Potassium voltage-gated channel subfamily A member 2

Overview
NamePotassium voltage-gated channel subfamily A member 2
Smed IDSMED30019915
Length (bp)1623
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium voltage-gated channel subfamily A member 2 (SMED30019915) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium voltage-gated channel subfamily A member 2 (SMED30019915) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage-gated channel subfamily A member 2 (SMED30019915) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage-gated channel subfamily A member 2 (SMED30019915) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019915

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019915SMESG000013562.1 SmedASXL_011709SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30019915SMESG000013562.1 dd_Smed_v4_15133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30019915SMESG000013562.1 dd_Smed_v4_15133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30019915SMESG000013562.1 dd_Smed_v4_15133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019915SMESG000013562.1 dd_Smed_v6_15133_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 383.645 bits (984), Expect = 1.339e-127
Identity = 191/393 (48.60%), Postives = 264/393 (67.18%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF---NKSHCVSGA--------------APNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG+  E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F   N+    SG               + +F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    +SQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 383.645 bits (984), Expect = 1.339e-127
Identity = 191/393 (48.60%), Postives = 264/393 (67.18%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF---NKSHCVSGA--------------APNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG+  E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F   N+    SG               + +F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    +SQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 383.645 bits (984), Expect = 1.339e-127
Identity = 191/393 (48.60%), Postives = 264/393 (67.18%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF---NKSHCVSGA--------------APNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG+  E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F   N+    SG               + +F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    +SQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 383.645 bits (984), Expect = 1.339e-127
Identity = 191/393 (48.60%), Postives = 264/393 (67.18%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF---NKSHCVSGA--------------APNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG+  E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F   N+    SG               + +F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    +SQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 383.645 bits (984), Expect = 1.339e-127
Identity = 191/393 (48.60%), Postives = 264/393 (67.18%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF---NKSHCVSGA--------------APNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG+  E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F   N+    SG               + +F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    +SQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 302.753 bits (774), Expect = 2.279e-97
Identity = 166/400 (41.50%), Postives = 253/400 (63.25%), Query Frame = 1
Query:  343 RRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTL-EVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAA-PNFLD--------VFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAF-----LRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHK 1497
            +R   + SS +  P+     + V IN+SG+ F+T+   L+ +P +LLGD +KR  ++     E+FFDR+R  FESI   YQ+GG++KRP  VP +IFL E+ F+Q+   +++ +   EG+   + + +P NK +R IW L E+P++S+SA  +A +S+A   LSI+ FC ET P   +   ++ +A    LD         FF +E +C  WFTIE+  RFISCP KV F   + NIID  A+ P++V        F  D +K ++S++F     LR++R+ RVFKL++HS GLQ+L  TFR+S++   L +  ++++++LF+S +Y+AE G P+S+  SIP +FW+ ++TM TVGYGD VP    GK+VG +CA+ GVLTLA+PVPII  NF  FY  +
Sbjct:   27 QRGTPDTSSTQGHPYT---DQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNSATAELLDEMDEKHYSPFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF------FFADTSKSNSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 417          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 302.753 bits (774), Expect = 2.279e-97
Identity = 166/400 (41.50%), Postives = 253/400 (63.25%), Query Frame = 1
Query:  343 RRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTL-EVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAA-PNFLD--------VFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAF-----LRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHK 1497
            +R   + SS +  P+     + V IN+SG+ F+T+   L+ +P +LLGD +KR  ++     E+FFDR+R  FESI   YQ+GG++KRP  VP +IFL E+ F+Q+   +++ +   EG+   + + +P NK +R IW L E+P++S+SA  +A +S+A   LSI+ FC ET P   +   ++ +A    LD         FF +E +C  WFTIE+  RFISCP KV F   + NIID  A+ P++V        F  D +K ++S++F     LR++R+ RVFKL++HS GLQ+L  TFR+S++   L +  ++++++LF+S +Y+AE G P+S+  SIP +FW+ ++TM TVGYGD VP    GK+VG +CA+ GVLTLA+PVPII  NF  FY  +
Sbjct:   27 QRGTPDTSSTQGHPYT---DQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNSATAELLDEMDEKHYSPFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF------FFADTSKSNSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 417          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 303.138 bits (775), Expect = 2.336e-97
Identity = 166/400 (41.50%), Postives = 253/400 (63.25%), Query Frame = 1
Query:  343 RRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTL-EVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAA-PNFLD--------VFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAF-----LRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHK 1497
            +R   + SS +  P+     + V IN+SG+ F+T+   L+ +P +LLGD +KR  ++     E+FFDR+R  FESI   YQ+GG++KRP  VP +IFL E+ F+Q+   +++ +   EG+   + + +P NK +R IW L E+P++S+SA  +A +S+A   LSI+ FC ET P   +   ++ +A    LD         FF +E +C  WFTIE+  RFISCP KV F   + NIID  A+ P++V        F  D +K ++S++F     LR++R+ RVFKL++HS GLQ+L  TFR+S++   L +  ++++++LF+S +Y+AE G P+S+  SIP +FW+ ++TM TVGYGD VP    GK+VG +CA+ GVLTLA+PVPII  NF  FY  +
Sbjct:   40 QRGTPDTSSTQGHPYT---DQIVTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNSATAELLDEMDEKHYSPFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF------FFADTSKSNSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 430          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 302.753 bits (774), Expect = 8.681e-97
Identity = 166/400 (41.50%), Postives = 253/400 (63.25%), Query Frame = 1
Query:  343 RRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTL-EVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAA-PNFLD--------VFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAF-----LRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHK 1497
            +R   + SS +  P+   +   V IN+SG+ F+T+   L+ +P +LLGD +KR  ++     E+FFDR+R  FESI   YQ+GG++KRP  VP +IFL E+ F+Q+   +++ +   EG+   + + +P NK +R IW L E+P++S+SA  +A +S+A   LSI+ FC ET P   +   ++ +A    LD         FF +E +C  WFTIE+  RFISCP KV F   + NIID  A+ P++V        F  D +K ++S++F     LR++R+ RVFKL++HS GLQ+L  TFR+S++   L +  ++++++LF+S +Y+AE G P+S+  SIP +FW+ ++TM TVGYGD VP    GK+VG +CA+ GVLTLA+PVPII  NF  FY  +
Sbjct:   73 QRGTPDTSSTQGHPYTDQI---VTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNSATAELLDEMDEKHYSPFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF------FFADTSKSNSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQE 463          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shk-1 (Potassium voltage-gated channel protein shk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4B0])

HSP 1 Score: 302.753 bits (774), Expect = 2.588e-96
Identity = 166/401 (41.40%), Postives = 253/401 (63.09%), Query Frame = 1
Query:  343 RRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTL-EVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAA-PNFLD--------VFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAF-----LRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            +R   + SS +  P+   +   V IN+SG+ F+T+   L+ +P +LLGD +KR  ++     E+FFDR+R  FESI   YQ+GG++KRP  VP +IFL E+ F+Q+   +++ +   EG+   + + +P NK +R IW L E+P++S+SA  +A +S+A   LSI+ FC ET P   +   ++ +A    LD         FF +E +C  WFTIE+  RFISCP KV F   + NIID  A+ P++V        F  D +K ++S++F     LR++R+ RVFKL++HS GLQ+L  TFR+S++   L +  ++++++LF+S +Y+AE G P+S+  SIP +FW+ ++TM TVGYGD VP    GK+VG +CA+ GVLTLA+PVPII  NF  FY  + 
Sbjct:  116 QRGTPDTSSTQGHPYTDQI---VTINVSGMRFQTFESTLSRYPNSLLGDRNKRQHFFVSDTNEFFFDRHRTTFESILYIYQSGGRVKRPEIVPIDIFLKEMRFFQMGDDLLEEFWIAEGYEKPKEVMMPNNKTQRKIWELMEYPDSSLSARIIAFISIAVIALSIISFCWETVPSDIEEKPINNSATAELLDEMDEKHYSPFFWIELMCILWFTIELILRFISCPCKVTFATSVLNIIDFVAIAPFFVNF------FFADTSKSNSSMSFAVLRVLRLVRVFRVFKLSRHSVGLQILGKTFRSSVQEFCLLIFFMAIALVLFASGMYFAEQGEPNSKFTSIPASFWFVLVTMTTVGYGDLVPLSPFGKVVGGMCAMIGVLTLALPVPIIVANFKHFYRQEN 507          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0089657)

HSP 1 Score: 394.43 bits (1012), Expect = 4.441e-130
Identity = 197/452 (43.58%), Postives = 288/452 (63.72%), Query Frame = 1
Query:  232 ERAIKFKGSTPKSNSFKIIWNSFKRSLSSNDSGSEKKRRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF----------NKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVL-------------VTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGR 1506
            ER ++ +    + NS    + S  + LSS D                   P  +D  E+VVIN+SGL FET    LN+ P TLLGDP++R  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP ++F  E+ FY++    I+ +++DEG   E    LP N+ +R +W+LFE+PE+S +A  VA++SV   +LSIV+FC+ET P F          N +       P+  D FF++ET+C  WFT E++ RF++CP+K+ F +D+ N+ID+ A+IPY++TL  V+             V+     + ++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + ++LFSS +Y+AE G+ +S  +SIPDAFWWA++TM TVGYGD  P  + GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T +
Sbjct:   42 ERKLQLREQQLQRNSLDG-YGSLPK-LSSQDEEGGAGHGFGGGPQHFEPIPHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQ 491          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0302903)

HSP 1 Score: 392.504 bits (1007), Expect = 1.581e-129
Identity = 188/402 (46.77%), Postives = 273/402 (67.91%), Query Frame = 1
Query:  382 PFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF----------NKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVL-------------VTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGR 1506
            P  +D  E+VVIN+SGL FET    LN+ P TLLGDP++R  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP ++F  E+ FY++    I+ +++DEG   E    LP N+ +R +W+LFE+PE+S +A  VA++SV   +LSIV+FC+ET P F          N +       P+  D FF++ET+C  WFT E++ RF++CP+K+ F +D+ N+ID+ A+IPY++TL  V+             V+     + ++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + ++LFSS +Y+AE G+ +S  +SIPDAFWWA++TM TVGYGD  P  + GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T +
Sbjct:   78 PHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQ 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0089661)

HSP 1 Score: 392.504 bits (1007), Expect = 1.581e-129
Identity = 188/402 (46.77%), Postives = 273/402 (67.91%), Query Frame = 1
Query:  382 PFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF----------NKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVL-------------VTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGR 1506
            P  +D  E+VVIN+SGL FET    LN+ P TLLGDP++R  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP ++F  E+ FY++    I+ +++DEG   E    LP N+ +R +W+LFE+PE+S +A  VA++SV   +LSIV+FC+ET P F          N +       P+  D FF++ET+C  WFT E++ RF++CP+K+ F +D+ N+ID+ A+IPY++TL  V+             V+     + ++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + ++LFSS +Y+AE G+ +S  +SIPDAFWWA++TM TVGYGD  P  + GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T +
Sbjct:   78 PHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQ 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0302902)

