.000e+098.33SMESG000072739.1[more]
SMESG000072739.10.000e+098.73SMESG000072739.1[more]
SMESG000072739.15.926e-3997.70SMESG000072739.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019923 ID=SMED30019923|Name=Armadillo repeat protein deleted in velo-cardio-facial syndrome|organism=Schmidtea mediterranea sexual|type=transcript|length=2111bp
AGCGCATTTGTGACCTCAAAATTGTAAATAGCGGTCCACCAATCAAATCA
CAAATAAGAAAATTCTCTTATTCACATTTTCCAGGAAATTTTTTAAATTT
CAATTTTGGATTTACAAGACAAATAATTTTTCAACCATCAACTGACTGAT
CCGTCAGCGAAATGACGCAATCGTCGACTCTCGAGCCAGGAATTCCTGAA
CTGTTAGATCTTTTGGCAACGGGAAATGTTGACATCCAGTCGAATGTGCT
GGCCTTTCTTCAACACATTACTTATGAAAACGAAAACATCAAAGAGATTA
TCAGACTTAAAAAAGGAATTCCTTTGATATTACCTCTTCTCAACTCTCCT
CACCGTCTGCTTCAACTCAACGCGGCAGGCGTGATCCGAAACCTGTCCAA
TGGACCCAATATTCAAATTAAGAAAGAATTGGGTAAAGAAAGAATAATTG
AAATAATTGAAAATCAAATGGAATCAAGTTCCGGTTCTTTGCCAAGATTA
GTCGAATATCAGGCGGCGATTTTATGCAATCTTTCCAGCTGTACTTTATT
TCATATTGCCCTTTCTCACAGTTGCTTATCGACATTTGTCCGTTTTGTAT
TATTGCCTAGCTTGGGTATGAGTGTGGACCCTCTGACAAACAGGGTAAGG
CTGTTCAAGATAAGTGACCTGAGTATCACTTTTGGGTCATGGCTGGAATT
TGTCACCTTGTTCTTAAAAAATATGAGCAGTGGGCCTAATGAAACTCGCG
ACATTATGAGAATGTGTGAAGGTCTATTAGATTCCGTTACATCCATAATT
CAGTTCTCATTCAATACGGAAGCATTCAACAATAGGACCGTAGAAAGTTG
CATTTGTATAATCCGTAATCTCTGCTATTCTCTTCACGACATTCTTCAAT
CCAGTCACCAATATTCCTTCAATAAAAAGACTGTAAAACATAGCAGGGAC
GAAATTCAGTTTTCAAATCCCCACCAAATGGATGTTGGAGACCAAATGCT
GCTGTGGAATTCAGAGATGATAGACTTGTTTCTGGAGATTATAAATTTCT
CTAAGAACTATTTATCAATTGAAGCCGCAATTGGAGCGGTTCAGAATTTA
GCGTGTTGTAAGTCAAAGGTTGCGGAAGAATTTAGAGTAAATTTTCGTAA
AAGAAAAGGTCTCCCATCCCTTGTAATGCACGTTATCAATGGGCCTGATA
TAGTGGTGAAGGTTGCTATAGTCGCCCTTAGAAATCTTTCGGAAGATACA
CGAAATCTAGAGCTGATCGGAACGCATGGTTTGATTCACATGTTACAATG
CCTGCCTTCTCCAAGTAGACCGGATATTAAGCGAATTTTAGATCCAGACT
CGTTCGGGCAAAACTTAGATATCCGCGAGGAATACCTCAGCCTTAATACA
ATGTATTCGATTTTTTCCTTTATCAGTTTCCTACTCCAGGCAAATGAAAG
TTTACTCGAGGTTTTTGTCAAAAGGAACGGGGTGAAAATCTGCATATATT
TGCTATCATCAGACCTTTTCTATCAAGACCACCTTGAAAGGTCAAATTCA
GGCCAAGCTGAAAATGCTAATAAGTTGCCGGTAATTGCTGCTGGGATTTT
ACAACTGGTCTGGGAAAAATCCAAATACTCAAAAAAGTTTAAGAAAGAGA
AATTCGGCTGTGAAGATTTCTGTGTTCGAAGTGGTTTTGAAAGATTCAAG
TTAGCGCTGTCTTGCGTGAATGAAAACGAGTTACCGGTGTATTATGGAAA
GCCGTATACCAAGGCCCGCTCCAATACACTCGTATCAATGGTCTATACCC
CTCGGCACTTGCCAAAAATAATAGTCACTAGAGATGAGGAGGACCCTGAC
CGGGCAGACGATAATGGATATCAGGGACCTTTCCAGAAATCCCAGACAGG
AAAAGAGACTCCAAATTCGAGGAGACTAAACGATACACTAGAACCATATA
AAAATAAAGATAAATAGAAATACAATAACAAAGAAAGAAAAGAGGATGCA
