SMED30019889

Overview
NameSMED30019889
Smed IDSMED30019889
Length (bp)2543
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30019889 (SMED30019889) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30019889 (SMED30019889) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30019889 (SMED30019889) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30019889 (SMED30019889) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019889

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019889h1SMcG0006775 SmedASXL_010278SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30019889h1SMcG0006775 SmedASXL_010278SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30019889h1SMcG0006775 SmedASXL_010277SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30019889h1SMcG0006775 SmedASXL_010277SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30019889h1SMcG0006775 dd_Smed_v4_19641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30019889h1SMcG0006775 dd_Smed_v6_19641_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30019889 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000501:2517..15426 +12461
Homology
BLAST of SMED30019889 vs. Ensembl Yeast
Match: REV1 (Deoxycytidyl transferase; involved in repair of abasic sites and adducted guanines in damaged DNA by translesion synthesis (TLS); forms a complex with the subunits of DNA polymerase zeta, Rev3p and Rev7p; relocalizes from nucleus to cytoplasm upon DNA replication stress [Source:SGD;Acc:S000005873])

HSP 1 Score: 50.8322 bits (120), Expect = 8.087e-7
Identity = 45/165 (27.27%), Postives = 71/165 (43.03%), Query Frame = 2
Query:  416 TDSTSRVIISKMSYQNQEKLHSNCNQRTFSSNLIDYFWKNHSKNPKTNAGIINSFRAKLFMNCRFVIVGLVRESFNSVMKAIVKHGGS-VYQLENVQIATHVIACREIDIINLNERKFLSENEFKN--VVSKDWIFDSVKRGFLMSMINYQIIR--DRQHINFDD 895
            +DS    +     Y  +   H   + +T    ++   +K+           I+S  +K+F NC   I G  +     + + IV HGG  ++ L + +  TH++A       NL  +K +   EF N  VVS DWI DSVK   L+   NY +    D Q    D+
Sbjct:  117 SDSNGDDVKKNTVYTREAYFHEKAHGQTLQDQILKDQYKDQ----------ISSQSSKIFKNCVIYINGYTKPGRLQLHEMIVLHGGKFLHYLSSKKTVTHIVAS------NLPLKKRI---EFANYKVVSPDWIVDSVKEARLLPWQNYSLTSKLDEQQKKLDN 262          
BLAST of SMED30019889 vs. Planmine SMEST
Match: SMESG000055277.1 (SMESG000055277.1)