HSP 1 Score: 392.504 bits (1007), Expect = 1.581e-129
Identity = 188/402 (46.77%), Postives = 273/402 (67.91%), Query Frame = 1
Query:  382 PFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF----------NKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVL-------------VTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGR 1506
            P  +D  E+VVIN+SGL FET    LN+ P TLLGDP++R  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP ++F  E+ FY++    I+ +++DEG   E    LP N+ +R +W+LFE+PE+S +A  VA++SV   +LSIV+FC+ET P F          N +       P+  D FF++ET+C  WFT E++ RF++CP+K+ F +D+ N+ID+ A+IPY++TL  V+             V+     + ++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + ++LFSS +Y+AE G+ +S  +SIPDAFWWA++TM TVGYGD  P  + GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T +
Sbjct:   78 PHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQ 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0308200)

HSP 1 Score: 392.504 bits (1007), Expect = 1.754e-129
Identity = 188/402 (46.77%), Postives = 273/402 (67.91%), Query Frame = 1
Query:  382 PFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF----------NKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVL-------------VTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGR 1506
            P  +D  E+VVIN+SGL FET    LN+ P TLLGDP++R  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP ++F  E+ FY++    I+ +++DEG   E    LP N+ +R +W+LFE+PE+S +A  VA++SV   +LSIV+FC+ET P F          N +       P+  D FF++ET+C  WFT E++ RF++CP+K+ F +D+ N+ID+ A+IPY++TL  V+             V+     + ++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + ++LFSS +Y+AE G+ +S  +SIPDAFWWA++TM TVGYGD  P  + GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T +
Sbjct:   78 PHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQ 479          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna2b (potassium voltage-gated channel, shaker-related subfamily, member 2b [Source:ZFIN;Acc:ZDB-GENE-080204-89])

HSP 1 Score: 389.423 bits (999), Expect = 3.591e-130
Identity = 193/385 (50.13%), Postives = 263/385 (68.31%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIEL-PTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF-------------NKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDG--AKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            E+VVINISGL FET    L++ P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNV  +IF  E+ FY++ +  I+ +++DEG   E  +L P N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F             + +  +S  +  F D FFILET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     DG   +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE   PDSQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   33 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEMFREDEGFIKEEEKLLPENEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPVFRNEETDMHKAYRTDSNSTISYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKAGFFVNIMNIIDIVAIIPYFITLGTELAEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPDSQFVSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 417          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 380.563 bits (976), Expect = 1.279e-126
Identity = 190/385 (49.35%), Postives = 257/385 (66.75%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAP-------------NFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDG--AKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            E+VVINISGL FET    L++ P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNV  ++F  E+ FY++    I+ +++DEG   E    LP N+ ++ +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F          P              F D FFILET+C  WF+ E   RF +CPSK  F  +I N+IDV A+IPY++TL   L     DG   +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE   P+SQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   32 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDVFSEEIRFYELGDEAIEIFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRSDEEEMHKVPVNVNNSTTSYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKASFFVNIMNMIDVVAIIPYFITLGTELAEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 380.563 bits (976), Expect = 1.279e-126
Identity = 190/385 (49.35%), Postives = 257/385 (66.75%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAP-------------NFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDG--AKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            E+VVINISGL FET    L++ P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNV  ++F  E+ FY++    I+ +++DEG   E    LP N+ ++ +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F          P              F D FFILET+C  WF+ E   RF +CPSK  F  +I N+IDV A+IPY++TL   L     DG   +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE   P+SQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   32 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDVFSEEIRFYELGDEAIEIFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRSDEEEMHKVPVNVNNSTTSYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKASFFVNIMNMIDVVAIIPYFITLGTELAEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: CABZ01113981.1 (pep scaffold:GRCz11:KN150008.1:12653:14179:-1 gene:ENSDARG00000102982.2 transcript:ENSDART00000162692.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01113981.1)

HSP 1 Score: 377.481 bits (968), Expect = 7.596e-126
Identity = 189/374 (50.53%), Postives = 260/374 (69.52%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLF---CVETHPFFNKSHCVSGAAPN-FLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            E+VVINISGL FET    L + P TLLGDP KR  ++D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF+ E+ FY++ + VI+ +K+DEG   E    LP ++ +R +W+LFE+PE+S  A  +A++SV   ++SI        E HP  N +   S   PN F D FFI+ET+C  WF+ E+  RF++CPSK  F K+I N ID+ A+IPY++TL   L     +G +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE  +PDS   SIPDAFWWA+++M TVGYGD  P  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   34 ERVVINISGLRFETQLKTLAQFPATLLGDPRKRMRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPVDIFMEEIKFYELGEEVIENFKEDEGFIKEEERPLPESEFQRQVWLLFEYPESSGPARGIAIVSVLVILISIFREDGKAFEEHPGVNGT-AASVKKPNPFTDPFFIVETLCIIWFSFELLVRFLACPSKPAFFKNIMNTIDIVAIIPYFITLGLELAEHQGNG-QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPDSGFSSIPDAFWWAVVSMTTVGYGDMCPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 405          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna1a (potassium voltage-gated channel, shaker-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-110408-15])

HSP 1 Score: 366.311 bits (939), Expect = 4.551e-121
Identity = 188/404 (46.53%), Postives = 266/404 (65.84%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNK---------SHCVSGAAPNFL-DVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDG----AKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLRF*ILINVTMINI 1548
            ++  E+VVINI+GL FET    L + P TLLG+P KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RP NVP ++F  E+ FY++    ++ +++DEG   E    LP  + +R IW+LFE PE+S  A  +A++SV   ++SIV+FC+ET P   +          +      P+ L D FFI+ET+C  WF+ E+  RF +CPSK  F K++ N ID+ A+IPY++TL   L   + DG     +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    +S   SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T       L+NV+  NI
Sbjct:   30 HECCERVVINIAGLRFETQLKTLAQFPETLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPANVPLDMFSEEIKFYELGVEAMEKFREDEGFIREEERPLPEKEFQRQIWLLFEHPESSGPARGIAIVSVMVILISIVIFCLETLPELKEDPEGRIKIIGNTTYYYKPSILADPFFIIETLCIIWFSFELIVRFFACPSKAAFFKNMMNTIDIVAIIPYFITLGTELAE-EQDGKEGKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEKESYFSSIPDAFWWAVVSMTTVGYGDMVPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQLLNVSNPNI 432          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 390.193 bits (1001), Expect = 1.929e-130
Identity = 197/403 (48.88%), Postives = 272/403 (67.49%), Query Frame = 1
Query:  340 KRRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAA------------PNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++R +L  SS R     ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+I+RPVNVP +IF  E+ FY++ +  ++ +++DEG   E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV+FC+ET P F      SG A             +F D FF++ET+C  WF+ E+  RF +CPSK  F K+I NIID+ A+IPY++TL   L     +G +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE  +P S   SIPDAFWWA++TM TVGYGD  P  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:    3 EKRLSLCLSSHRQE--DHECCERVVINISGLRFETQLKTLAQFPDTLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYELGEEAMEKFREDEGFIREEERPLPPNEFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDDKEYSGTALPPGNGTGPYISSSFTDPFFVVETLCIIWFSFELLVRFFACPSKATFCKNIMNIIDIVAIIPYFITLGTELAERQGNG-QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 402          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA2 (potassium channel, voltage gated shaker related subfamily A, member 3 [Source:NCBI gene;Acc:100496794])

HSP 1 Score: 384.03 bits (985), Expect = 9.781e-128
Identity = 191/393 (48.60%), Postives = 266/393 (67.68%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF-NKSHCVSGAAPN----------------FLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLV--TFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L++ P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG   E    LP N+ ++ +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F +++  + G+  N                F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L   T D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    DSQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEIFREDEGFIKEEERPLPDNEYQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPVFRDENEDMHGSGVNYYPYSNSTVRYQKSNTFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKTEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA5 (potassium channel, voltage gated shaker related subfamily A, member 5 [Source:NCBI gene;Acc:496997])

HSP 1 Score: 386.341 bits (991), Expect = 5.726e-127
Identity = 185/392 (47.19%), Postives = 262/392 (66.84%), Query Frame = 1
Query:  379 GPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTL-EVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFL--------------DVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            G   ++  ++V+INI+GL FET    LN+ P TLLGDP KR  ++D  R EYFFDR RP+F+ I  +YQ+GGKI+RPVNV  ++F  E+ FY++ +  ++ +++DEG    E   LP N+ +R +W++FE+PE+S SA  +A++SV   ++SI+ FC+ET P F   + +  A    L              D FFI+ET C  WFT E+  RF +CPSK  F K+I NIID+ A+IPY++TL   L     +  +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE  +P+S   SIPDAFWWA++TM TVGYGD  P  + GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:  161 GIMDHESNQRVIINIAGLRFETQLSTLNQFPDTLLGDPEKRMRFFDPLRNEYFFDRNRPSFDGILYFYQSGGKIRRPVNVSIDVFADEIRFYELGEEAMERFREDEGFIKDEEKPLPCNEFQRQVWLIFEYPESSSSARGIAIVSVLVILISIITFCLETLPEFRDENELPPALSKVLNDTQEHPSPPSGLTDPFFIIETTCVIWFTFELLVRFFACPSKSDFSKNIMNIIDIVAIIPYFITLGTELAQHQTNNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPESHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 552          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: ENSXETT00000049277.1 (potassium channel, voltage gated shaker related subfamily A, member 6 [Source:NCBI gene;Acc:100492986])

HSP 1 Score: 380.178 bits (975), Expect = 8.627e-127
Identity = 190/384 (49.48%), Postives = 262/384 (68.23%), Query Frame = 1
Query:  394 DLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPN-----------FLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            D  E+VVINISGL FET    L++ P TLLGDP KR  ++D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IFL E+ FY++ + VI+ ++ DEG   E    LP N  +R +W+LFE+PE+S  A  +A++SV   ++SIV+FC+ET P F +    SG  P            F D FF+ ET+C  WF+ E+  RF +CPSK  F K++ N+ID+ A+IPY++TL   L        +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE  +P+S   SIPDAFWWA+++M TVGYGD  P  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   11 DCCERVVINISGLRFETQLRTLSQFPQTLLGDPRKRMRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPVDIFLEEIKFYELGEEVIEIFRDDEGFIKEEERPLPENDFQRQVWLLFEYPESSGPARGIAIVSVLIILISIVIFCLETLPEFREEARQSGGQPAVNGTHTFTNSPFTDPFFLTETLCIIWFSFELLVRFFACPSKPAFFKNMMNVIDIVAIIPYFITLGTELAEQQGSNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPESLFTSIPDAFWWAVVSMTTVGYGDMYPMTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 394          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: fastkd3 (FAST kinase domains 3 [Source:Xenbase;Acc:XB-GENE-5998409])

