casein kinase I

Overview
Namecasein kinase I
Smed IDSMED30019896
Length (bp)1232
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of casein kinase I (SMED30019896) t-SNE clustered cells

Violin plots show distribution of expression levels for casein kinase I (SMED30019896) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of casein kinase I (SMED30019896) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for casein kinase I (SMED30019896) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019896

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30019896h1SMcG0002710 Contig49630newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019896h1SMcG0002710 Contig49630uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30019896h1SMcG0002710 dd_Smed_v4_1225_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019896h1SMcG0002710 dd_Smed_v4_1225_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30019896h1SMcG0002710 dd_Smed_v4_1225_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30019896h1SMcG0002710 dd_Smed_v4_1225_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019896h1SMcG0002710 dd_Smed_v4_1225_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of casein kinase I vs. Ensembl Human
Match: CSNK1A1 (casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:2451])

HSP 1 Score: 497.664 bits (1280), Expect = 7.983e-177
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. Ensembl Human
Match: CSNK1A1 (casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:2451])

HSP 1 Score: 496.508 bits (1277), Expect = 1.479e-176
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. Ensembl Human
Match: CSNK1A1 (casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:2451])

HSP 1 Score: 483.411 bits (1243), Expect = 1.090e-170
Identity = 229/339 (67.55%), Postives = 265/339 (78.17%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNK----------------------------LFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG +     YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNK                            LF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQE---KDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 342          
BLAST of casein kinase I vs. Ensembl Human
Match: CSNK1A1 (casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:2451])

HSP 1 Score: 482.256 bits (1240), Expect = 1.921e-170
Identity = 229/339 (67.55%), Postives = 265/339 (78.17%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNK----------------------------LFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNK                            LF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 342          
BLAST of casein kinase I vs. Ensembl Human
Match: CSNK1A1 (casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:2451])

HSP 1 Score: 481.1 bits (1237), Expect = 8.489e-170
Identity = 229/342 (66.96%), Postives = 265/342 (77.49%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLK-------------------------------ANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG +     YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLK                               A  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQE---KDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKRQCLTVLPRLVSNSWAQVILLLQHPKELGLQAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 345          
BLAST of casein kinase I vs. Ensembl Celegans
Match: kin-19 (Casein kinase I isoform alpha [Source:UniProtKB/Swiss-Prot;Acc:P42168])

HSP 1 Score: 491.886 bits (1265), Expect = 6.637e-175
Identity = 231/320 (72.19%), Postives = 266/320 (83.12%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGGLPGNSRAT 1037
            DF+VA K++L+RKIGSGSFGDIY+ + V+NGEEVA+KLES  ARHPQLLYESKVY+ LQ GVGIP IRWYG    + +YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM+ R+E++H KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D++T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R TLPWQGLKA  KKQKYE+I EKK +T ++ LCK FP EF  YL Y R L+FDE+P+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQS   S G+PG +  T
Sbjct:    9 DFIVATKYKLIRKIGSGSFGDIYVSINVTNGEEVAIKLESNRARHPQLLYESKVYRILQGGVGIPHIRWYG---TEREYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMIGRIEYVHVKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDSRTRTHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRGTLPWQGLKAATKKQKYEKISEKKMTTSVEHLCKGFPAEFPMYLSYTRGLRFDESPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKA----QQSQ--SSGVPGTNTTT 319          
BLAST of casein kinase I vs. Ensembl Celegans
Match: kin-19 (Casein kinase I isoform alpha [Source:UniProtKB/Swiss-Prot;Acc:P42168])

HSP 1 Score: 491.886 bits (1265), Expect = 6.637e-175
Identity = 231/320 (72.19%), Postives = 266/320 (83.12%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGGLPGNSRAT 1037
            DF+VA K++L+RKIGSGSFGDIY+ + V+NGEEVA+KLES  ARHPQLLYESKVY+ LQ GVGIP IRWYG    + +YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM+ R+E++H KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D++T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R TLPWQGLKA  KKQKYE+I EKK +T ++ LCK FP EF  YL Y R L+FDE+P+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQS   S G+PG +  T
Sbjct:    9 DFIVATKYKLIRKIGSGSFGDIYVSINVTNGEEVAIKLESNRARHPQLLYESKVYRILQGGVGIPHIRWYG---TEREYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMIGRIEYVHVKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDSRTRTHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRGTLPWQGLKAATKKQKYEKISEKKMTTSVEHLCKGFPAEFPMYLSYTRGLRFDESPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKA----QQSQ--SSGVPGTNTTT 319          
BLAST of casein kinase I vs. Ensembl Celegans
Match: kin-20 (Casein kinase I isoform delta [Source:UniProtKB/Swiss-Prot;Acc:Q20471])

HSP 1 Score: 392.504 bits (1007), Expect = 2.656e-136
Identity = 186/293 (63.48%), Postives = 229/293 (78.16%), Query Frame = 3
Query:   87 VAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLK 965
            V  ++RL RKIGSGSFGDIYLG  +   EEVAVKLE V ++HPQL  ES++Y+ +  G+GIP IRW G +G    YN +VM+LLGPSLEDLFNFC R+F++KTVL+LA+QML+RVEFIH +++IHRDIKPDNFLMG+G+  N ++++DFGL+K+Y+D+K + HI YRE+KNLTGTARYASIN H GIEQSRRDD+ES+GYVFMYF R TLPWQGLKA  K+QKYE I EKK ST +D LC  +P  F+ YL YCR+L F+E P+Y  LR  F  LF    F YDYVFDW   K
Sbjct:    5 VGNRFRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLGGIGIPEIRWCGQEG---DYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIHRDIKPDNFLMGLGKRGNLVYIIDFGLAKRYRDSKHQ-HIAYRENKNLTGTARYASINTHRGIEQSRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYCRSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDWNTYK 293          
BLAST of casein kinase I vs. Ensembl Celegans
Match: kin-20 (Casein kinase I isoform delta [Source:UniProtKB/Swiss-Prot;Acc:Q20471])

HSP 1 Score: 392.504 bits (1007), Expect = 2.656e-136
Identity = 186/293 (63.48%), Postives = 229/293 (78.16%), Query Frame = 3
Query:   87 VAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLK 965
            V  ++RL RKIGSGSFGDIYLG  +   EEVAVKLE V ++HPQL  ES++Y+ +  G+GIP IRW G +G    YN +VM+LLGPSLEDLFNFC R+F++KTVL+LA+QML+RVEFIH +++IHRDIKPDNFLMG+G+  N ++++DFGL+K+Y+D+K + HI YRE+KNLTGTARYASIN H GIEQSRRDD+ES+GYVFMYF R TLPWQGLKA  K+QKYE I EKK ST +D LC  +P  F+ YL YCR+L F+E P+Y  LR  F  LF    F YDYVFDW   K
Sbjct:    5 VGNRFRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLGGIGIPEIRWCGQEG---DYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIHRDIKPDNFLMGLGKRGNLVYIIDFGLAKRYRDSKHQ-HIAYRENKNLTGTARYASINTHRGIEQSRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYCRSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDWNTYK 293          
BLAST of casein kinase I vs. Ensembl Celegans
Match: kin-20 (Casein kinase I isoform delta [Source:UniProtKB/Swiss-Prot;Acc:Q20471])

HSP 1 Score: 392.889 bits (1008), Expect = 3.222e-136
Identity = 186/293 (63.48%), Postives = 229/293 (78.16%), Query Frame = 3
Query:   87 VAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLK 965
            V  ++RL RKIGSGSFGDIYLG  +   EEVAVKLE V ++HPQL  ES++Y+ +  G+GIP IRW G +G    YN +VM+LLGPSLEDLFNFC R+F++KTVL+LA+QML+RVEFIH +++IHRDIKPDNFLMG+G+  N ++++DFGL+K+Y+D+K + HI YRE+KNLTGTARYASIN H GIEQSRRDD+ES+GYVFMYF R TLPWQGLKA  K+QKYE I EKK ST +D LC  +P  F+ YL YCR+L F+E P+Y  LR  F  LF    F YDYVFDW   K
Sbjct:    5 VGNRFRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLGGIGIPEIRWCGQEG---DYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIHRDIKPDNFLMGLGKRGNLVYIIDFGLAKRYRDSKHQ-HIAYRENKNLTGTARYASINTHRGIEQSRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYCRSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDWNTYK 293          
BLAST of casein kinase I vs. Ensembl Fly
Match: CkIalpha (gene:FBgn0015024 transcript:FBtr0073680)