ATAAATGAAAACTGACAAGGAATCTGGTGATATGTTCAAACGTTCAAGAT
TTTTATCATTTTTATCATTTTTATTTGTAATAAATAAATTATCCGTGTTG
TGGTAAATGAC
back to top

protein sequence of SMED30019923-orf-1

>SMED30019923-orf-1 ID=SMED30019923-orf-1|Name=SMED30019923-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=602bp
MTQSSTLEPGIPELLDLLATGNVDIQSNVLAFLQHITYENENIKEIIRLK
KGIPLILPLLNSPHRLLQLNAAGVIRNLSNGPNIQIKKELGKERIIEIIE
NQMESSSGSLPRLVEYQAAILCNLSSCTLFHIALSHSCLSTFVRFVLLPS
LGMSVDPLTNRVRLFKISDLSITFGSWLEFVTLFLKNMSSGPNETRDIMR
MCEGLLDSVTSIIQFSFNTEAFNNRTVESCICIIRNLCYSLHDILQSSHQ
YSFNKKTVKHSRDEIQFSNPHQMDVGDQMLLWNSEMIDLFLEIINFSKNY
LSIEAAIGAVQNLACCKSKVAEEFRVNFRKRKGLPSLVMHVINGPDIVVK
VAIVALRNLSEDTRNLELIGTHGLIHMLQCLPSPSRPDIKRILDPDSFGQ
NLDIREEYLSLNTMYSIFSFISFLLQANESLLEVFVKRNGVKICIYLLSS
DLFYQDHLERSNSGQAENANKLPVIAAGILQLVWEKSKYSKKFKKEKFGC
EDFCVRSGFERFKLALSCVNENELPVYYGKPYTKARSNTLVSMVYTPRHL
PKIIVTRDEEDPDRADDNGYQGPFQKSQTGKETPNSRRLNDTLEPYKNKD
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0098609cell-cell adhesion
GO:0010172embryonic body morphogenesis
GO:0032956regulation of actin cytoskeleton organization
GO:0007275multicellular organism development
GO:0016337single organismal cell-cell adhesion
GO:0016339calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002056medial muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR028446JAC-1
IPR028435Plakophilin/d_Catenin
IPR000225Armadillo
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0045296cadherin binding
GO:0005515protein binding
GO:0005488binding
Vocabulary: cellular component
TermDefinition
GO:0005912adherens junction
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005886plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000225ArmadilloSMARTSM00185arm_5coord: 83..126
e-value: 390.0
score: 1.0
coord: 193..239
e-value: 410.0
score: 0.8
coord: 321..361
e-value: 41.0
score: 8.5
coord: 39..80
e-value: 0.0064
score: 25.7
IPR000225ArmadilloPROSITEPS50176ARM_REPEATcoord: 51..79
score: 8.872
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 10..504
e-value: 1.9E-85
score: 289.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 557..601
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 571..591
IPR028446Juxtamembrane domain-associated cateninPANTHERPTHR10372:SF27ADHERENS JUNCTION PROTEIN P120coord: 8..399
IPR028435Plakophilin/Delta cateninPANTHERPTHR10372PLAKOPHILLIN-RELATEDcoord: 8..399
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 10..448