HSP 1 Score: 372.474 bits (955), Expect = 3.122e-124
Identity = 185/379 (48.81%), Postives = 258/379 (68.07%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIEL-PTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVS------GAAPN---FLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            E+VVIN+SGL FET    L+  P TLLGDP +R  ++D  R EYFFDR RP F+SI  +YQ+GG+++RP NVP ++F+ EL FYQ+  +VI  +++DEG   E   L P  +  + +W+LFE P++S +A  +A++SV   ++SIV+FC+ET P F     +S         P    F D FFI+ET+C  WF+ E+S RFI+CPSK  F KDI N+ID  A+IPY+V L   L      G + + SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE  + D++  SIP+AFWWA++TM TVGYGD  P+ + GKLVGS+CA++GVLT+++PVP+I  NF+ FY  +T
Sbjct:    8 ERVVINVSGLRFETQIRTLHRFPDTLLGDPRRRIHFFDPLRNEYFFDRNRPCFDSILYFYQSGGRLRRPTNVPLDVFMEELLFYQLGDNVIRKFREDEGFMKEEERLLPECEFMKQVWLLFEHPDSSSAARIIAIISVMVILISIVIFCLETLPEFRDDRDLSLPKDPLSGRPQKSPFEDPFFIVETICICWFSFELSVRFIACPSKAAFFKDIMNMIDFVAIIPYFVALGTELARHKGVG-QPAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADHEDTKFTSIPEAFWWAVVTMTTVGYGDMSPETVGGKLVGSLCAIAGVLTISLPVPVIVSNFSYFYHRET 385          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 384.8 bits (987), Expect = 3.748e-128
Identity = 191/393 (48.60%), Postives = 263/393 (66.92%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKS-----------HCVSGA------APNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG+  E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F              H  S +      + +F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    DSQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 384.8 bits (987), Expect = 3.748e-128
Identity = 191/393 (48.60%), Postives = 263/393 (66.92%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKS-----------HCVSGA------APNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG+  E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F              H  S +      + +F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    DSQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 384.8 bits (987), Expect = 3.748e-128
Identity = 191/393 (48.60%), Postives = 263/393 (66.92%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKS-----------HCVSGA------APNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG+  E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F              H  S +      + +F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    DSQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna3 (potassium voltage-gated channel, shaker-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96660])

HSP 1 Score: 382.104 bits (980), Expect = 9.057e-127
Identity = 188/389 (48.33%), Postives = 260/389 (66.84%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF-------------------NKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            E+VVINISGL FET    L + P TLLGDP +R  Y+D  R EYFFDR RP+F++I  YYQ+GG+I+RPVNVP +IF  E+ FYQ+ +  ++ +++DEG   E    LP    +R +W+LFE+PE+S  A  +A++SV   ++SIV+FC+ET P F                   N +      A +F D FF++ET+C  WF+ E+  RF +CPSK  F ++I N+ID+ A+IPY++TL   L     +G +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE  +P S   SIPDAFWWA++TM TVGYGD  P  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   57 ERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASPSQDVFEAANNSTSGAPSGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNG-QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 444          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna1 (potassium voltage-gated channel, shaker-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96654])

HSP 1 Score: 372.089 bits (954), Expect = 2.656e-123
Identity = 182/387 (47.03%), Postives = 257/387 (66.41%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPN------------FLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTL-TNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLG+P KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP ++F  E+ FY++ +  ++ +++DEG   E    LP  + +R +W+LFE+PE+S  A  +A++SV   ++SIV+FC+ET P        +G                F D FFI+ET+C  WF+ E+  RF +CPSK  F K+I N ID+ A+IPY++TL T +         +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    +S   SIPDAFWWA+++M TVGYGD  P  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   33 HECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDFTGTIHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 419          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P08510|KCNAS_DROME (Potassium voltage-gated channel protein Shaker OS=Drosophila melanogaster OX=7227 GN=Sh PE=1 SV=3)

HSP 1 Score: 394.43 bits (1012), Expect = 4.452e-129
Identity = 197/452 (43.58%), Postives = 288/452 (63.72%), Query Frame = 1
Query:  232 ERAIKFKGSTPKSNSFKIIWNSFKRSLSSNDSGSEKKRRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF----------NKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVL-------------VTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGR 1506
            ER ++ +    + NS    + S  + LSS D                   P  +D  E+VVIN+SGL FET    LN+ P TLLGDP++R  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP ++F  E+ FY++    I+ +++DEG   E    LP N+ +R +W+LFE+PE+S +A  VA++SV   +LSIV+FC+ET P F          N +       P+  D FF++ET+C  WFT E++ RF++CP+K+ F +D+ N+ID+ A+IPY++TL  V+             V+     + ++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + ++LFSS +Y+AE G+ +S  +SIPDAFWWA++TM TVGYGD  P  + GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T +
Sbjct:   42 ERKLQLREQQLQRNSLDG-YGSLPK-LSSQDEEGGAGHGFGGGPQHFEPIPHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQ 491          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|Q09081|KCNA2_RABIT (Potassium voltage-gated channel subfamily A member 2 OS=Oryctolagus cuniculus OX=9986 GN=KCNA2 PE=1 SV=2)

HSP 1 Score: 385.571 bits (989), Expect = 1.116e-127
Identity = 192/393 (48.85%), Postives = 264/393 (67.18%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF---NKSHCVSG--------------AAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG+  E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F   N+    SG               + +F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    DSQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGMTFHTYSNSTAGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P63142|KCNA2_RAT (Potassium voltage-gated channel subfamily A member 2 OS=Rattus norvegicus OX=10116 GN=Kcna2 PE=1 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 2.622e-127
Identity = 191/393 (48.60%), Postives = 263/393 (66.92%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKS-----------HCVSGA------APNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG+  E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F              H  S +      + +F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    DSQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P63141|KCNA2_MOUSE (Potassium voltage-gated channel subfamily A member 2 OS=Mus musculus OX=10090 GN=Kcna2 PE=1 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 2.622e-127
Identity = 191/393 (48.60%), Postives = 263/393 (66.92%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKS-----------HCVSGA------APNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG+  E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F              H  S +      + +F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    DSQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P16389|KCNA2_HUMAN (Potassium voltage-gated channel subfamily A member 2 OS=Homo sapiens OX=9606 GN=KCNA2 PE=1 SV=2)

HSP 1 Score: 383.645 bits (984), Expect = 6.433e-127
Identity = 191/393 (48.60%), Postives = 264/393 (67.18%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF---NKSHCVSGA--------------APNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF  E+ FY++ +  ++ +++DEG+  E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F   N+    SG               + +F D FFI+ET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     D    +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    +SQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 HECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A2H1CQP4 (K+ channel tetramerization domain protein OS=Fasciola hepatica OX=6192 GN=D915_002281 PE=3 SV=1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 266/397 (67.00%), Postives = 323/397 (81.36%), Query Frame = 1
Query:  322 DSGSEKKRRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLR 1512
            +SGS     N  E SS  +        ++V++N+SGL FETW  +LN HPTTLLGD  KR  +YD++R+EYFFDR+RP+FE+IFNYYQ GG+IKRP  V D+IFL EL+F+QIEK  +++YKK+EG+  EVI LP N+IKR +W+LFE+PETS  AFC +V SV FTV+SI+LFCVET P + ++HC  GA PNF D FFI+ET+CT WFT E+  RF+SCPS  KFIKD+KN+ID+AA++PYY+TLTNVL+TF C+GAK SASLAFLRVIRLIRVFKLTKHS GLQVL+LTF+ SIEGL LFLVA  V I++FSS +YY E+    SQIESIPDAFWWA+ITMCTVGYGDKVP+  LGK+VGSVCAV+GVLTLAIPVPIITENFNKFY+HKTGR R
Sbjct:  396 ESGSPVILANEFEPSSSNNSETVCQDCQRVILNVSGLKFETWLAVLNNHPTTLLGDADKRMPFYDEQRKEYFFDRHRPSFEAIFNYYQYGGRIKRPAVVADDIFLRELEFFQIEKDALESYKKNEGYVPEVIILPENRIKRKLWLLFEYPETSPLAFCFSVTSVIFTVISIILFCVETLPVYAQTHCEPGAKPNFRDPFFIIETICTIWFTFELIIRFVSCPSHKKFIKDLKNLIDLAAIVPYYITLTNVLITFSCEGAKSSASLAFLRVIRLIRVFKLTKHSSGLQVLVLTFKESIEGLSLFLVAFIVCILVFSSVLYYVEIDRKGSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGKIVGSVCAVAGVLTLAIPVPIITENFNKFYAHKTGRGR 792          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A074ZNJ5 (BTB domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_07533 PE=3 SV=1)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 274/426 (64.32%), Postives = 336/426 (78.87%), Query Frame = 1
Query:  265 KSNSFKIIWNS-----FKRSLSSNDSGSEKKRRNAL---EYSSLRSGPFQY--DLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLR 1512
            K N    +W+S     F+R  +  DS  +  + N+L   EY    SG  Q    +  +V++N+SGL FETW+ +L   PTT+LGDP KR  ++D KR+EYFFDR+RP+FE+IFNYYQ GG +KRP  V D+IFL EL+F+QIE + I++YKK EG+  EVI LP    KR++W+LFE+PETS+SAFCV+V SV FTV+SI+LFCVET P ++ +HC  G  PNFLD FFI+ET+CT WFT E+S RF+SCPS+  F+KDIKN+ID+AA++PYY+TLTNVL+TF C+GAK SASL FLRVIRLIRVFKLTKHS GLQVL+LTF+ SIEGL LFLVA  V I++FSSTIYY E+   DSQIESIPDAFWWA+ITMCTVGYGDKVP+  LGKLVGSVCAV+GVLTLAIPVPIITENFNKFY+HKTGR R
Sbjct:  321 KKNERSHLWHSGGSASFRRMNTHLDSAPDYIKENSLAISEYLESESGCSQSVDAINRRVILNVSGLKFETWSAVLESRPTTVLGDPEKRRPFWDSKRREYFFDRHRPSFEAIFNYYQYGGCLKRPAVVSDDIFLKELEFFQIEDAAIESYKKSEGYVPEVIVLPEISWKRTLWLLFEYPETSLSAFCVSVTSVLFTVISIILFCVETLPAYSTTHCEPGDRPNFLDPFFIIETMCTIWFTAELSIRFLSCPSRRSFLKDIKNLIDLAAIVPYYLTLTNVLITFSCEGAKSSASLGFLRVIRLIRVFKLTKHSSGLQVLVLTFKESIEGLSLFLVAFIVCILVFSSTIYYVEIDRKDSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGKLVGSVCAVAGVLTLAIPVPIITENFNKFYAHKTGRGR 746          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: H2KQ48 (Potassium voltage-gated channel protein Shaker OS=Clonorchis sinensis OX=79923 GN=CLF_103220 PE=3 SV=1)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 273/426 (64.08%), Postives = 337/426 (79.11%), Query Frame = 1
Query:  265 KSNSFKIIWNS-----FKRSLSSNDSGSEKKRRNAL---EYSSLRSGPFQ--YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLR 1512
            K N    +W+S     F++  +  DS S+  + N+L   EY    SG  Q    + ++VV+N+SGL FETW+ +L   PTT+LGDP KR  ++D KR+EYFFDR+RP+FE+IFNYYQ GG +KRP  V D+IFL EL+F+Q+E   I++YKK EG+  EVI LP    KR++W+LFE+PETS+SAFCV+V SV FTV+SI+LFCVET P ++ +HC  G  PNFLD FFI+ET+CT WFT E+S RF+SCPS+  F+KDIKN+ID+AA++PYY+TLTNVL+TF C+GAK SASL FLRVIRLIRVFKLTKHS GLQVL+LTF+ S+EGL LFLVA  V I++FSSTIYY E+   DSQIESIPDAFWWA+ITMCTVGYGDKVP+  LGKLVGSVCAV+GVLTLAIPVPIITENFNKFY+HKTGR R
Sbjct:  311 KKNERSHLWHSGGSVSFRKMNAHLDSASDYIKENSLAISEYLESESGYSQSVAAINQRVVLNVSGLKFETWSAVLESRPTTVLGDPEKRRPFWDSKRREYFFDRHRPSFEAIFNYYQYGGCLKRPAVVSDDIFLKELEFFQLEDDAIESYKKSEGYVPEVIVLPEISWKRTLWLLFEYPETSLSAFCVSVTSVLFTVISIILFCVETLPAYSTTHCEPGDRPNFLDPFFIIETMCTIWFTAELSIRFLSCPSRRSFLKDIKNLIDLAAIVPYYLTLTNVLITFSCEGAKSSASLGFLRVIRLIRVFKLTKHSSGLQVLVLTFKESVEGLSLFLVAFIVCILVFSSTIYYVEIDRKDSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGKLVGSVCAVAGVLTLAIPVPIITENFNKFYAHKTGRGR 736          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A3R7CF38 (Potassium voltage-gated channel subfamily A member 2 OS=Clonorchis sinensis OX=79923 GN=KCNA2 PE=3 SV=1)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 273/426 (64.08%), Postives = 337/426 (79.11%), Query Frame = 1
Query:  265 KSNSFKIIWNS-----FKRSLSSNDSGSEKKRRNAL---EYSSLRSGPFQ--YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLR 1512
            K N    +W+S     F++  +  DS S+  + N+L   EY    SG  Q    + ++VV+N+SGL FETW+ +L   PTT+LGDP KR  ++D KR+EYFFDR+RP+FE+IFNYYQ GG +KRP  V D+IFL EL+F+Q+E   I++YKK EG+  EVI LP    KR++W+LFE+PETS+SAFCV+V SV FTV+SI+LFCVET P ++ +HC  G  PNFLD FFI+ET+CT WFT E+S RF+SCPS+  F+KDIKN+ID+AA++PYY+TLTNVL+TF C+GAK SASL FLRVIRLIRVFKLTKHS GLQVL+LTF+ S+EGL LFLVA  V I++FSSTIYY E+   DSQIESIPDAFWWA+ITMCTVGYGDKVP+  LGKLVGSVCAV+GVLTLAIPVPIITENFNKFY+HKTGR R
Sbjct:  361 KKNERSHLWHSGGSVSFRKMNAHLDSASDYIKENSLAISEYLESESGYSQSVAAINQRVVLNVSGLKFETWSAVLESRPTTVLGDPEKRRPFWDSKRREYFFDRHRPSFEAIFNYYQYGGCLKRPAVVSDDIFLKELEFFQLEDDAIESYKKSEGYVPEVIVLPEISWKRTLWLLFEYPETSLSAFCVSVTSVLFTVISIILFCVETLPAYSTTHCEPGDRPNFLDPFFIIETMCTIWFTAELSIRFLSCPSRRSFLKDIKNLIDLAAIVPYYLTLTNVLITFSCEGAKSSASLGFLRVIRLIRVFKLTKHSSGLQVLVLTFKESVEGLSLFLVAFIVCILVFSSTIYYVEIDRKDSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGKLVGSVCAVAGVLTLAIPVPIITENFNKFYAHKTGRGR 786          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A504Y710 (Potassium voltage-gated channel subfamily A member 3 OS=Fasciola gigantica OX=46835 GN=FGIG_01360 PE=3 SV=1)