HSP 1 Score: 453.366 bits (1165), Expect = 1.155e-159
Identity = 207/299 (69.23%), Postives = 250/299 (83.61%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKA 974
            + +V  K+R++RKIGSGSFGDIYLG+++ +GEEVA+K+ES +ARHPQLLYE+K+Y+ L  GVG PRIR +G +     +N LVMDLLGPSLEDLFNFC R FT+KTVLML +QM+ R+E+IH K FIHRDIKPDNFLMGIGRHCNKLF++DFGL+KK++D  T+ HI YREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R  LPWQG+KAN K+QKYE+I EKK STPI++LCK  P EFS YL YCR+L+F+E P+Y  LR+ F  LFRTLN  YDY++DWT+LKQK 
Sbjct:   13 EIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKE---KNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKT 308          
BLAST of casein kinase I vs. Ensembl Fly
Match: CkIalpha (gene:FBgn0015024 transcript:FBtr0073682)

HSP 1 Score: 453.366 bits (1165), Expect = 1.155e-159
Identity = 207/299 (69.23%), Postives = 250/299 (83.61%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKA 974
            + +V  K+R++RKIGSGSFGDIYLG+++ +GEEVA+K+ES +ARHPQLLYE+K+Y+ L  GVG PRIR +G +     +N LVMDLLGPSLEDLFNFC R FT+KTVLML +QM+ R+E+IH K FIHRDIKPDNFLMGIGRHCNKLF++DFGL+KK++D  T+ HI YREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R  LPWQG+KAN K+QKYE+I EKK STPI++LCK  P EFS YL YCR+L+F+E P+Y  LR+ F  LFRTLN  YDY++DWT+LKQK 
Sbjct:   13 EIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKE---KNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKT 308          
BLAST of casein kinase I vs. Ensembl Fly
Match: CkIalpha (gene:FBgn0015024 transcript:FBtr0345163)

HSP 1 Score: 453.366 bits (1165), Expect = 1.155e-159
Identity = 207/299 (69.23%), Postives = 250/299 (83.61%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKA 974
            + +V  K+R++RKIGSGSFGDIYLG+++ +GEEVA+K+ES +ARHPQLLYE+K+Y+ L  GVG PRIR +G +     +N LVMDLLGPSLEDLFNFC R FT+KTVLML +QM+ R+E+IH K FIHRDIKPDNFLMGIGRHCNKLF++DFGL+KK++D  T+ HI YREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R  LPWQG+KAN K+QKYE+I EKK STPI++LCK  P EFS YL YCR+L+F+E P+Y  LR+ F  LFRTLN  YDY++DWT+LKQK 
Sbjct:   13 EIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKE---KNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKT 308          
BLAST of casein kinase I vs. Ensembl Fly
Match: CkIalpha (gene:FBgn0015024 transcript:FBtr0300380)

HSP 1 Score: 453.366 bits (1165), Expect = 1.155e-159
Identity = 207/299 (69.23%), Postives = 250/299 (83.61%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKA 974
            + +V  K+R++RKIGSGSFGDIYLG+++ +GEEVA+K+ES +ARHPQLLYE+K+Y+ L  GVG PRIR +G +     +N LVMDLLGPSLEDLFNFC R FT+KTVLML +QM+ R+E+IH K FIHRDIKPDNFLMGIGRHCNKLF++DFGL+KK++D  T+ HI YREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R  LPWQG+KAN K+QKYE+I EKK STPI++LCK  P EFS YL YCR+L+F+E P+Y  LR+ F  LFRTLN  YDY++DWT+LKQK 
Sbjct:   13 EIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKE---KNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKT 308          
BLAST of casein kinase I vs. Ensembl Fly
Match: CkIalpha (gene:FBgn0015024 transcript:FBtr0345162)

HSP 1 Score: 453.366 bits (1165), Expect = 1.155e-159
Identity = 207/299 (69.23%), Postives = 250/299 (83.61%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKA 974
            + +V  K+R++RKIGSGSFGDIYLG+++ +GEEVA+K+ES +ARHPQLLYE+K+Y+ L  GVG PRIR +G +     +N LVMDLLGPSLEDLFNFC R FT+KTVLML +QM+ R+E+IH K FIHRDIKPDNFLMGIGRHCNKLF++DFGL+KK++D  T+ HI YREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R  LPWQG+KAN K+QKYE+I EKK STPI++LCK  P EFS YL YCR+L+F+E P+Y  LR+ F  LFRTLN  YDY++DWT+LKQK 
Sbjct:   13 EIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKE---KNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKT 308          
BLAST of casein kinase I vs. Ensembl Zebrafish
Match: csnk1a1 (casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-020419-19])

HSP 1 Score: 496.123 bits (1276), Expect = 2.122e-176
Identity = 229/312 (73.40%), Postives = 264/312 (84.62%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGG 1013
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG +     YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA     Q    SGG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQE---KDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA----QQAASSGG 314          
BLAST of casein kinase I vs. Ensembl Zebrafish
Match: csnk1a1 (casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-020419-19])

HSP 1 Score: 495.738 bits (1275), Expect = 2.138e-176
Identity = 229/312 (73.40%), Postives = 264/312 (84.62%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGG 1013
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA     Q    SGG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA----QQAASSGG 314          
BLAST of casein kinase I vs. Ensembl Zebrafish
Match: csnk1a1 (casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-020419-19])

HSP 1 Score: 496.123 bits (1276), Expect = 2.323e-176
Identity = 229/312 (73.40%), Postives = 264/312 (84.62%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGG 1013
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA     Q    SGG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA----QQAASSGG 314          
BLAST of casein kinase I vs. Ensembl Zebrafish
Match: csnk1a1 (casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-020419-19])

HSP 1 Score: 481.871 bits (1239), Expect = 2.512e-170
Identity = 229/340 (67.35%), Postives = 264/340 (77.65%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNK----------------------------LFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGG 1013
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG +     YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNK                            LF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA     Q    SGG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQE---KDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSLAVSSSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA----QQAASSGG 342          
BLAST of casein kinase I vs. Ensembl Zebrafish
Match: csnk1a1 (casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-020419-19])

HSP 1 Score: 481.1 bits (1237), Expect = 2.931e-170
Identity = 229/340 (67.35%), Postives = 264/340 (77.65%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNK----------------------------LFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGG 1013
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNK                            LF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA     Q    SGG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSLAVSSSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA----QQAASSGG 342          
BLAST of casein kinase I vs. Ensembl Xenopus
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:407897])

HSP 1 Score: 496.893 bits (1278), Expect = 1.128e-176
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:    3 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 307          
BLAST of casein kinase I vs. Ensembl Xenopus
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:407897])

HSP 1 Score: 496.508 bits (1277), Expect = 1.341e-176
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. Ensembl Xenopus
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:407897])

HSP 1 Score: 496.893 bits (1278), Expect = 1.858e-176
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG +     YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQE---KDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. Ensembl Xenopus
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:407897])

HSP 1 Score: 495.738 bits (1275), Expect = 3.425e-176
Identity = 229/310 (73.87%), Postives = 264/310 (85.16%), Query Frame = 3
Query:   81 FVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:    9 FIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 312          
BLAST of casein kinase I vs. Ensembl Xenopus
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:407897])

HSP 1 Score: 494.967 bits (1273), Expect = 7.051e-176
Identity = 229/310 (73.87%), Postives = 264/310 (85.16%), Query Frame = 3
Query:   81 FVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:    9 FIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 312          
BLAST of casein kinase I vs. Ensembl Mouse
Match: Csnk1a1 (casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MGI:1934950])

HSP 1 Score: 498.049 bits (1281), Expect = 4.389e-177
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG +     YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQE---KDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. Ensembl Mouse
Match: Csnk1a1 (casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MGI:1934950])

HSP 1 Score: 497.664 bits (1280), Expect = 5.480e-177
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. Ensembl Mouse
Match: Csnk1a1 (casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MGI:1934950])

HSP 1 Score: 497.278 bits (1279), Expect = 8.315e-177
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. Ensembl Mouse
Match: Csnk1a1 (casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MGI:1934950])

HSP 1 Score: 496.508 bits (1277), Expect = 1.015e-176
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. Ensembl Mouse
Match: Csnk1a1 (casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MGI:1934950])

HSP 1 Score: 496.123 bits (1276), Expect = 9.877e-176
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG +     YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQE---KDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. UniProt/SwissProt
Match: sp|P67963|KC1A_XENLA (Casein kinase I isoform alpha OS=Xenopus laevis OX=8355 GN=csnk1a1 PE=1 SV=1)

HSP 1 Score: 497.664 bits (1280), Expect = 3.669e-176
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. UniProt/SwissProt
Match: sp|P67962|KC1A_CHICK (Casein kinase I isoform alpha OS=Gallus gallus OX=9031 GN=CSNK1A1 PE=2 SV=1)

HSP 1 Score: 497.664 bits (1280), Expect = 3.669e-176
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. UniProt/SwissProt
Match: sp|Q8BK63|KC1A_MOUSE (Casein kinase I isoform alpha OS=Mus musculus OX=10090 GN=Csnk1a1 PE=1 SV=2)

HSP 1 Score: 497.664 bits (1280), Expect = 3.834e-176
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. UniProt/SwissProt
Match: sp|P48729|KC1A_HUMAN (Casein kinase I isoform alpha OS=Homo sapiens OX=9606 GN=CSNK1A1 PE=1 SV=2)