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 258/370 (69.73%), Postives = 311/370 (84.05%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLR 1512
            ++V++N+SGL FETW  +LN HPTTLLGD  KR  +YD +R+EYFFDR+RP+FE+IFNYYQ GG+IKRP  V D+IFL EL+F+QIEK  +++YKK+EG+  EVI LP N IKR +W+LFE+PETS  AFC +V SV FTV+SI+LFCVET P + ++HC  GA PNF D FFI+ET+CT WFT E+  RF+SCPS   FIKD+KN+ID+AA++PYY+TLTNVL+TF C+GAK SASLAFLRVIRLIRVFKLTKHS GLQVL+LTF+ SIEGL LFLVA  V I++FSS +YY E+    SQIESIPDAFWWA+ITMCTVGYGDKVP+  LGK+VGSVCAV+GVLTLAIPVPIITENFNKFY+HKTGR R
Sbjct:  423 QRVILNVSGLKFETWLAVLNNHPTTLLGDADKRMPFYDAQRREYFFDRHRPSFEAIFNYYQYGGRIKRPAVVADDIFLRELEFFQIEKDALESYKKNEGYVPEVIILPENHIKRKLWLLFEYPETSPLAFCFSVTSVIFTVISIILFCVETLPVYAQTHCEPGAKPNFRDPFFIIETICTIWFTFELIIRFVSCPSHKTFIKDLKNLIDLAAIVPYYITLTNVLITFSCEGAKSSASLAFLRVIRLIRVFKLTKHSSGLQVLVLTFKESIEGLSLFLVAFIVCILVFSSVLYYVEIDRKGSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGKIVGSVCAVAGVLTLAIPVPIITENFNKFYAHKTGRGR 792          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: kcna2a (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:103030675])

HSP 1 Score: 384.03 bits (985), Expect = 4.814e-128
Identity = 194/393 (49.36%), Postives = 264/393 (67.18%), Query Frame = 1
Query:  379 GPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF----NKSHCVSGAAPN---------FLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDG--AKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            G  + +  E+VVINISGL FET    L++ P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNV  +IF  E+ FY++ +  I+ +++DEG   E    LP N+ ++ +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F     + H V     N         F D FFILET+C  WF+ E   RF +CPSK  F  +I N+IDV A+IPY++TL   L     DG   +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE   P+SQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   24 GEAEQECCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEMFREDEGFIKEEERPLPDNEFQKQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRSDEEEMHKVRTYNSNSTTSYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKASFFVNIMNMIDVVAIIPYFITLGTELAEKAEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:NCBI gene;Acc:103031324])

HSP 1 Score: 384.415 bits (986), Expect = 1.041e-127
Identity = 190/388 (48.97%), Postives = 262/388 (67.53%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSH--------------CVSGAAP----NFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            E+VVINISGL FET     ++ P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+I+RPVNVP ++F  E+ FYQ+ +  ++ +++DEG   E    LP+ + +R +W+LFE+PE+S  A  +A++SV   ++SIV+FC+ET P F                    +G AP     F D FF++ET+C  WF+ E+  RF +CPSK  F K+I NIID+ A+IPY++TL   L     +G +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE  +P S   SIPDAFWWA++TM TVGYGD  P  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   68 ERVVINISGLRFETQLKTFSQFPDTLLGDPRKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDVFSEEIRFYQLGEEAMEKFREDEGFIKEEERPLPSREFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDDREAAAAAAAAAAAVPLNNGTAPYGPGAFTDPFFVIETLCIVWFSFELLVRFFACPSKATFSKNIMNIIDIVAIIPYFITLGTELAERQGNG-QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPASSFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 454          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: kcna2b (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:103039676])

HSP 1 Score: 382.489 bits (981), Expect = 1.838e-127
Identity = 193/389 (49.61%), Postives = 262/389 (67.35%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF-NKSHCVSGAAPN------------FLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDG--AKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L++ P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNV  +IF  E+ FY++ +  I+ +++DEG   E  + LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F N    +    P             F D FFILET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     DG   +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE    DSQ  SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   28 HECCERVVINISGLRFETQLKTLSQFPDTLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEIFREDEGFIKEEEKPLPENEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRNDDIDMRKTYPGNSNSTTSYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKAGFFVNIMNIIDIVAIIPYFITLGTELAESPEDGQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEADSQFVSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: ENSAMXT00000027012.2 (potassium voltage-gated channel subfamily A member 2-like [Source:NCBI gene;Acc:103027793])

HSP 1 Score: 377.096 bits (967), Expect = 7.575e-125
Identity = 198/437 (45.31%), Postives = 280/437 (64.07%), Query Frame = 1
Query:  307 SLSSNDSGSEKKRRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF------------------------NKSHC---VSGAAPNFL------DVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLV--TFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++ S D   E+   NA++    R  P +++  E+VVINISGL FET    L + P TLLGDP KR+ Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP ++F  E+ FY++ +  ++ +++DEG   E    LP  + +R +W+LFE+PE+S  A  +A++SV   ++SIV+FC+ET P F                        N+ H    ++G  P  L      D FF++ET+C  WF+ E+  RF +CPSK  F K+I NIID+ A+IPY++TL   L        G +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE  +PDS   SIPDAFWWA++TM TVGYGD  P  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   49 TVVSCDGAPEEPNSNAVD----RYEP-EHECCERVVINISGLRFETQLKTLAQFPETLLGDPRKRTAYFDPLRNEYFFDRNRPSFDAILYYYQSGGRVRRPVNVPIDVFTEEIRFYELGEEAMEKFREDEGFIKEEERALPAGEFQRQVWLLFEYPESSGPARGIAIVSVLVILVSIVIFCLETLPEFRDDDSDVTRDRVGTTPLHMLNHYPNEMHGHGNLTGGLPPILSGTPFSDPFFVVETLCIVWFSFELLVRFFACPSKATFSKNIMNIIDIVAIIPYFITLGTELAERQQGNGGGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPDSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 480          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: kcna1a (potassium voltage-gated channel subfamily A member 1 [Source:NCBI gene;Acc:103039047])

HSP 1 Score: 369.007 bits (946), Expect = 2.659e-122
Identity = 187/388 (48.20%), Postives = 263/388 (67.78%), Query Frame = 1
Query:  388 QYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKS-----HCVSGAA----PNFL-DVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVT--FDCDG-AKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
             +D  E+VVINI+GL FET    L + P TLLG+P KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RP +VP ++F  E+ FY++    ++ +++DEG   E    LP  + +R IW+LFE PE+S  A  +A++SV   ++SIV+FC+ET P   ++       +  +     P+ L D FFI+ET+C  WF+ E+  RF++CPSK  F KD+ N IDV A+IPY++TL   L     + DG  +++ SLA LRVIRL+RVF   KL++HS GLQ+L LT +AS+  LGL +  L + +ILFSS +Y+AE    DS   SIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 DHDCCERVVINIAGLRFETELKTLAQFPETLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPASVPLDMFSEEIKFYELGYEAMEKFREDEGFIREKERPLPEAEFQRQIWLLFEHPESSGPARGIAIVSVTVILVSIVIFCLETLPQLKENPEGHIQIIGNSTFYYKPSLLTDPFFIVETLCIIWFSFELIVRFLACPSKAAFFKDMMNTIDVVAIIPYFITLGTELAEDPNNKDGKGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGLTLKASMRELGLLVFFLFIGVILFSSAVYFAEAEEADSYFGSIPDAFWWAVVSMTTVGYGDMVPVTIGGKVVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 365.925 bits (938), Expect = 1.414e-121
Identity = 184/389 (47.30%), Postives = 268/389 (68.89%), Query Frame = 1
Query:  382 PFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNK-------SHCVSGAA----PNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTL-TNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            P  +D  E+VVIN+SGL FET    L + P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPV+VP +IF  E+ FY + +  +  Y++DEG+  E  + LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SI++FC+ET P F         S+  +G        F D FFI+ET+C  WF+ E+  RF +CPSKV+F K++ NIID+ A++PY++TL T +         +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T  AS+  LGL +  L + +ILFSS +++AEV +  ++ +SIPDAFWW+++TM TVGYGD  P+ + GK+VGS+CA++GVLT+++PVP+I  NFN FY  +T
Sbjct:   31 PGGHDFCERVVINVSGLRFETQLRTLAQFPDTLLGDPQKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVSVPYDIFTEEVRFYDLGEETMLRYREDEGYVKEPEKPLPENEFQRQVWLLFEYPESSSPARAIAIVSVLVILISIIIFCLETLPEFRDDADLYKVSYYTNGTHYFYHNVFADPFFIMETICIIWFSFELMVRFCACPSKVEFGKNLMNIIDIVAIVPYFITLGTEMAEQTGSANGQQTMSLAILRVIRLVRVFRIFKLSRHSKGLQILGHTLHASMRELGLLIFFLFIGVILFSSAVFFAEVDSKKTEFQSIPDAFWWSLVTMTTVGYGDMSPKTVGGKIVGSLCAIAGVLTVSLPVPVIVSNFNYFYQRET 419          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 365.155 bits (936), Expect = 1.703e-121
Identity = 184/400 (46.00%), Postives = 268/400 (67.00%), Query Frame = 1
Query:  355 LEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF--------------NKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            LE     + P  ++  E++VIN+SGL FET    L++ P TLLG+PSKRS Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNV  ++F  E+ FY++    +  +++DEG   E  + LP+++ +R +W+LFE+PE+S  A  +A++SV   ++SI++FC+ET P F              N +        +F D FFI+ET+C  WF+ E+  RF +CPSK  F K I NIID+ A++PY++TL   +      G +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE  + +S+  SIPDAFWWA++TM TVGYGD  P  + GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   12 LEDGPETAEPLTHEYCERIVINVSGLRFETQLKSLDQFPDTLLGNPSKRSRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVSIDVFSEEIKFYELGNEAMAKFQEDEGFIKEEEKPLPSDEFQRQVWLLFEYPESSNPARGIAIVSVLVILISIIIFCLETLPEFRDEKEQKFLPAKDINGTQVKIMHGSSFTDPFFIVETICIIWFSFELLVRFFACPSKPGFFKSIMNIIDIVAILPYFITLGTEMAKHQGSG-QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADHQNSEFRSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 410          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 326.25 bits (835), Expect = 2.465e-107
Identity = 173/379 (45.65%), Postives = 242/379 (63.85%), Query Frame = 1
Query:  457 LNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPN-------------------------FLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFD--CDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            L   P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+ GK++RP NVP +IF  E+ FY++ +  +  Y++DEG+  E  + LP N ++R +W+LFE+PE+S  A  +A++SV   V+SIV+F  ET P F     +     +                           D FFI+ETVC  WF+ E+  RF +CPSK  F K+I N ID+ A++PY++TL   L   D   +  +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T RAS+  LGL +  L + +ILFSS IY+AEV +P++   SIP+AFWW+++TM TVGYGD  P  + GK+VGS+CA++GVLT+A+PVP+I  NFN FY   +
Sbjct:    5 LAHFPDTLLGDPQKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSRGKLRRPTNVPYDIFAEEVRFYELGEETMARYREDEGYVKEEEKPLPENALQRQVWLLFEYPESSNPARVIAIVSVLVIVISIVIFVAETLPEFRDDKDLHSGTRHDVGAGDAAVAAAGNSSGGSSGGGSGHADPFFIVETVCIVWFSFELLVRFCACPSKPGFFKNIMNTIDIVAIMPYFITLGTELAAQDTGANNGQQTMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVILFSSAIYFAEVDDPNTHFHSIPEAFWWSLVTMTTVGYGDMFPVTLGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRGS 383          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 321.242 bits (822), Expect = 7.795e-106
Identity = 152/378 (40.21%), Postives = 237/378 (62.70%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNF--------LDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLR 1512
            ++VVIN+SG  FET    L++ P +LLG P KR+ Y+D  + EYFFDR    F++I  YYQ+GG++ +PV+VP ++F  E++FY++ +  +  Y ++   T E   +     ++ +W LFE  + S++A  ++++S   T+LSI + C+ET P F K + V      F        LD FF+LET C  WF  E++ RF +CPSK  F+KD  N ID+ A++PY++T+  VL         +   L  +R++R++R+FKL++H   LQ+L LT +AS+  L +    L V++++FS  IYY E  +P     SIPDAFWWA++TM  VGYGD  P  + GK+VG++CA++GVLT+++PVP+I  NF  FY+ K   ++
Sbjct:    1 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVAKYGENTLDTPEEENVHGKDFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSIRTSIYNLDPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITV--VLEIMQQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVEADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYNLKNKDIK 376          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 320.857 bits (821), Expect = 9.469e-106
Identity = 152/378 (40.21%), Postives = 237/378 (62.70%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNF--------LDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLR 1512
            ++VVIN+SG  FET    L++ P +LLG P KR+ Y+D  + EYFFDR    F++I  YYQ+GG++ +PV+VP ++F  E++FY++ +  +  Y ++   T E   +     ++ +W LFE  + S++A  ++++S   T+LSI + C+ET P F K + V      F        LD FF+LET C  WF  E++ RF +CPSK  F+KD  N ID+ A++PY++T+  VL         +   L  +R++R++R+FKL++H   LQ+L LT +AS+  L +    L V++++FS  IYY E  +P     SIPDAFWWA++TM  VGYGD  P  + GK+VG++CA++GVLT+++PVP+I  NF  FY+ K   ++
Sbjct:    5 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVAKYGENTLDTPEEENVHGKDFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSIRTSIYNLDPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITV--VLEIMQQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVEADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYNLKNKDIK 380          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK4 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHB6])

HSP 1 Score: 339.347 bits (869), Expect = 5.833e-112
Identity = 188/383 (49.09%), Postives = 249/383 (65.01%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSH-----CVSGA-AP---NFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLR 1512
            ++++IN+SGL FET    L  +P TLLG+  KR+ YYD  R EYFFDR RPAF++I  YYQ+GGK+ RP NVP ++F  E+ FY++   V+   +++EG+  E    LP NK++R IW LFEFP+TS+ A  VA+ SV    LSIV FC+ET P F K        V+G   P    F   +F +ET C  WFT E   R IS P K+ FI+   N+ID+ A++PYY+TL             K++SL  LRVIRL+RVF   KL++HS GLQ+L  T RAS+  LGL +  L + +ILFSS +YYAE G   +  +SIPDAFWWA++TM TVGYGD  P  + GK+VGS+CA+SGVLT+A+PVP+I  NFN FY H+    R
Sbjct:   58 DRILINVSGLKFETHVQTLESNPDTLLGNAVKRAKYYDSVRNEYFFDRNRPAFDAILFYYQSGGKLLRPANVPMDVFADEIRFYELGDDVLHKVEQEEGYIEEEKPILPENKLQRQIWQLFEFPDTSMPARFVAIFSVFVITLSIVTFCIETLPQFQKKEEDLYVSVNGTLVPVDNRFDQPWFSMETACIIWFTFEYIMRLISSPQKLIFIRSFLNMIDIVAILPYYITLPM--------QDTKASSLGVLRVIRLVRVFRIFKLSRHSRGLQILGHTLRASLRELGLLIFFLLIGVILFSSAVYYAEGGEKGTHFKSIPDAFWWAVVTMTTVGYGDMRPITVWGKIVGSLCAISGVLTIALPVPVIVSNFNYFY-HRENEQR 431          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAKR1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3Y6])

HSP 1 Score: 311.612 bits (797), Expect = 3.784e-102
Identity = 167/375 (44.53%), Postives = 242/375 (64.53%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSV----IDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGR 1506
            ++V IN+SG+ +ET    L+  PT+LLG   KRS+Y+D  ++EYFFDR R AF+SI  +YQ+ GK+ RPV++  + F+ E+ F+++E  V    I+AY  D   T  V ++P N I+R IW + E P +S +A  VAV SV   +LSIV+FC+ET P   ++     +A       + +E +C  WFT+E+  RF++CP+K  FI    NIIDV A++PYY+ L            K +++LAFLR++RL+RVF   KL++H  GL+VL LT +AS+  L L    L + +I+FSS +YYAE     +   SIP+AFW++++TM TVGYGDK P    GKLVGS+CA++GVLTLA+PVP+I  NF+ FY+    R
Sbjct:    1 KRVKINVSGMVYETLESTLDRFPTSLLGCREKRSVYFDSMKKEYFFDRNRVAFDSILYFYQSNGKLLRPVDLDMKTFVNEVYFFELEDLVSHQFIEAYGSD---TSLVSKMPDNAIQRKIWEVLELPHSSFTAQVVAVWSVGVILLSIVVFCIETLPGLRETRTEKSSA------LYSIEILCVAWFTLELLLRFLTCPNKPHFIISFLNIIDVLAILPYYIML-------GLGDTKDTSTLAFLRILRLVRVFRIFKLSRHYRGLKVLGLTLKASLRELLLLTFFLLMGVIVFSSGVYYAE----STHFSSIPEAFWFSVVTMTTVGYGDKAPLSTWGKLVGSMCAIAGVLTLALPVPVIVSNFSFFYNQDRDR 355          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFM4])