HSP 1 Score: 497.664 bits (1280), Expect = 3.834e-176
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. UniProt/SwissProt
Match: sp|P67829|KC1A_SHEEP (Casein kinase I isoform alpha OS=Ovis aries OX=9940 GN=CSNK1A1 PE=3 SV=1)

HSP 1 Score: 496.508 bits (1277), Expect = 7.103e-176
Identity = 229/311 (73.63%), Postives = 265/311 (85.21%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSG 1010
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA    QQ+   SG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA---QQAASSSG 314          
BLAST of casein kinase I vs. TrEMBL
Match: A0A1I8IIR2 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027530g1 PE=3 SV=1)

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 247/300 (82.33%), Postives = 277/300 (92.33%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAV 977
            DF+V +K++L RKIGSGSFG+IYLGV++ NGEEVAVKLE V ARHPQLLYESKVYK LQDG+GIP IRWYG DGVKNQYN LVMDLLGPSLEDLF FC RRFTMKTVLMLA+QML RVEF+H+KNFIHRDIKPDNFLMGIGRHCNKLF+VDFGL+KKY+D++TKAHIPYR+DKNLTGTARYAS+NAHAGIEQSRRDD+ES+GYVFMYFLRS+LPWQGLKANNKKQKYERIYEKK STPI+ L + +PPEFS YL YCRNLKF+EAP+Y+ LRE+F  LFRTLNF +DYVFDWTLLKQ+A 
Sbjct:   11 DFIVGSKYKLTRKIGSGSFGEIYLGVSIINGEEVAVKLEPVTARHPQLLYESKVYKILQDGIGIPTIRWYGQDGVKNQYNCLVMDLLGPSLEDLFTFCSRRFTMKTVLMLADQMLCRVEFVHNKNFIHRDIKPDNFLMGIGRHCNKLFLVDFGLAKKYRDSRTKAHIPYRDDKNLTGTARYASVNAHAGIEQSRRDDLESLGYVFMYFLRSSLPWQGLKANNKKQKYERIYEKKVSTPIESLTRGYPPEFSRYLSYCRNLKFEEAPDYRWLRENFRILFRTLNFVFDYVFDWTLLKQRAT 310          
BLAST of casein kinase I vs. TrEMBL
Match: A0A267DVC4 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014970g1 PE=3 SV=1)

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 251/319 (78.68%), Postives = 281/319 (88.09%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGGLPGNSRA 1034
            DFVV  K++L RKIGSGSFG+IYLGV++ NGEEVAVKLE V ARHPQLLYESKVYK LQDG+GIP +RWYG DGVKNQYN LVMDLLGPSLEDLF FC RRFTMKTVLMLA+QML R+EF+H+KNFIHRDIKPDNFLMGIGRHCNKLF+VDFGL+KKY+D++TK HIPYR+DKNLTGTARYAS+NAHAGIEQSRRDD+ES+GYVFMYFLRS+LPWQGLKANNKKQKYERIYEKK STPI+ L K +PPEFS YL YCRNLKF+EAP+Y+ LRE+F  LFRTLNF +DYVFDWTLLKQ+A      +   S GL  N  A
Sbjct:   10 DFVVGGKYKLTRKIGSGSFGEIYLGVSIINGEEVAVKLEPVTARHPQLLYESKVYKILQDGIGIPSVRWYGQDGVKNQYNCLVMDLLGPSLEDLFTFCSRRFTMKTVLMLADQMLCRIEFVHNKNFIHRDIKPDNFLMGIGRHCNKLFLVDFGLAKKYRDSRTKTHIPYRDDKNLTGTARYASVNAHAGIEQSRRDDLESLGYVFMYFLRSSLPWQGLKANNKKQKYERIYEKKVSTPIESLTKGYPPEFSRYLSYCRNLKFEEAPDYRWLRENFRILFRTLNFVFDYVFDWTLLKQRAT-----TAASSAGLAANQPA 323          
BLAST of casein kinase I vs. TrEMBL
Match: A0A1I8H4N2 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014874g1 PE=3 SV=1)

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 247/300 (82.33%), Postives = 277/300 (92.33%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAV 977
            DF+V +K++L RKIGSGSFG+IYLGV+V NGEEVAVKLE V ARHPQLLYESKVYK LQDG+GIP IRWYG DG+KNQYN LVMDLLGPSLEDLF FC RRFTMKTVLMLA+QML RVEF+H+KNFIHRDIKPDNFLMGIGRHCNKLF+VDFGL+KKY+D++TKAHIPYR+DKNLTGTARYAS+NAHAGIEQSRRDD+ES+GYVFMYFLRS+LPWQGLKANNKKQKYERIYEKK STPI+ L + +PPEFS YL YCRNLKF+EAP+Y+ LRE+F  LFRTLNF +DYVFDWTLLKQ+A 
Sbjct:   11 DFIVGSKYKLTRKIGSGSFGEIYLGVSVINGEEVAVKLEPVTARHPQLLYESKVYKILQDGIGIPTIRWYGQDGLKNQYNCLVMDLLGPSLEDLFTFCSRRFTMKTVLMLADQMLCRVEFVHNKNFIHRDIKPDNFLMGIGRHCNKLFLVDFGLAKKYRDSRTKAHIPYRDDKNLTGTARYASVNAHAGIEQSRRDDLESLGYVFMYFLRSSLPWQGLKANNKKQKYERIYEKKVSTPIESLTRGYPPEFSRYLSYCRNLKFEEAPDYRWLRENFRILFRTLNFVFDYVFDWTLLKQRAT 310          
BLAST of casein kinase I vs. TrEMBL
Match: A0A1I8ICT7 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 557.755 bits (1436), Expect = 3.752e-178
Identity = 251/319 (78.68%), Postives = 281/319 (88.09%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGGLPGNSRA 1034
            DFVV  K++L RKIGSGSFG+IYLGV++ NGEEVAVKLE V ARHPQLLYESKVYK LQDG+GIP +RWYG DGVKNQYN LVMDLLGPSLEDLF FC RRFTMKTVLMLA+QML R+EF+H+KNFIHRDIKPDNFLMGIGRHCNKLF+VDFGL+KKY+D++TK HIPYR+DKNLTGTARYAS+NAHAGIEQSRRDD+ES+GYVFMYFLRS+LPWQGLKANNKKQKYERIYEKK STPI+ L K +PPEFS YL YCRNLKF+EAP+Y+ LRE+F  LFRTLNF +DYVFDWTLLKQ+A      +   S GL  N  A
Sbjct: 1510 DFVVGGKYKLTRKIGSGSFGEIYLGVSIINGEEVAVKLEPVTARHPQLLYESKVYKILQDGIGIPSVRWYGQDGVKNQYNCLVMDLLGPSLEDLFTFCSRRFTMKTVLMLADQMLCRIEFVHNKNFIHRDIKPDNFLMGIGRHCNKLFLVDFGLAKKYRDSRTKTHIPYRDDKNLTGTARYASVNAHAGIEQSRRDDLESLGYVFMYFLRSSLPWQGLKANNKKQKYERIYEKKVSTPIESLTKGYPPEFSRYLSYCRNLKFEEAPDYRWLRENFRILFRTLNFVFDYVFDWTLLKQRAT-----TAASSAGLAANQPA 1823          
BLAST of casein kinase I vs. TrEMBL
Match: A0A2T7NJD0 (Protein kinase domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19440 PE=3 SV=1)

HSP 1 Score: 502.671 bits (1293), Expect = 1.130e-175
Identity = 229/306 (74.84%), Postives = 267/306 (87.25%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQS 995
            +F+VA K+RLVRKIGSGSFGDIYLG+ ++NGEEVAVKLES+ ARHPQLLYESK+YK LQ GVGIP IR++G D     YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM+ R+E++H+KNFIHRDIKPDNFLMGIGRHCNK+FV+DFGL+KKY+D++T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R +LPWQGLKAN KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN+ YDY FDWT+LKQKA  + Q +
Sbjct:   17 EFIVAGKYRLVRKIGSGSFGDIYLGINITNGEEVAVKLESIKARHPQLLYESKLYKILQGGVGIPHIRFFGQD---KNYNELVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMIGRIEYVHNKNFIHRDIKPDNFLMGIGRHCNKVFVIDFGLAKKYRDSRTRTHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRGSLPWQGLKANTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNYQYDYTFDWTMLKQKAAAVAQST 319          
BLAST of casein kinase I vs. Ensembl Cavefish
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:103035793])

HSP 1 Score: 496.123 bits (1276), Expect = 1.798e-176
Identity = 229/312 (73.40%), Postives = 264/312 (84.62%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGG 1013
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG +     YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA     Q    SGG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQE---KDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA----QQAASSGG 314          
BLAST of casein kinase I vs. Ensembl Cavefish
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:103035793])