HSP 1 Score: 311.227 bits (796), Expect = 6.822e-102
Identity = 168/380 (44.21%), Postives = 236/380 (62.11%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQI-EKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF----------NKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVG-NPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHK 1497
            +++ INISGL +ET+   L   P +LLG  S+R  +YD    EYFFDR R  FESI  YYQ  G + RP N+P ++F++++ ++ + E+++  A    E    E+  +P NK +R++W LFE P+TS  A  +A+ SVA  VLSIVLFCVET P F          N +  +    P    VFF +E+ C  WFT+E   RF+  P K KF+  + N+ID+ A++P+++TL     T         +SLA LR +RL+RVF   KL+++S GLQ+L  T +AS+  LGL    L V +ILFSS +YYAE   N D++  SIP +FWW+IITM TVGYGD  P+ + GKLVG  CA+SGVL +A+PVP+I  NF  +YS +
Sbjct:    1 KRITINISGLRYETFDKTLERFPESLLGCKSRRDDFYDSVNDEYFFDRNRLCFESILAYYQTCGVLIRPPNIPRKVFVSDIKYFDLGEQALRQAGDDLEITDREIRPMPKNKFQRTVWSLFEHPDTSNGARAIAIFSVAVIVLSIVLFCVETLPQFQRRPKEVLRNNITETIMIDNPK-KSVFFAIESFCIAWFTLEYFIRFLCSPDKCKFVVSVLNLIDLVAILPFFITLPMTEPT-------SVSSLAILRCVRLVRVFRIFKLSRYSRGLQILGHTLKASLRELGLLFFFLCVGVILFSSAVYYAEYNYNRDTEFLSIPHSFWWSIITMTTVGYGDMAPKTLGGKLVGCFCAISGVLAIALPVPVIVSNFAYYYSRE 372          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK45])

HSP 1 Score: 310.842 bits (795), Expect = 1.925e-101
Identity = 170/386 (44.04%), Postives = 237/386 (61.40%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFN-KSHCVSGAAPNFL----------------DVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHK 1497
            ++++IN+SGL FET+   L + P TLLG  SKR  Y+D    EYFFDR R  FE+I  +YQ+ GK+ RP  VP  +F  E+ F+++ K  +   +++EG+  E    LP + ++R IW LFE+P++S+ A  +AV SV+  ++SIV+FC+ET P F  K+       P  L                  +  LE +C  WFT+E   R +S P K+ F++   N+ID+ A++PYY+TL             +  SLA LRVIRL+RVF   KL++HS GLQVL  T RAS   L + +  L +S++LFSS +YYAE     S+  SIPDAFWWA++TM TVGYGD  P    GKLVGS+CA+SGVLT+A+PVP+I  NFN FY  +
Sbjct:    1 KRIIINVSGLRFETYEATLAQFPNTLLGSESKREEYFDSDADEYFFDRNRSTFEAILFFYQSNGKLVRPSGVPFLLFKDEVIFFKLGKDNLKRLEEEEGYIEETTRVLPRHHLQRRIWELFEYPDSSMGARVLAVWSVSVILISIVVFCIETLPTFRCKTSPDGNGCPKLLPGTNSTADHPEPVEKSSAWLALEILCIAWFTLEYVVRLLSSPQKLLFVRSFLNVIDLMAILPYYITLPM--------KDLRITSLAVLRVIRLVRVFRIFKLSRHSRGLQVLGHTLRASSRELAMLIFFLLISVVLFSSAVYYAEEEEAASKFSSIPDAFWWAVVTMTTVGYGDMYPVTPWGKLVGSICAISGVLTIALPVPVIVSNFNYFYKRE 378          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK5 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS8])

HSP 1 Score: 300.827 bits (769), Expect = 9.540e-98
Identity = 160/385 (41.56%), Postives = 234/385 (60.78%), Query Frame = 1
Query:  406 KVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKK---DEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF-----------------NKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRV---FKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQI-ESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFY 1488
            +V +N+SG  ++T+   L++ PTTLLGDP+KR  Y+D    EYFFDR +  FE I  +YQ+ G++  P ++  EI L E++F+ + ++ I+A K+   DE       ++PTNKI+   W LFE+ ++S +A  +A+ SV+  V SI + CVET P F                 NK +  +  A  +   F  LE     WFT+E   RF+S P K  F++   N+ID+ A++P+Y+     L+         + SLAFLR++RL+RV   FKL++HS GLQ+L LT R S+  LGL +  L + +++FSS  YYAE G  D+ +  SIPD FWWA++TM TVGYGD VP+ + GKLVGS CA+ GVL +A+PVP+I  NF+  Y
Sbjct:    1 RVTLNVSGFRYQTYVETLDKFPTTLLGDPAKRREYFDPDLNEYFFDRNKQVFEIILYFYQSNGRLVCPPDLAPEILLEEVEFFDLGETAINAVKELLTDEEPDETPRDMPTNKIQTQFWNLFEYADSSKAARVIALFSVSIIVASIAVLCVETLPNFAILPIHDPNNTEEVRRVNKHNEGAILARRW---FGYLEAAFIAWFTLEYLVRFLSSPKKCPFVRSFLNVIDILAIVPFYID----LILNSVQSNDGTLSLAFLRILRLVRVFRIFKLSRHSSGLQILGLTLRKSLRELGLLIFFLFIGVVIFSSMAYYAEAGTKDTHLGRSIPDTFWWALVTMTTVGYGDLVPKTLWGKLVGSCCALCGVLAIALPVPVIVSNFDAIY 378          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: ENSORLT00000004658.2 (pep primary_assembly:ASM223467v1:6:13425755:13435070:-1 gene:ENSORLG00000003738.2 transcript:ENSORLT00000004658.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 395.971 bits (1016), Expect = 2.231e-133
Identity = 196/387 (50.65%), Postives = 270/387 (69.77%), Query Frame = 1
Query:  382 PFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF---------NKSHCVSGAAPN-FLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            P   +  E++VINISGL FET    L+  PTTLLGDP KR  +YD  R EYFFDR RP+F++I  YYQ+GG+++RPV+VP +IFL EL FY++E+ VI+ +K DEG   E    LP+N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV+FC+ET P F         + +    G  P+ F D FF++ET+C  WF+ E   RF+SCPSK  F K+I N+IDV A+ PY++TL   L       ++++ASLA LRVIRL+RVF   KL++HS GLQ+L  T RAS+  LGL +  L + ++LFSS++Y+AEV +P+S+  SIPDAFWWA++TM TVGYGD  P  I GK VGS+CA++GVLT+A+PVP+I  NFN FY  + 
Sbjct:   26 PADQECSERLVINISGLRFETQLKTLSRFPTTLLGDPRKRIRFYDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVSVPVDIFLEELKFYELEEEVIELFKDDEGLPREEERPLPSNEFQRQVWLLFEYPESSGPARMIAIVSVMVILISIVIFCLETLPEFKDVPPEPDNHANGSAHGKEPSPFTDPFFMVETLCIVWFSFEFMMRFLSCPSKPVFFKNIMNLIDVVAIAPYFITLGMDLAEHQ-GSSQQAASLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASLRELGLLIFFLIIGVVLFSSSVYFAEVEDPNSEFSSIPDAFWWAVVTMTTVGYGDMCPTTIGGKFVGSLCAIAGVLTIALPVPVIVSNFNYFYHREN 411          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 390.963 bits (1003), Expect = 3.708e-131
Identity = 196/390 (50.26%), Postives = 265/390 (67.95%), Query Frame = 1
Query:  403 EKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFF-------NKSHC-----------VSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDG--AKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            E+VVINISGL FET    L++ P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNV  +IF  E+ FY++ +  I+ +++DEG   E    LP N+ +R +W+LFE+PE+S  A  +A++SV   ++SIV FC+ET P F       +KSH            +S  +  F D FFILET+C  WF+ E   RF +CPSK  F  +I NIID+ A+IPY++TL   L     DG   +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE   P+SQ ESIPDAFWWA+++M TVGYGD VP  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   29 ERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVTLDIFSEEIRFYELGEEAIEMFREDEGFIKEEERPLPDNEFQRQVWLLFEYPESSGPARIIAIISVMVILISIVSFCLETLPIFRNDEDDMHKSHAKVFSPETNTTIISYTSTYFTDPFFILETLCIIWFSFEFLVRFFACPSKAGFFGNIMNIIDIVAIIPYFITLGTELADRPEDGQPGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFESIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 418          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3-like [Source:NCBI gene;Acc:105354379])

HSP 1 Score: 388.652 bits (997), Expect = 2.083e-129
Identity = 191/386 (49.48%), Postives = 267/386 (69.17%), Query Frame = 1
Query:  391 YDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSH--------CVSGAAPNFL----DVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            ++  E+VVINISGL FET    L++ P TLLGDP KR  Y+D  R EYFFDR RP+F++I  YYQ+GG+I+RPVNVP +IF  E+ FY++ +  ++ +++DEG   E    LP N+ +R +W+LFE+PE+S  A  VA++SV   ++SIV+FC+ET P F   +         ++G  P F+    D FF++ET+C  WF+ E+  RF +CPSK  F K+I NIID+ A++PY++TL   L     +G +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE  +P S   SIPDAFWWA++TM TVGYGD  P  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   70 HECCERVVINISGLRFETQLKTLSQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYELGEEAMEKFREDEGFIKEEERPLPENEFQRQVWLLFEYPESSGPARGVAIVSVLVILISIVIFCLETLPEFRDENNDVITLAPVINGTVPYFISPFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSKNIMNIIDIVAIVPYFITLGTELAERQGNG-QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 454          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: ENSORLT00000025729.2 (shaker-related potassium channel tsha2 [Source:NCBI gene;Acc:101167693])