HSP 1 Score: 481.1 bits (1237), Expect = 2.484e-170
Identity = 229/340 (67.35%), Postives = 264/340 (77.65%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNK----------------------------LFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGG 1013
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNK                            LF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA     Q    SGG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSLAVSSSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA----QQAASSGG 342          
BLAST of casein kinase I vs. Ensembl Cavefish
Match: ENSAMXT00000001347.2 (casein kinase I [Source:NCBI gene;Acc:103041322])

HSP 1 Score: 433.721 bits (1114), Expect = 4.608e-151
Identity = 196/296 (66.22%), Postives = 242/296 (81.76%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLK 965
            D  V +K+RL RKIGSGSFGDIYLG  ++ GEEVA+KLE V  +HPQL  ESK YK +Q GVGIP I+W G +G    YN +VM+LLGPSLEDLFNFC R+F++KTVL+LA+QM++R+E+IHSKNFIHRD+KPDNFLMG+G+  N ++++DFGL+KKY+D +T  HIPYRE+KNLTGTARYASIN H GIEQSRRDD+ES+GYV MYF   +LPWQGLKA  K+QKYERI EKK STPI++LCK +P EFS YL +CR+L+FD+ P+Y  LR+ F NLF    F+YDYVFDW +LK
Sbjct:    2 DLRVGSKYRLGRKIGSGSFGDIYLGSNIATGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEG---DYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK 294          
BLAST of casein kinase I vs. Ensembl Cavefish
Match: csnk1e (casein kinase I-like [Source:NCBI gene;Acc:103024972])

HSP 1 Score: 434.491 bits (1116), Expect = 6.020e-151
Identity = 197/296 (66.55%), Postives = 243/296 (82.09%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLK 965
            +  V  K+RL RKIGSGSFGDIYLG  +++GEEVA+KLESV  +HPQL  ESK YK +Q GVGIP I+W G +G    YN +VM+LLGPSLEDLFNFC R+FT+KTVL+LA+QM++R+E+IHSKNFIHRDIKPDNFLMG+G+  N ++++DFGL+KKY+D +T  HIPYRE+KNLTGTARYASIN H GIEQSRRDD+ES+GYV MYF   +LPWQGLKA  K+QKYERI EKK STPI++LCK +P EFS Y+ +CR+L+FD+ P+Y  LR+ F NLF    F+YDYVFDW +LK
Sbjct:    2 ELRVGNKYRLGRKIGSGSFGDIYLGANITSGEEVAIKLESVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEG---DYNVMVMELLGPSLEDLFNFCSRKFTLKTVLLLADQMISRIEYIHSKNFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYMNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK 294          
BLAST of casein kinase I vs. Ensembl Cavefish
Match: csnk1e (casein kinase I-like [Source:NCBI gene;Acc:103024972])

HSP 1 Score: 431.409 bits (1108), Expect = 1.262e-150
Identity = 197/293 (67.24%), Postives = 242/293 (82.59%), Query Frame = 3
Query:   87 VAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLK 965
            V  K+RL RKIGSGSFGDIYLG  +++GEEVA+KLESV  +HPQL  ESK YK +Q GVGIP I+W G +G    YN +VM+LLGPSLEDLFNFC R+FT+KTVL+LA+QM++R+E+IHSKNFIHRDIKPDNFLMG+G+  N ++++DFGL+KKY+D +T  HIPYRE+KNLTGTARYASIN H GIEQSRRDD+ES+GYV MYF   +LPWQGLKA  K+QKYERI EKK STPI++LCK +P EFS Y+ +CR+L+FD+ P+Y  LR+ F NLF    F+YDYVFDW +LK
Sbjct:    5 VGNKYRLGRKIGSGSFGDIYLGANITSGEEVAIKLESVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEG---DYNVMVMELLGPSLEDLFNFCSRKFTLKTVLLLADQMISRIEYIHSKNFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYMNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK 294          
BLAST of casein kinase I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008477.1 (pep scaffold:Pmarinus_7.0:GL482342:316:9736:-1 gene:ENSPMAG00000007664.1 transcript:ENSPMAT00000008477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 422.55 bits (1085), Expect = 7.085e-148
Identity = 192/294 (65.31%), Postives = 241/294 (81.97%), Query Frame = 3
Query:   87 VAAKWRLVRKIGSGSFGDIYL-GVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLK 965
            +  K+RL RKIGSGSFGDIYL G  ++ GEEVA+KLE V  +HPQL  ESK+YK LQ GVGIP I+W G +G    YN +VM+LLGPS+EDLFNFC R+F++KTVL+LA+QM++R+E++HSKNFIHRDIKPDNFLMG+G+  N ++++D GL+KKY+D++T  HIPYRE+KNLTGTARYASIN H GIEQSRRDD+ES+GYV MYF   +LPWQGLKA  K+QKYERI EKK STPI++LCK++P EF+ YL +CR+L+FD+ P+Y  LR+ F NLF    F+YDYVFDW  LK
Sbjct:    5 IGNKYRLGRKIGSGSFGDIYLVGTNIATGEEVAIKLECVKTKHPQLHIESKIYKLLQGGVGIPVIKWCGAEG---DYNVMVMELLGPSMEDLFNFCSRKFSLKTVLLLADQMISRIEYLHSKNFIHRDIKPDNFLMGLGKKGNLVYIIDLGLAKKYRDSRTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEMLCKTYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNTLK 295          
BLAST of casein kinase I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001691.1 (pep scaffold:Pmarinus_7.0:GL476581:539457:546336:1 gene:ENSPMAG00000001522.1 transcript:ENSPMAT00000001691.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 330.102 bits (845), Expect = 7.833e-114
Identity = 151/192 (78.65%), Postives = 172/192 (89.58%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQ 653
            +F+V  K+RLVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG +     YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQ
Sbjct:   10 EFIVGGKYRLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQE---KDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQ 198          
BLAST of casein kinase I vs. Ensembl Sea Lamprey
Match: csnk1g2a (casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-6445])

HSP 1 Score: 328.176 bits (840), Expect = 6.940e-110
Identity = 154/295 (52.20%), Postives = 221/295 (74.92%), Query Frame = 3
Query:   81 FVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNK---LFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWT 956
             +V   +R+ +KIG G+FG++ LG  +   E VA+KLE + +R PQL  E + YK L +  G+P++ ++G  G   +YNA+V++LLGPSLEDLF+ C R FT+KTVLM+A Q+LTR+E++HS+N I+RD+KP+NFL+G  +  NK   + ++DFGL+K+Y D +TK HIPYRE K+LTGTARY SIN H G EQSRRDD+E++G++FMYFLR +LPWQGLKA+  K++Y++I + KR+TPI++LC++FP E + YL Y R L F E P+Y+ +R  F +LF    +++DY FDWT
Sbjct:   32 LMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGNAEGVPQVYYFGPCG---KYNAMVLELLGPSLEDLFDLCNRTFTLKTVLMIAIQLLTRMEYVHSRNLIYRDVKPENFLIG-RQSTNKQHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFERPDYEYMRNLFMDLFERKGYSFDYEFDWT 322          
BLAST of casein kinase I vs. Ensembl Sea Lamprey
Match: csnk1g1 (casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494092])

HSP 1 Score: 250.366 bits (638), Expect = 7.421e-82
Identity = 117/221 (52.94%), Postives = 169/221 (76.47%), Query Frame = 3
Query:   81 FVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMG---IGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLK 734
             +V   +R+ +KIG G+FG++ LG  +   E VA+KLE + +R PQL  E + YK L +  G+P++ ++G  G   +YNA+V++LLGPSLEDLF+ C R F++KTVLM+A Q+++R+E++HS++ I+RD+KP+NFL+G     +H N + ++DFGL+K+Y D +TK HIPYRE K+LTGTARY SIN H G EQSRRDD+E++G++FMYFLR +LPWQGLK
Sbjct:   26 LMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGNAEGVPQVYYFGPCG---KYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAMQLISRMEYVHSRSLIYRDVKPENFLVGRQGTSKHHN-IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLK 242          
BLAST of casein kinase I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004926.1 (pep scaffold:Pmarinus_7.0:GL480178:196:11423:1 gene:ENSPMAG00000004461.1 transcript:ENSPMAT00000004926.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.798 bits (325), Expect = 1.623e-35
Identity = 73/221 (33.03%), Postives = 118/221 (53.39%), Query Frame = 3
Query:  297 GVKNQYNALVMDLLGPSLEDLFNFCGR-RFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMG-IGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDW 953
            G  +++N +VM L G +L DL     R  F++ T L L  QML  +E IH+  F+HRDIKP NF MG +    +K F++D+GL+++Y ++  +   P R      GT RYASINAH   E  R DD+ S+ Y+ + F    LPW+ +K   +    +  Y+ +      +L +  P +F  +L++   L +   PNY+S+     ++ R  +   +  +DW
Sbjct:   11 GRNDKFNYVVMQLQGRNLADLRRSQPRGTFSLSTTLRLGRQMLEAIESIHAVGFLHRDIKPSNFAMGRLPSTTHKCFMLDYGLARQYTNSSGEVRPP-RAVAGFRGTVRYASINAHRNKEMGRHDDLWSLFYMLVEFTVGQLPWRKIKDKEQVGLIKERYDHR------LLLRHMPTDFHIFLDHVSTLDYCTRPNYQSIHSCALHIMRERSITENEPYDW 224          
BLAST of casein kinase I vs. Ensembl Yeast
Match: HRR25 (Conserved casein kinase; regulates diverse events including: vesicular traffic, DNA repair, the CVT pathway, monopolar attachment of sister kinetochores at meiosis I, and ribosomal subunit biogenesis; monopolin subunit; binds the RNAPII CTD; phosphorylates COPII coat subunits; interacts with Sit4p phosphatase; antagonizes calcineurin signaling, reducing nuclear accumulation of Crz1p; phosphorylates Dsn1p, the kinetochore receptor for monopolin; homolog of mammalian CK1delta [Source:SGD;Acc:S000006125])

HSP 1 Score: 397.512 bits (1020), Expect = 3.585e-136
Identity = 184/305 (60.33%), Postives = 236/305 (77.38%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQ 992
            D  V  K+R+ RKIGSGSFGDIY G  + +GEEVA+KLES+ +RHPQL YES+VY++L  GVGIP IRW+G +G   +YNA+V+DLLGPSLEDLFN+C RRF+ KTV+MLA QM  R+++IH ++FIHRDIKPDNFLMG+GR  + + V+DFGLSKKY+D  T  HIPYRE+K+LTGTARYAS+N H GIEQSRRDD+ES+GYV +YF + +LPWQGLKA  KKQKY+RI EKK +  ++ LC   P EF  Y+ YC+NLKFDE P+Y  L   F +L   L +  D++FDWT+L+     +++Q
Sbjct:    2 DLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVGIPFIRWFGREG---EYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETLCSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTMLRYTKAMVEKQ 303          
BLAST of casein kinase I vs. Ensembl Yeast
Match: YCK2 (Palmitoylated plasma membrane-bound casein kinase I (CK1) isoform; shares redundant functions with Yck1p in morphogenesis, proper septin assembly, endocytic trafficking, and glucose sensing; stabilized by Sod1p binding in the presence of glucose and oxygen, causing glucose repression of respiratory metabolism; involved in the phosphorylation and regulation of glucose sensor Rgt2p; YCK2 has a paralog, YCK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005098])

HSP 1 Score: 303.908 bits (777), Expect = 5.254e-99
Identity = 151/295 (51.19%), Postives = 202/295 (68.47%), Query Frame = 3
Query:   84 VVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRH--CNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLL 962
            +V   +++ +KIG GSFG ++ G  + NG  VA+K E      PQL  E + YK L    GIP+  ++G +G+   +N LV+DLLGPSLEDLF++CGRRF++KTV+ +A QM+T +E +H+ + I+RDIKPDNFL+G       NK+ ++DFG++K+Y+D KTK HIPYRE K+L+GTARY SIN H G EQSRRDDME+MG+VF YFLR  LPWQGLKA N KQKYE+I EKKR T +  L +  P +F  YLE  RNL F+E P+Y+  R    ++   L    D  +DW  L
Sbjct:   71 IVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQEYYFGQEGL---HNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKL 362          
BLAST of casein kinase I vs. Ensembl Yeast
Match: YCK1 (Palmitoylated plasma membrane-bound casein kinase I (CK1) isoform; shares redundant functions with Yck2p in morphogenesis, proper septin assembly, endocytic trafficking, and glucose sensing; stabilized by Sod1p binding in the presence of glucose and oxygen, causing glucose repression of respiratory metabolism; involved in the phosphorylation and regulation of glucose sensor Rgt2p; YCK1 has a paralog, YCK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001177])

HSP 1 Score: 299.671 bits (766), Expect = 2.179e-97
Identity = 148/295 (50.17%), Postives = 201/295 (68.14%), Query Frame = 3
Query:   84 VVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRH--CNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLL 962
            +V   +++ +KIG GSFG ++ G  + NG  VA+K E      PQL  E K YK L     IP   ++G +G+   +N LV+DLLGPSLEDLF++CGR+F++KTV+ +A QM+T +E +H+ + I+RDIKPDNFL+G       N + ++DFG++K+Y+D KTK HIPYRE K+L+GTARY SIN H G EQSRRDDME++G+VF YFLR  LPWQGLKA N KQKYE+I EKKRST +  L +  P +F  YLE  R+L F+E P+Y+  R+   ++   L    D  +DW  L
Sbjct:   64 IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPNIPYAYYFGQEGL---HNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKL 355          
BLAST of casein kinase I vs. Ensembl Yeast
Match: YCK3 (Palmitoylated vacuolar membrane-localized casein kinase I isoform; negatively regulates vacuole fusion during hypertonic stress via phosphorylation of Vps41p; shares essential functions with Hrr25p; regulates vesicle fusion in AP-3 pathway [Source:SGD;Acc:S000000925])

HSP 1 Score: 270.011 bits (689), Expect = 3.600e-86
Identity = 146/330 (44.24%), Postives = 203/330 (61.52%), Query Frame = 3
Query:   84 VVAAKWRLVRKIGSGSFGDIYLGVAVSNG-----------------EEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMG----------IGRHC--------NKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERI-YEKKRSTPIDILC-KSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLL 962
            +V   + +  KIG GSFG I+ G  + +                  E VA+K E  ++  PQL  E + Y+ L   VGIP   ++G +G+   +N L++DLLGPSLEDLF +CGR+F++KT  M+A+QM+ RV  IH  + I+RDIKPDNFL+           + + C        N +++VDFG++K+Y+D +TK HIPYRE K+L+GTARY SIN H G EQSRRDD+ES+G+VF YFLR +LPWQGLKA N K KYE+I   K++  P D+L   + P +F+ YL+Y R+LKFDE P+Y  L     +  R  +   D  +DW  L
Sbjct:    9 IVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIKFEPRHSDAPQLRDEFRAYRILNGCVGIPHAYYFGQEGM---HNILIIDLLGPSLEDLFEWCGRKFSVKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNNDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSLKFDEDPDYDYLISLMDDALRLNDLKDDGHYDWMDL 335          
BLAST of casein kinase I vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 76.2554 bits (186), Expect = 2.768e-15
Identity = 62/222 (27.93%), Postives = 105/222 (47.30%), Query Frame = 3
Query:   99 WRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESV---NARHPQLLYESKVYK----FLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYAS---INAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLK 734
            W     IG GSFG +YL + V+ GE +AVK   V   ++++  +L   +  +     L+D   +  +++ GF+   N Y+  +  + G S+  L    GR F    +  L  Q+L  + ++HSK  +HRD+K DN L+     C    + DFG+S+K KD      I    D  + GT  + +   ++   G   S + D+ S+G + +       PW  L+
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICK---ISDFGISRKSKD------IYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLE 1384          
BLAST of casein kinase I vs. Ensembl Nematostella
Match: EDO46523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ6])

HSP 1 Score: 488.419 bits (1256), Expect = 1.035e-173
Identity = 221/300 (73.67%), Postives = 261/300 (87.00%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAV 977
            +F V  K+RLVRKIGSGSFGDIYL +  +NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP +R+YG +     YN LVM+LLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMG+G+HCNKLF++DFGL+KKY+D++T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN+ YDY+FDWT+LKQKA 
Sbjct:   12 EFEVGGKYRLVRKIGSGSFGDIYLAINTTNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPSVRYYGQE---RDYNVLVMELLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMGVGKHCNKLFLIDFGLAKKYRDSRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNYQYDYIFDWTMLKQKAA 308          
BLAST of casein kinase I vs. Ensembl Nematostella
Match: EDO48738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM1])

HSP 1 Score: 476.478 bits (1225), Expect = 3.589e-169
Identity = 225/320 (70.31%), Postives = 259/320 (80.94%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGGLPGNSRAT 1037
            +F+V  K+RLVRKIGSGSFGDIYL V   NGEE AVKLES  ARHPQLLYESK+YK L  G GIP IR +     +N YN LVMDLLGPSLEDLFNFC R+F MKTVLMLA+QM+ R+E++H+KNFIHRDIKPDNFLMGIGRHCNKL+++DFGL+KKY+D++TK HI YREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF RS LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EFS YL YC+ L+F+EAP+Y  LR+ F  LFRTLN  YDY+FDWT LKQK+         C G +PG + AT
Sbjct:    7 EFIVQGKYRLVRKIGSGSFGDIYLCVHTENGEEKAVKLESQKARHPQLLYESKLYKILAGGSGIPAIRHFS---QENDYNVLVMDLLGPSLEDLFNFCNRKFNMKTVLMLADQMIARIEYVHNKNFIHRDIKPDNFLMGIGRHCNKLYLIDFGLAKKYRDSRTKQHISYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRSNLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFSMYLNYCKGLRFEEAPDYMYLRQLFRILFRTLNHQYDYIFDWTTLKQKS--------GCQGAVPGTAVAT 315          
BLAST of casein kinase I vs. Ensembl Nematostella
Match: EDO34742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG2])