HSP 1 Score: 385.956 bits (990), Expect = 4.112e-129
Identity = 190/386 (49.22%), Postives = 266/386 (68.91%), Query Frame = 1
Query:  394 DLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVET-------------HPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            D  E+VVINISGL FET    L + P TLLGDP KR  ++D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP +IF+ E+ FY++ + VI+ +K+DEG   E    LP ++ +R +W+LFE+PE+S +A  +A++SV   ++SIV+FC+ET              P+ N +     A P F D FFI+ET+C  WF+ E+  RF++CPSK  F K+I N ID+ A++PY++TL   L     +G +++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS +Y+AE  +P S   SIPDAFWWA+++M TVGYGD  P  I GK+VGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   33 DCCERVVINISGLRFETQLKTLAQFPATLLGDPRKRMRFFDPLRNEYFFDRNRPSFDAIVYYYQSGGRLRRPVNVPVDIFMEEIKFYELGEEVIENFKEDEGFIKEEERPLPEHEFQRQVWLLFEYPESSGAARGIAIVSVLVILISIVIFCLETLPEFREDARDLEAQPYVNGTASADRANP-FTDPFFIVETLCIIWFSFELLVRFLACPSKPAFFKNIMNTIDIVAIMPYFITLGLELAEHQGNG-QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPHSGFSSIPDAFWWAVVSMTTVGYGDMCPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: ENSORLT00000008056.2 (pep primary_assembly:ASM223467v1:5:13015115:13021828:-1 gene:ENSORLG00000006413.2 transcript:ENSORLT00000008056.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 384.8 bits (987), Expect = 7.395e-128
Identity = 198/422 (46.92%), Postives = 272/422 (64.45%), Query Frame = 1
Query:  307 SLSSNDSGSEKKRRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEV-IELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKS--------HCVSGAAPN----------FLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCD--GAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            S S  DS   K  ++  +   L    +  D  EKVVINISGL FET    LN+ P TLLGDP KR  Y+D  + EYFFDR RP+F+ I  YYQ+GG+++RP NVP +IF  E+ FY++    ++ +++DEG T E  + LPTN++KR  W+LFE+PE+S +A   A++SV   V+SI +FC+ET P F +           ++G   +            D FFI+ET+C  WF  EV  RF+ CPSK +F  +I NIID+ ++IPY+VTL   L T   D   + ++ SLA LR+IRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L + +ILFSS IY+AEV  P +Q  SIPD FWWA++TM TVGYGD  P  + GK+VG++CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   52 SESPTDSVFSKMPKDYYDNEDLFEKHYMEDKDEKVVINISGLMFETQLSTLNKFPETLLGDPMKRINYFDPMKNEYFFDRNRPSFDGILYYYQSGGRLRRPANVPLDIFANEIVFYELGHEAMEQFREDEGFTKEPEVLLPTNELKRQFWLLFEYPESSSAARAFALVSVLVIVISIFIFCLETLPEFREEKDFPSGIIQIINGTQDSSTHHSKVVAYLTDPFFIVETICIIWFCFEVGVRFVVCPSKSEFFNNIMNIIDIVSIIPYFVTLGTELGTTPDDDPNSGQNMSLATLRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAIYFAEVDEPQTQFVSIPDGFWWAVVTMTTVGYGDMCPITMGGKMVGTLCAIAGVLTIALPVPVIVSNFNYFYHRET 473          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000013562.1 (SMESG000013562.1)

HSP 1 Score: 962.985 bits (2488), Expect = 0.000e+0
Identity = 470/470 (100.00%), Postives = 470/470 (100.00%), Query Frame = 1
Query:  106 MFYNQSALDSNSGSIRYGRKNKIKQKETNKDEIFDYFSSINDERAIKFKGSTPKSNSFKIIWNSFKRSLSSNDSGSEKKRRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLRF 1515
            MFYNQSALDSNSGSIRYGRKNKIKQKETNKDEIFDYFSSINDERAIKFKGSTPKSNSFKIIWNSFKRSLSSNDSGSEKKRRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLRF
Sbjct:    1 MFYNQSALDSNSGSIRYGRKNKIKQKETNKDEIFDYFSSINDERAIKFKGSTPKSNSFKIIWNSFKRSLSSNDSGSEKKRRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLRF 470          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000014198.1 (SMESG000014198.1)

HSP 1 Score: 499.204 bits (1284), Expect = 1.363e-174
Identity = 235/366 (64.21%), Postives = 287/366 (78.42%), Query Frame = 1
Query:  415 INISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLR 1512
            IN+SG+ FE  T+ L  HPTTLLGD  K   Y+DK+  EYFFDR+RP FE+IF YYQ    +KRP +VPD+IFL EL F+QIEK V+  YK +EGH  E   LP  K ++ +W+LFE+PETS+ A+ + ++S+ FT++SI+LFCVET P F ++HCV G+APNFLD FF++ET CT WF++E   R + CPSK   IKD+KN +D+ A++PYYVTL NVL +F C GAK SASLAFLRVI+LIR+FKLTKHS GLQVL+ TFRASIE LGLF+VALS+ +ILFSS +YY E    DS I+SIP AFWWAIITMCTVGYGD VPQ  LGK+VGS CAV+GVLTLAIPVPIITENFNKFYSH+T R R
Sbjct:   48 INVSGMKFEIPTYKLKYHPTTLLGDSHKCKSYFDKRFNEYFFDRHRPTFEAIFVYYQYSCDLKRPFDVPDDIFLEELKFFQIEKEVVMKYKLEEGHVEETFVLPKGKYQQKLWILFEYPETSLLAYTIGLISMIFTLISIILFCVETLPVFKETHCVDGSAPNFLDSFFLIETFCTAWFSLEFIVRLVVCPSKNAHIKDLKNTVDIIAILPYYVTLVNVLYSFSCSGAKNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNR 413          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000014206.1 (SMESG000014206.1)

HSP 1 Score: 495.738 bits (1275), Expect = 3.830e-173
Identity = 234/366 (63.93%), Postives = 286/366 (78.14%), Query Frame = 1
Query:  415 INISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLR 1512
            IN+SG+ FE  T+ L  HPTTLLGD  K   Y+DK+  EYFFDR+RP FE+IF YYQ    +KRP +V D+IFL EL F+QIEK V+  YK +EGH  E   LP  K ++ +W+LFE+PETS+ A+ + ++S+ FT++SI+LFCVET P F ++HCV G+APNFLD FF++ET CT WF++E   R + CPSK   IKD+KN +D+ A++PYYVTL NVL +F C GAK SASLAFLRVI+LIR+FKLTKHS GLQVL+ TFRASIE LGLF+VALS+ +ILFSS +YY E    DS I+SIP AFWWAIITMCTVGYGD VPQ  LGK+VGS CAV+GVLTLAIPVPIITENFNKFYSH+T R R
Sbjct:   48 INVSGMKFEIPTYKLKYHPTTLLGDSHKCKSYFDKRFNEYFFDRHRPTFEAIFVYYQYSCDLKRPFDVLDDIFLEELKFFQIEKEVVMKYKLEEGHVEETFVLPKGKYQQKLWILFEYPETSLLAYTIGLISMIFTLISIILFCVETLPVFKETHCVDGSAPNFLDSFFLIETFCTAWFSLEFIVRLVVCPSKNAHIKDLKNTVDIIAILPYYVTLVNVLYSFSCSGAKNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNR 413          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000006565.1 (SMESG000006565.1)

HSP 1 Score: 475.707 bits (1223), Expect = 3.412e-165
Identity = 219/372 (58.87%), Postives = 293/372 (78.76%), Query Frame = 1
Query:  400 KEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDC-DGAKKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLR 1512
            K +V IN+SGL FETW   L+ HPTTLLG P+ R  ++D +R EYFFDR+R AFE IF+YY+ G KIKRP NVP+++FL+E++++++E +VI+ +  D+G+  E I+LP+N + + IW+LFE+PETS  A+ V ++S+  T++SI  FC+ET P ++K  C+     NFL  FFI ET+CT WFTIE+  R +SCP+  +++KD KN++D+ A+IPYY+TL N+L + +C DG K  +SLA LRVIRLIR+FKLTKHS GLQVL+LTF+AS+ GLG+FL+A+ VS++LFSSTIYY EV   DS I SIPDAFWW +ITMCTVGYGD VP+ ++G++VGS CAVSGVLTLA+ VPII+ENFNKFYSHKTGR R
Sbjct:   47 KSRVRINVSGLIFETWISDLDRHPTTLLGSPTLRKQHFDSRRNEYFFDRHRQAFEGIFHYYKYGDKIKRPANVPEDVFLSEMEYFKLEPNVINGFHHDQGYVFEKIKLPSNPLLQKIWVLFEYPETSGYAYAVGIVSLLLTIMSITAFCIETIPKYSKM-CIDNKNYNFLSGFFICETICTIWFTIEMIGRLVSCPNLKEYMKDCKNVMDIVALIPYYITLANMLFSDNCIDGKKGGSSLAILRVIRLIRIFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKFYSHKTGRGR 417          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000020672.1 (SMESG000020672.1)

HSP 1 Score: 391.734 bits (1005), Expect = 6.595e-131
Identity = 204/441 (46.26%), Postives = 282/441 (63.95%), Query Frame = 1
Query:  244 KFKGSTPKSNSFKIIWNSFKRSLS---SNDSGSEKKRRNALEYSSLRSGPFQYDLKEKVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRPAFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHTLEVIE-LPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVETHPFFNKSHCVSGA---------------APNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFIKDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVF---KLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKT 1500
            K  GS P ++ F    ++F +S+      ++  +K   NA           +YD+ E+V INISGL FET    L + P TLLG+  KR+ Y+D  R EYFFDR RP+F++I  YYQ+GG+++RPVNVP ++F  E+ FY++ +  I+ Y++DEG+  E I+ LP N  +R +W+LFE+PE+S+ A CVA+ SV   +LSIV+FC+ET P F     V+                  P F + FFI+ETVC  WFT E+  RF S P K+ F K I N+ID+ A+IPY++TL  V+   D     ++ SLA LRVIRL+RVF   KL++HS GLQ+L  T +AS+  LGL +  L +S+ILFSS +Y+AE     S   SIPDAFWWA++TM TVGYGD  P  + GKLVGS+CA++GVLT+A+PVP+I  NFN FY  +T
Sbjct:   11 KPSGSMPHNDFFYEKSHTFNQSMPKYPDEETPYDKVGENA-----------EYDI-ERVTINISGLRFETQLKTLGQFPNTLLGNALKRNQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPIDVFCEEIKFYELGEEAIEKYREDEGYIKEDIKILPENPFQRKVWLLFEYPESSMGARCVAICSVFVIILSIVIFCIETLPHFKHYRIVNSTFAGTNQSAYKIEEDDIPQFSEPFFIIETVCIIWFTFELLVRFSSSPEKLTFFKTIMNLIDIVAIIPYFITLGTVIAD-DSRSQNQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASVRELGLLVFFLLISVILFSSAVYFAEADADKSYFRSIPDAFWWAVVTMTTVGYGDMRPVTVWGKLVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 438          
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA21.339e-12748.60potassium voltage-gated channel subfamily A member... [more]
KCNA21.339e-12748.60potassium voltage-gated channel subfamily A member... [more]
KCNA21.339e-12748.60potassium voltage-gated channel subfamily A member... [more]
KCNA21.339e-12748.60potassium voltage-gated channel subfamily A member... [more]
KCNA21.339e-12748.60potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shk-12.279e-9741.50Potassium voltage-gated channel protein shk-1 [So... [more]
shk-12.279e-9741.50Potassium voltage-gated channel protein shk-1 [So... [more]
shk-12.336e-9741.50Potassium voltage-gated channel protein shk-1 [So... [more]
shk-18.681e-9741.50Potassium voltage-gated channel protein shk-1 [So... [more]
shk-12.588e-9641.40Potassium voltage-gated channel protein shk-1 [So... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sh4.441e-13043.58gene:FBgn0003380 transcript:FBtr0089657[more]
Sh1.581e-12946.77gene:FBgn0003380 transcript:FBtr0302903[more]
Sh1.581e-12946.77gene:FBgn0003380 transcript:FBtr0089661[more]
Sh1.581e-12946.77gene:FBgn0003380 transcript:FBtr0302902[more]
Sh1.754e-12946.77gene:FBgn0003380 transcript:FBtr0308200[more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcna2b3.591e-13050.13potassium voltage-gated channel, shaker-related su... [more]
kcna2a1.279e-12649.35potassium voltage-gated channel, shaker-related su... [more]
kcna2a1.279e-12649.35potassium voltage-gated channel, shaker-related su... [more]
CABZ01113981.17.596e-12650.53pep scaffold:GRCz11:KN150008.1:12653:14179:-1 gene... [more]
kcna1a4.551e-12146.53potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA31.929e-13048.88potassium voltage-gated channel subfamily A member... [more]
KCNA29.781e-12848.60potassium channel, voltage gated shaker related su... [more]
KCNA55.726e-12747.19potassium channel, voltage gated shaker related su... [more]
ENSXETT00000049277.18.627e-12749.48potassium channel, voltage gated shaker related su... [more]
fastkd33.122e-12448.81FAST kinase domains 3 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcna23.748e-12848.60potassium voltage-gated channel, shaker-related su... [more]
Kcna23.748e-12848.60potassium voltage-gated channel, shaker-related su... [more]
Kcna23.748e-12848.60potassium voltage-gated channel, shaker-related su... [more]
Kcna39.057e-12748.33potassium voltage-gated channel, shaker-related su... [more]
Kcna12.656e-12347.03potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08510|KCNAS_DROME4.452e-12943.58Potassium voltage-gated channel protein Shaker OS=... [more]
sp|Q09081|KCNA2_RABIT1.116e-12748.85Potassium voltage-gated channel subfamily A member... [more]
sp|P63142|KCNA2_RAT2.622e-12748.60Potassium voltage-gated channel subfamily A member... [more]
sp|P63141|KCNA2_MOUSE2.622e-12748.60Potassium voltage-gated channel subfamily A member... [more]
sp|P16389|KCNA2_HUMAN6.433e-12748.60Potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1CQP40.000e+067.00K+ channel tetramerization domain protein OS=Fasci... [more]
A0A074ZNJ50.000e+064.32BTB domain-containing protein OS=Opisthorchis vive... [more]
H2KQ480.000e+064.08Potassium voltage-gated channel protein Shaker OS=... [more]
A0A3R7CF380.000e+064.08Potassium voltage-gated channel subfamily A member... [more]
A0A504Y7100.000e+069.73Potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcna2a4.814e-12849.36potassium voltage-gated channel subfamily A member... [more]
KCNA31.041e-12748.97potassium voltage-gated channel subfamily A member... [more]
kcna2b1.838e-12749.61potassium voltage-gated channel subfamily A member... [more]
ENSAMXT00000027012.27.575e-12545.31potassium voltage-gated channel subfamily A member... [more]
kcna1a2.659e-12248.20potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA31.414e-12147.30potassium voltage-gated channel subfamily A member... [more]
KCNA31.703e-12146.00potassium voltage-gated channel subfamily A member... [more]
KCNA32.465e-10745.65potassium voltage-gated channel subfamily A member... [more]
kcna1b7.795e-10640.21potassium voltage-gated channel, shaker-related su... [more]
kcna1b9.469e-10640.21potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
SHAK45.833e-11249.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAKR13.784e-10244.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK66.822e-10244.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK31.925e-10144.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK59.540e-9841.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000004658.22.231e-13350.65pep primary_assembly:ASM223467v1:6:13425755:134350... [more]
kcna2a3.708e-13150.26potassium voltage-gated channel, shaker-related su... [more]
KCNA32.083e-12949.48potassium voltage-gated channel subfamily A member... [more]
ENSORLT00000025729.24.112e-12949.22shaker-related potassium channel tsha2 [Source:NCB... [more]
ENSORLT00000008056.27.395e-12846.92pep primary_assembly:ASM223467v1:5:13015115:130218... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013562.10.000e+0100.00SMESG000013562.1[more]
SMESG000014198.11.363e-17464.21SMESG000014198.1[more]
SMESG000014206.13.830e-17363.93SMESG000014206.1[more]
SMESG000006565.13.412e-16558.87SMESG000006565.1[more]
SMESG000020672.16.595e-13146.26SMESG000020672.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019915 ID=SMED30019915|Name=Potassium voltage-gated channel subfamily A member 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1623bp
GAGATTAACAACTGATTGGCTGTTCTATTTACCAGTAGGAAATTGAAATT
GAGTCTCTTCTGTTTCAACTCAGAGAATCAAATCTGACTTTGAGTTATTC
TATTAATGTTTTATAACCAAAGCGCACTAGACTCGAATTCTGGCTCAATT
AGATATGGGAGGAAAAATAAAATCAAACAAAAAGAAACGAATAAAGATGA
GATTTTTGATTATTTCTCAAGCATAAACGATGAAAGGGCAATTAAGTTCA
AAGGTTCCACACCGAAGTCAAATTCTTTCAAAATCATTTGGAATTCTTTC
AAACGATCTTTGTCAAGCAATGATTCAGGGAGTGAAAAAAAACGTCGAAA
TGCTCTTGAATATTCTTCTTTGAGAAGTGGACCGTTCCAATACGATTTAA
AGGAAAAGGTTGTAATTAACATCAGTGGATTAACGTTTGAGACTTGGACA
TGGATTCTGAATGAACATCCTACGACTCTTCTAGGTGATCCGAGCAAACG
GTCTATGTATTATGATAAAAAACGCCAGGAATATTTTTTCGACAGATATC
GGCCAGCTTTTGAATCGATCTTTAACTATTATCAAAATGGCGGTAAAATT
AAACGACCGGTCAATGTTCCAGATGAGATATTTCTTACTGAATTGGATTT
TTATCAAATCGAAAAATCTGTCATTGATGCTTATAAAAAGGATGAAGGAC
ATACTTTAGAGGTCATAGAGTTGCCAACTAACAAAATCAAACGAAGCATT
TGGATGCTTTTTGAATTTCCAGAAACATCCGTCAGTGCGTTTTGTGTAGC
CGTTTTGTCCGTTGCCTTTACTGTTTTATCAATCGTTCTCTTCTGTGTAG
AAACTCACCCATTTTTTAACAAAAGCCATTGTGTCAGCGGTGCCGCTCCT
AACTTCCTTGATGTTTTCTTCATTCTAGAGACTGTTTGTACATTTTGGTT
TACTATTGAAGTCAGTTTCAGATTTATTTCTTGTCCTTCTAAAGTGAAAT
TTATCAAGGATATTAAGAATATTATCGATGTCGCTGCAGTCATTCCATAC
TATGTAACGCTGACTAACGTTTTGGTCACTTTTGATTGTGACGGAGCTAA
AAAAAGTGCTTCCTTGGCATTCTTGCGTGTCATTCGTTTAATAAGAGTTT
TCAAACTGACAAAACATTCACCAGGATTGCAAGTTCTCATGTTAACATTT
CGAGCTAGTATTGAAGGTCTCGGATTATTTTTAGTAGCACTGAGTGTGTC
AATTATTTTATTTTCATCCACAATCTATTACGCAGAAGTCGGCAATCCTG
ATTCTCAAATTGAAAGCATTCCAGATGCATTTTGGTGGGCTATAATTACA
ATGTGCACAGTTGGATATGGTGACAAAGTTCCACAACAGATATTAGGAAA
ATTAGTCGGCAGTGTTTGTGCCGTCTCAGGGGTCCTTACGTTGGCTATTC
CAGTACCAATCATCACAGAAAACTTTAACAAATTCTATTCTCACAAAACG
GGCAGACTCCGCTTTTGAATTTTAATAAATGTTACTATGATAAATATATT
TCTCTCAGGAATTTTATATATTTTGTAATAAACTGTGTAATTTTTCAAGC
ACGTTTAATATATCATGCGGTAC
back to top

protein sequence of SMED30019915-orf-1

>SMED30019915-orf-1 ID=SMED30019915-orf-1|Name=SMED30019915-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=471bp
MFYNQSALDSNSGSIRYGRKNKIKQKETNKDEIFDYFSSINDERAIKFKG
STPKSNSFKIIWNSFKRSLSSNDSGSEKKRRNALEYSSLRSGPFQYDLKE
KVVINISGLTFETWTWILNEHPTTLLGDPSKRSMYYDKKRQEYFFDRYRP
AFESIFNYYQNGGKIKRPVNVPDEIFLTELDFYQIEKSVIDAYKKDEGHT
LEVIELPTNKIKRSIWMLFEFPETSVSAFCVAVLSVAFTVLSIVLFCVET
HPFFNKSHCVSGAAPNFLDVFFILETVCTFWFTIEVSFRFISCPSKVKFI
KDIKNIIDVAAVIPYYVTLTNVLVTFDCDGAKKSASLAFLRVIRLIRVFK
LTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDS
QIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPV
PIITENFNKFYSHKTGRLRF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR028325VG_K_chnl
IPR003968K_chnl_volt-dep_Kv
IPR003972K_chnl_volt-dep_Kv1
IPR000210BTB/POZ_dom
IPR027359Volt_channel_dom_sf
IPR005821Ion_trans_dom
IPR003131T1-type_BTB
IPR011333SKP1/BTB/POZ_sf
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0051260protein homooligomerization
GO:0006810transport
GO:0034765regulation of ion transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 442..453
score: 68.19
coord: 142..152
score: 68.33
coord: 347..355
score: 61.94
coord: 371..385
score: 35.06
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 273..296
score: 47.12
coord: 371..394
score: 43.56
coord: 299..319
score: 49.19
coord: 342..368
score: 49.94
coord: 431..457
score: 59.26
coord: 142..161
score: 54.28
coord: 222..250
score: 41.09
coord: 402..424
score: 65.4
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 355..465
e-value: 7.2E-31
score: 108.1
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 99..200
e-value: 1.5E-33
score: 116.9
NoneNo IPR availablePANTHERPTHR11537:SF113POTASSIUM VOLTAGE-GATED CHANNEL PROTEIN SHAKERcoord: 99..467
NoneNo IPR availableCDDcd18377BTB_POZ_Kv1_KCNAcoord: 100..184
e-value: 2.046E-43
score: 145.893
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 228..459
NoneNo IPR availableTMHMMTMhelixcoord: 226..248
NoneNo IPR availableTMHMMTMhelixcoord: 371..393
NoneNo IPR availableTMHMMTMhelixcoord: 306..325
NoneNo IPR availableTMHMMTMhelixcoord: 429..451
NoneNo IPR availableTMHMMTMhelixcoord: 408..422
NoneNo IPR availableTMHMMTMhelixcoord: 269..291
IPR003972Potassium channel, voltage dependent, Kv1PRINTSPR01496SHAKERCHANELcoord: 129..140
score: 46.75
coord: 219..235
score: 49.07
coord: 143..153
score: 71.62
coord: 242..253
score: 64.63
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 100..200
e-value: 1.8E-5
score: 34.2
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 201..354
e-value: 2.4E-40
score: 139.7
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 102..191
e-value: 5.6E-23
score: 81.1
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 230..464
e-value: 1.1E-39
score: 136.1
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 99..467
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 100..196