HSP 1 Score: 426.787 bits (1096), Expect = 1.574e-148
Identity = 195/296 (65.88%), Postives = 239/296 (80.74%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLK 965
            +  V  K+RL RKIGSGSFGDIYLG ++S GEEVA+KLE V  +HPQL  E+K YK +Q GVGIP I+W G +G    YN LVM+LLGPSLEDLFNFC R+F++KTVL+LA+Q ++R+E++HSKNFIHRDIKPDNFLMG+G+  N ++++DFGL+KKY+D +T  HIPYRE+KNLTGTARYASIN H GIEQSRRDD+ES+GYV MYF   +LPWQGLKA  K+QKYERI EKK STPI++LCK FP EF+ YL  CR+L+FD+ P+Y  LR+ F NLF    + YDYVFDW LLK
Sbjct:    2 ELRVGNKYRLGRKIGSGSFGDIYLGTSISTGEEVAIKLECVKTKHPQLHIEAKFYKMMQGGVGIPTIKWCGTEG---DYNVLVMELLGPSLEDLFNFCNRKFSIKTVLLLADQTISRIEYVHSKNFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKYRDPRTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGFPSEFATYLNNCRSLRFDDKPDYSYLRQLFRNLFHRQGYTYDYVFDWNLLK 294          
BLAST of casein kinase I vs. Ensembl Nematostella
Match: EDO34289 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPP6])

HSP 1 Score: 328.176 bits (840), Expect = 4.461e-109
Identity = 154/295 (52.20%), Postives = 219/295 (74.24%), Query Frame = 3
Query:   81 FVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMG---IGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWT 956
             +V   +R+ +KIG G+FG++ LG  + N E VA+KLE + +R PQL  E + YK L +  GIP++ ++G  G   +YNALVM+LLGPSLEDLF+ C R+F++KTVLM+A Q+++R+E++HSKN I+RDIKP+NFL+G    G+    + ++DFGL+K+Y D +TK HIPYRE K+LTGTARY SIN H G EQSRRDD+E++G++FMYFLR +LPWQGLKA+  K++Y++I + KR+TPI++LC++ P E + YL Y R L F E P+Y+ LR+ F +L     +  D+ FDWT
Sbjct:   40 MMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKLEPMKSRAPQLHLEYRFYKALGNAEGIPQVHYFGPCG---KYNALVMELLGPSLEDLFDLCNRQFSLKTVLMVALQLISRIEYVHSKNMIYRDIKPENFLIGRKSAGKE-KTINIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENHPEEMATYLRYVRRLDFFETPDYEYLRKLFRDLMERKGYVEDFEFDWT 330          
BLAST of casein kinase I vs. Ensembl Nematostella
Match: EDO46789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP40])

HSP 1 Score: 146.362 bits (368), Expect = 7.930e-41
Identity = 105/298 (35.23%), Postives = 153/298 (51.34%), Query Frame = 3
Query:   84 VVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRR------FTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMG-IGRHCNKLFVVDFGLSKKYKDTKTKAHI-PYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDW 953
            VV  +W++++KIG G FG+IY G+     + VA+KLESV+     L  E  V K LQ   G+  I  +   G    +N LVM L G +L +L     RR      F+  T+L L  Q+L  V+ IH   F+HRDIKP NF MG      +  +++DFGLS+++  TK    + P R      GT RYASINAH   E  R DD+ S  Y+ + F    LPW+ +K   +  K ++ Y+      I  L KS P EF  ++++   LK+++ P+YK L      + +         +DW
Sbjct:   10 VVRQRWKIIKKIGGGGFGEIYRGLDQVTKDYVAIKLESVHQSKQVLKMEVAVLKKLQ---GVDHICKFISCGRNESFNYLVMSLQGSNLAEL-----RRSQPKGVFSHSTMLRLGTQILKSVKSIHEAGFLHRDIKPSNFAMGNTPDTVHICYMLDFGLSRQF--TKANGEVRPPRNTAGFRGTVRYASINAHENKEMGRHDDLWSFFYLMVEFTVGQLPWRKMKDKEQVGKMKKTYD------IANLLKSMPGEFKQFVDHISKLKYEDKPDYKMLLGLLEQIIKRKGIKESDPYDW 291          
BLAST of casein kinase I vs. Ensembl Medaka
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:101155263])

HSP 1 Score: 495.352 bits (1274), Expect = 2.145e-176
Identity = 229/312 (73.40%), Postives = 264/312 (84.62%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGG 1013
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNKLF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA     Q    SGG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA----QQGASSGG 314          
BLAST of casein kinase I vs. Ensembl Medaka
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:101155263])

HSP 1 Score: 480.715 bits (1236), Expect = 4.218e-170
Identity = 229/340 (67.35%), Postives = 264/340 (77.65%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNK----------------------------LFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGG 1013
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG    +  YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNK                            LF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFRTLN  YDY FDWT+LKQKA     Q    SGG
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYG---QEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCSDSAVGKRKRGVAVSSSQDPPFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA----QQGASSGG 342          
BLAST of casein kinase I vs. Ensembl Medaka
Match: csnk1a1 (casein kinase 1 alpha 1 [Source:NCBI gene;Acc:101155263])

HSP 1 Score: 444.121 bits (1141), Expect = 9.708e-156
Identity = 211/310 (68.06%), Postives = 245/310 (79.03%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNK----------------------------LFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTL 923
            +F+V  K++LVRKIGSGSFGDIYL + ++NGEEVAVKLES  ARHPQLLYESK+YK LQ GVGIP IRWYG +     YN LVMDLLGPSLEDLFNFC RRFTMKTVLMLA+QM++R+E++H+KNFIHRDIKPDNFLMGIGRHCNK                            LF++DFGL+KKY+D +T+ HIPYREDKNLTGTARYASINAH GIEQSRRDDMES+GYV MYF R++LPWQGLKA  KKQKYE+I EKK STP+++LCK FP EF+ YL YCR L+F+EAP+Y  LR+ F  LFR L
Sbjct:   10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQE---KDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCSDSAVGKRKRGVAVSSSQDPPFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRVL 316          
BLAST of casein kinase I vs. Ensembl Medaka
Match: csnk1db (casein kinase 1 delta [Source:NCBI gene;Acc:101156740])

HSP 1 Score: 431.409 bits (1108), Expect = 7.881e-150
Identity = 194/296 (65.54%), Postives = 242/296 (81.76%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLK 965
            +  V  ++RL RKIGSGSFGDIYLG  +S GEEVA+KLE V  +HPQL  ESK+YK +Q GVGIP I+W G +G    YN +VM+LLGPSLEDLFNFC R+F++KTVL+LA+QM++R+E+IHSKNFIHRD+KPDNFLMG+G+  N ++++DFGL+KKY+D +T  HIPYRE+KNLTGTARYASIN H GIEQSRRDD+ES+GYV MYF   +LPWQGLKA  K+QKYERI EKK STPI++LCK +P EF+ YL +CR+L+FD+ P+Y  LR+ F NLF    F+YDYVFDW +LK
Sbjct:    2 ELRVGNRYRLGRKIGSGSFGDIYLGTDISVGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPIIKWCGAEG---DYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK 294          
BLAST of casein kinase I vs. Ensembl Medaka
Match: ENSORLT00000018110.2 (casein kinase 1 epsilon [Source:NCBI gene;Acc:101175322])

HSP 1 Score: 431.409 bits (1108), Expect = 8.515e-150
Identity = 195/296 (65.88%), Postives = 241/296 (81.42%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLK 965
            +  V  K+RL RKIGSGSFGDIYLG  ++ GEEVA+KLE V  +HPQL  ESK YK +Q GVGIP I+W G +G    YN +VM+LLGPSLEDLFNFC R+F++KTVL+LA+QM++R+E+IHSKNFIHRD+KPDNFLMG+G+  N ++++DFGL+KKY+D +T  HIPYRE+KNLTGTARYASIN H GIEQSRRDD+ES+GYV MYF   +LPWQGLKA  K+QKYERI EKK STPI++LCK +P EFS YL +CR+L+FD+ P+Y  LR+ F NLF    F+YDYVFDW +LK
Sbjct:    2 ELRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEG---DYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLK 294          
BLAST of casein kinase I vs. Planmine SMEST
Match: SMESG000013473.1 (SMESG000013473.1)

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 341/341 (100.00%), Postives = 341/341 (100.00%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGGLPGNSRATXXXXXXXXXXXXXXXXSAQYK 1100
            DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGGLPGNSRATPGGGPLGGIGGAPGLGSAQYK
Sbjct:   14 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAVGMQQQSHQCSGGLPGNSRATPGGGPLGGIGGAPGLGSAQYK 354          
BLAST of casein kinase I vs. Planmine SMEST
Match: SMESG000050144.1 (SMESG000050144.1)

HSP 1 Score: 486.878 bits (1252), Expect = 2.477e-173
Identity = 216/300 (72.00%), Postives = 263/300 (87.67%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAV 977
            +FVV  KW+L+++IGSGSFG IYLGV + +GEE A+KLESV ARHPQL YESK+Y+ LQ+GVGIP+ +WYG DG+KNQYNALV++LLGPSLEDLFNFC RRFTMKTVLM+A+Q+++R+EF+HSK+ IHRDIKP+NFLMG+GRHCNK+F +DFGL+K+Y++  TK HIPYR+DKNLTGTARYASINAH+GIEQSRRDDMES+GYV +YFLR +LPWQGLKAN+K+QKYE+IYE K  TP++ LCK FPPE   Y++Y R LKFDE PNY  LRE F NLFRTLNF +DYVFDW+LLKQ+  
Sbjct:   12 EFVVNQKWKLLKRIGSGSFGSIYLGVNMQSGEEYAIKLESVGARHPQLSYESKIYRLLQEGVGIPKFKWYGIDGMKNQYNALVIELLGPSLEDLFNFCSRRFTMKTVLMIADQLISRIEFMHSKSLIHRDIKPENFLMGVGRHCNKVFAIDFGLAKRYREHHTKLHIPYRDDKNLTGTARYASINAHSGIEQSRRDDMESIGYVILYFLRGSLPWQGLKANHKRQKYEKIYECKIETPVEKLCKGFPPEIVKYVKYSRQLKFDEDPNYTMLREEFRNLFRTLNFVWDYVFDWSLLKQRTT 311          
BLAST of casein kinase I vs. Planmine SMEST
Match: SMESG000050130.1 (SMESG000050130.1)

HSP 1 Score: 486.878 bits (1252), Expect = 2.477e-173
Identity = 216/300 (72.00%), Postives = 263/300 (87.67%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAV 977
            +FVV  KW+L+++IGSGSFG IYLGV + +GEE A+KLESV ARHPQL YESK+Y+ LQ+GVGIP+ +WYG DG+KNQYNALV++LLGPSLEDLFNFC RRFTMKTVLM+A+Q+++R+EF+HSK+ IHRDIKP+NFLMG+GRHCNK+F +DFGL+K+Y++  TK HIPYR+DKNLTGTARYASINAH+GIEQSRRDDMES+GYV +YFLR +LPWQGLKAN+K+QKYE+IYE K  TP++ LCK FPPE   Y++Y R LKFDE PNY  LRE F NLFRTLNF +DYVFDW+LLKQ+  
Sbjct:   12 EFVVNQKWKLLKRIGSGSFGSIYLGVNMQSGEEYAIKLESVGARHPQLSYESKIYRLLQEGVGIPKFKWYGIDGMKNQYNALVIELLGPSLEDLFNFCSRRFTMKTVLMIADQLISRIEFMHSKSLIHRDIKPENFLMGVGRHCNKVFAIDFGLAKRYREHHTKLHIPYRDDKNLTGTARYASINAHSGIEQSRRDDMESIGYVILYFLRGSLPWQGLKANHKRQKYEKIYECKIETPVEKLCKGFPPEIVKYVKYSRQLKFDEDPNYTMLREEFRNLFRTLNFVWDYVFDWSLLKQRTT 311          
BLAST of casein kinase I vs. Planmine SMEST
Match: SMESG000050144.1 (SMESG000050144.1)

HSP 1 Score: 486.493 bits (1251), Expect = 3.224e-173
Identity = 216/300 (72.00%), Postives = 263/300 (87.67%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAV 977
            +FVV  KW+L+++IGSGSFG IYLGV + +GEE A+KLESV ARHPQL YESK+Y+ LQ+GVGIP+ +WYG DG+KNQYNALV++LLGPSLEDLFNFC RRFTMKTVLM+A+Q+++R+EF+HSK+ IHRDIKP+NFLMG+GRHCNK+F +DFGL+K+Y++  TK HIPYR+DKNLTGTARYASINAH+GIEQSRRDDMES+GYV +YFLR +LPWQGLKAN+K+QKYE+IYE K  TP++ LCK FPPE   Y++Y R LKFDE PNY  LRE F NLFRTLNF +DYVFDW+LLKQ+  
Sbjct:    9 EFVVNQKWKLLKRIGSGSFGSIYLGVNMQSGEEYAIKLESVGARHPQLSYESKIYRLLQEGVGIPKFKWYGIDGMKNQYNALVIELLGPSLEDLFNFCSRRFTMKTVLMIADQLISRIEFMHSKSLIHRDIKPENFLMGVGRHCNKVFAIDFGLAKRYREHHTKLHIPYRDDKNLTGTARYASINAHSGIEQSRRDDMESIGYVILYFLRGSLPWQGLKANHKRQKYEKIYECKIETPVEKLCKGFPPEIVKYVKYSRQLKFDEDPNYTMLREEFRNLFRTLNFVWDYVFDWSLLKQRTT 308          
BLAST of casein kinase I vs. Planmine SMEST
Match: SMESG000050130.1 (SMESG000050130.1)

HSP 1 Score: 486.493 bits (1251), Expect = 3.224e-173
Identity = 216/300 (72.00%), Postives = 263/300 (87.67%), Query Frame = 3
Query:   78 DFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVKLESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLLGPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFLMGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAHAGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRSTPIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYDYVFDWTLLKQKAV 977
            +FVV  KW+L+++IGSGSFG IYLGV + +GEE A+KLESV ARHPQL YESK+Y+ LQ+GVGIP+ +WYG DG+KNQYNALV++LLGPSLEDLFNFC RRFTMKTVLM+A+Q+++R+EF+HSK+ IHRDIKP+NFLMG+GRHCNK+F +DFGL+K+Y++  TK HIPYR+DKNLTGTARYASINAH+GIEQSRRDDMES+GYV +YFLR +LPWQGLKAN+K+QKYE+IYE K  TP++ LCK FPPE   Y++Y R LKFDE PNY  LRE F NLFRTLNF +DYVFDW+LLKQ+  
Sbjct:    9 EFVVNQKWKLLKRIGSGSFGSIYLGVNMQSGEEYAIKLESVGARHPQLSYESKIYRLLQEGVGIPKFKWYGIDGMKNQYNALVIELLGPSLEDLFNFCSRRFTMKTVLMIADQLISRIEFMHSKSLIHRDIKPENFLMGVGRHCNKVFAIDFGLAKRYREHHTKLHIPYRDDKNLTGTARYASINAHSGIEQSRRDDMESIGYVILYFLRGSLPWQGLKANHKRQKYEKIYECKIETPVEKLCKGFPPEIVKYVKYSRQLKFDEDPNYTMLREEFRNLFRTLNFVWDYVFDWSLLKQRTT 308          
The following BLAST results are available for this feature:
BLAST of casein kinase I vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSNK1A17.983e-17773.63casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1A11.479e-17673.63casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1A11.090e-17067.55casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1A11.921e-17067.55casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1A18.489e-17066.96casein kinase 1 alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of casein kinase I vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kin-196.637e-17572.19Casein kinase I isoform alpha [Source:UniProtKB/S... [more]
kin-196.637e-17572.19Casein kinase I isoform alpha [Source:UniProtKB/S... [more]
kin-202.656e-13663.48Casein kinase I isoform delta [Source:UniProtKB/S... [more]
kin-202.656e-13663.48Casein kinase I isoform delta [Source:UniProtKB/S... [more]
kin-203.222e-13663.48Casein kinase I isoform delta [Source:UniProtKB/S... [more]
back to top
BLAST of casein kinase I vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CkIalpha1.155e-15969.23gene:FBgn0015024 transcript:FBtr0073680[more]
CkIalpha1.155e-15969.23gene:FBgn0015024 transcript:FBtr0073682[more]
CkIalpha1.155e-15969.23gene:FBgn0015024 transcript:FBtr0345163[more]
CkIalpha1.155e-15969.23gene:FBgn0015024 transcript:FBtr0300380[more]
CkIalpha1.155e-15969.23gene:FBgn0015024 transcript:FBtr0345162[more]
back to top
BLAST of casein kinase I vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1a12.122e-17673.40casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
csnk1a12.138e-17673.40casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
csnk1a12.323e-17673.40casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
csnk1a12.512e-17067.35casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
csnk1a12.931e-17067.35casein kinase 1, alpha 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of casein kinase I vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1a11.128e-17673.63casein kinase 1 alpha 1 [Source:NCBI gene;Acc:4078... [more]
csnk1a11.341e-17673.63casein kinase 1 alpha 1 [Source:NCBI gene;Acc:4078... [more]
csnk1a11.858e-17673.63casein kinase 1 alpha 1 [Source:NCBI gene;Acc:4078... [more]
csnk1a13.425e-17673.87casein kinase 1 alpha 1 [Source:NCBI gene;Acc:4078... [more]
csnk1a17.051e-17673.87casein kinase 1 alpha 1 [Source:NCBI gene;Acc:4078... [more]
back to top
BLAST of casein kinase I vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Csnk1a14.389e-17773.63casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1a15.480e-17773.63casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1a18.315e-17773.63casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1a11.015e-17673.63casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1a19.877e-17673.63casein kinase 1, alpha 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of casein kinase I vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P67963|KC1A_XENLA3.669e-17673.63Casein kinase I isoform alpha OS=Xenopus laevis OX... [more]
sp|P67962|KC1A_CHICK3.669e-17673.63Casein kinase I isoform alpha OS=Gallus gallus OX=... [more]
sp|Q8BK63|KC1A_MOUSE3.834e-17673.63Casein kinase I isoform alpha OS=Mus musculus OX=1... [more]
sp|P48729|KC1A_HUMAN3.834e-17673.63Casein kinase I isoform alpha OS=Homo sapiens OX=9... [more]
sp|P67829|KC1A_SHEEP7.103e-17673.63Casein kinase I isoform alpha OS=Ovis aries OX=994... [more]
back to top
BLAST of casein kinase I vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IIR20.000e+082.33Protein kinase domain-containing protein OS=Macros... [more]
A0A267DVC40.000e+078.68Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8H4N20.000e+082.33Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8ICT73.752e-17878.68Protein kinase domain-containing protein OS=Macros... [more]
A0A2T7NJD01.130e-17574.84Protein kinase domain-containing protein OS=Pomace... [more]
back to top
BLAST of casein kinase I vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1a11.798e-17673.40casein kinase 1 alpha 1 [Source:NCBI gene;Acc:1030... [more]
csnk1a12.484e-17067.35casein kinase 1 alpha 1 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000001347.24.608e-15166.22casein kinase I [Source:NCBI gene;Acc:103041322][more]
csnk1e6.020e-15166.55casein kinase I-like [Source:NCBI gene;Acc:1030249... [more]
csnk1e1.262e-15067.24casein kinase I-like [Source:NCBI gene;Acc:1030249... [more]
back to top
BLAST of casein kinase I vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008477.17.085e-14865.31pep scaffold:Pmarinus_7.0:GL482342:316:9736:-1 gen... [more]
ENSPMAT00000001691.17.833e-11478.65pep scaffold:Pmarinus_7.0:GL476581:539457:546336:1... [more]
csnk1g2a6.940e-11052.20casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
csnk1g17.421e-8252.94casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494... [more]
ENSPMAT00000004926.11.623e-3533.03pep scaffold:Pmarinus_7.0:GL480178:196:11423:1 gen... [more]
back to top
BLAST of casein kinase I vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRR253.585e-13660.33Conserved casein kinase; regulates diverse events ... [more]
YCK25.254e-9951.19Palmitoylated plasma membrane-bound casein kinase ... [more]
YCK12.179e-9750.17Palmitoylated plasma membrane-bound casein kinase ... [more]
YCK33.600e-8644.24Palmitoylated vacuolar membrane-localized casein k... [more]
BCK12.768e-1527.93MAPKKK acting in the protein kinase C signaling pa... [more]
back to top
BLAST of casein kinase I vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO465231.035e-17373.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487383.589e-16970.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347421.574e-14865.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342894.461e-10952.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467897.930e-4135.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of casein kinase I vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1a12.145e-17673.40casein kinase 1 alpha 1 [Source:NCBI gene;Acc:1011... [more]
csnk1a14.218e-17067.35casein kinase 1 alpha 1 [Source:NCBI gene;Acc:1011... [more]
csnk1a19.708e-15668.06casein kinase 1 alpha 1 [Source:NCBI gene;Acc:1011... [more]
csnk1db7.881e-15065.54casein kinase 1 delta [Source:NCBI gene;Acc:101156... [more]
ENSORLT00000018110.28.515e-15065.88casein kinase 1 epsilon [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of casein kinase I vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013473.10.000e+0100.00SMESG000013473.1[more]
SMESG000050144.12.477e-17372.00SMESG000050144.1[more]
SMESG000050130.12.477e-17372.00SMESG000050130.1[more]
SMESG000050144.13.224e-17372.00SMESG000050144.1[more]
SMESG000050130.13.224e-17372.00SMESG000050130.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019896 ID=SMED30019896|Name=casein kinase I|organism=Schmidtea mediterranea sexual|type=transcript|length=1232bp
AATCTATATAAATCTTATATGATCATTTTAAAAGCTAAATGAGTACTAGT
AAAGGCACAAGCGGTAGCAGTAGGTCAGATTTCGTAGTTGCTGCTAAATG
GCGATTAGTAAGAAAAATAGGGTCAGGCTCCTTTGGTGATATTTATTTGG
GTGTTGCAGTATCAAATGGTGAAGAGGTTGCAGTGAAATTGGAATCAGTA
AATGCCAGACATCCCCAACTACTTTACGAAAGTAAAGTTTATAAGTTTCT
TCAGGATGGAGTTGGTATTCCCAGAATCAGATGGTATGGATTTGATGGAG
TTAAGAATCAATATAATGCTCTTGTAATGGATTTGCTTGGACCGAGTTTA
GAAGATTTATTCAATTTTTGTGGTCGCAGATTTACAATGAAAACCGTTTT
AATGTTGGCTGAACAAATGTTAACTAGAGTAGAGTTCATTCATTCAAAAA
ATTTTATCCATCGTGACATTAAACCCGATAATTTTCTAATGGGTATAGGA
CGTCATTGTAACAAGTTGTTTGTTGTTGATTTTGGATTATCTAAGAAATA
TAAGGATACTAAAACTAAGGCTCATATTCCCTACAGAGAAGATAAAAATC
TGACCGGCACTGCTCGTTATGCTAGTATAAATGCTCACGCAGGAATCGAG
CAATCTCGGCGAGATGACATGGAATCAATGGGTTACGTATTTATGTACTT
CTTACGGAGCACACTCCCATGGCAGGGATTGAAGGCTAATAATAAAAAGC
AAAAATACGAACGAATCTATGAGAAAAAACGATCGACTCCAATTGATATT
TTATGTAAAAGCTTTCCACCGGAATTTTCATTTTATTTGGAATATTGCCG
AAACCTGAAGTTCGACGAGGCCCCCAATTACAAAAGCCTGAGGGAAAGTT
TTTCGAATTTATTCCGAACATTGAATTTCGCATACGATTACGTGTTTGAT
TGGACCCTTTTGAAACAGAAGGCAGTCGGTATGCAACAGCAATCACACCA
ATGCAGCGGCGGACTCCCTGGAAACAGCAGAGCCACACCAGGTGGGGGTC
CGCTCGGTGGAATCGGGGGTGCGCCTGGGCTGGGTAGTGCTCAGTATAAG
TAATAATAATATTTCTAAGCTGGAAAATTGTCGTCAACCTGTATGTGTGC
GCGCGGATTATTACAGTACACACGTGTTTATTGTTATAATAAAAATAATC
ATCTTTTGTCTGTATTCACAATTCTATCGGAG
back to top

protein sequence of SMED30019896-orf-1

>SMED30019896-orf-1 ID=SMED30019896-orf-1|Name=SMED30019896-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MSTSKGTSGSSRSDFVVAAKWRLVRKIGSGSFGDIYLGVAVSNGEEVAVK
LESVNARHPQLLYESKVYKFLQDGVGIPRIRWYGFDGVKNQYNALVMDLL
GPSLEDLFNFCGRRFTMKTVLMLAEQMLTRVEFIHSKNFIHRDIKPDNFL
MGIGRHCNKLFVVDFGLSKKYKDTKTKAHIPYREDKNLTGTARYASINAH
AGIEQSRRDDMESMGYVFMYFLRSTLPWQGLKANNKKQKYERIYEKKRST
PIDILCKSFPPEFSFYLEYCRNLKFDEAPNYKSLRESFSNLFRTLNFAYD
YVFDWTLLKQKAVGMQQQSHQCSGGLPGNSRATPGGGPLGGIGGAPGLGS
AQYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0016055Wnt signaling pathway
GO:0016310phosphorylation
GO:0045104intermediate filament cytoskeleton organization
GO:0051301cell division
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0016607nuclear speck
GO:0000775chromosome, centromeric region
GO:0000776kinetochore
GO:0000777condensed chromosome kinetochore
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 21..292
e-value: 5.0E-12
score: 38.2
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 23..239
e-value: 7.9E-26
score: 91.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 21..292
score: 28.457
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 4..325
e-value: 7.7E-107
score: 359.7
NoneNo IPR availablePANTHERPTHR11909CASEIN KINASE-RELATEDcoord: 12..318
NoneNo IPR availablePANTHERPTHR11909:SF139CASEIN KINASE I ISOFORM ALPHA-LIKEcoord: 12..318
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 27..50
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 139..151
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 19..305