HSP 1 Score: 1603.96 bits (4152), Expect = 0.000e+0
Identity = 829/829 (100.00%), Postives = 829/829 (100.00%), Query Frame = 2
Query:   38 MKIFIYKPANAIILKNCKIKSPIVVYFSKLQDINNLIEISKVSNKYIFCVEDEKDTIFLYNYNPMAIIISPLELYNLWKENKAAFSSTTEKVLKNEMLYFCGFNLIELCRMKVKALLMGAKVSDYITDSTSRVIISKMSYQNQEKLHSNCNQRTFSSNLIDYFWKNHSKNPKTNAGIINSFRAKLFMNCRFVIVGLVRESFNSVMKAIVKHGGSVYQLENVQIATHVIACREIDIINLNERKFLSENEFKNVVSKDWIFDSVKRGFLMSMINYQIIRDRQHINFDDLEYEENQFGKNITECPSIKTLLSLPSNEYITPKTTDIITVNDSSNRLIIISNLRTFLWNNIVSEINKFQNLRSNSVLSTVKELDDIFKAFQKIFVFFSDLHKQLIIEEFPEDYCYGIEFLEIFGLVDEYYESYKQLFISLIDRVNFINNYSNSVKTLLKEFCKKNSHPDILSFFKLPIRSWLVXXXXXXXXXXXXRCYHPDIGAWCTVQEKISNLLNYFNTIENERINGVKQNLVAKCLSSIVELNENNQFWTCVDCVLFDETSKLIPLTIFIMKETIMFCAFSDFKKKLCKYEKIKGNLEKSIQRIVRINKDFVPNKNNQEKSPKKFRSSTFNPEEFVKEFKTIPFKNQLSKFNKIFNGLANINWNFVSNKKYNEYFEIKKSQFTKISYECLDNDILISPLSFDLSYINSNSMNSTIRLQLVPTIVNSXXXXXXXXXXXXXXXXWTPKESKDMSWIEFILAEKNNFCYFFDQMITASNQRYFDAFQESNSKGLTQLSKSSSRAYSTFFSKPKESRTRSPIIKKPTIFSNLSKRIKKIRKFLG 2524
            MKIFIYKPANAIILKNCKIKSPIVVYFSKLQDINNLIEISKVSNKYIFCVEDEKDTIFLYNYNPMAIIISPLELYNLWKENKAAFSSTTEKVLKNEMLYFCGFNLIELCRMKVKALLMGAKVSDYITDSTSRVIISKMSYQNQEKLHSNCNQRTFSSNLIDYFWKNHSKNPKTNAGIINSFRAKLFMNCRFVIVGLVRESFNSVMKAIVKHGGSVYQLENVQIATHVIACREIDIINLNERKFLSENEFKNVVSKDWIFDSVKRGFLMSMINYQIIRDRQHINFDDLEYEENQFGKNITECPSIKTLLSLPSNEYITPKTTDIITVNDSSNRLIIISNLRTFLWNNIVSEINKFQNLRSNSVLSTVKELDDIFKAFQKIFVFFSDLHKQLIIEEFPEDYCYGIEFLEIFGLVDEYYESYKQLFISLIDRVNFINNYSNSVKTLLKEFCKKNSHPDILSFFKLPIRSWLVINTIITEILTNTRCYHPDIGAWCTVQEKISNLLNYFNTIENERINGVKQNLVAKCLSSIVELNENNQFWTCVDCVLFDETSKLIPLTIFIMKETIMFCAFSDFKKKLCKYEKIKGNLEKSIQRIVRINKDFVPNKNNQEKSPKKFRSSTFNPEEFVKEFKTIPFKNQLSKFNKIFNGLANINWNFVSNKKYNEYFEIKKSQFTKISYECLDNDILISPLSFDLSYINSNSMNSTIRLQLVPTIVNSIKDYENIKIDINDEIEWTPKESKDMSWIEFILAEKNNFCYFFDQMITASNQRYFDAFQESNSKGLTQLSKSSSRAYSTFFSKPKESRTRSPIIKKPTIFSNLSKRIKKIRKFLG
Sbjct:    1 MKIFIYKPANAIILKNCKIKSPIVVYFSKLQDINNLIEISKVSNKYIFCVEDEKDTIFLYNYNPMAIIISPLELYNLWKENKAAFSSTTEKVLKNEMLYFCGFNLIELCRMKVKALLMGAKVSDYITDSTSRVIISKMSYQNQEKLHSNCNQRTFSSNLIDYFWKNHSKNPKTNAGIINSFRAKLFMNCRFVIVGLVRESFNSVMKAIVKHGGSVYQLENVQIATHVIACREIDIINLNERKFLSENEFKNVVSKDWIFDSVKRGFLMSMINYQIIRDRQHINFDDLEYEENQFGKNITECPSIKTLLSLPSNEYITPKTTDIITVNDSSNRLIIISNLRTFLWNNIVSEINKFQNLRSNSVLSTVKELDDIFKAFQKIFVFFSDLHKQLIIEEFPEDYCYGIEFLEIFGLVDEYYESYKQLFISLIDRVNFINNYSNSVKTLLKEFCKKNSHPDILSFFKLPIRSWLVINTIITEILTNTRCYHPDIGAWCTVQEKISNLLNYFNTIENERINGVKQNLVAKCLSSIVELNENNQFWTCVDCVLFDETSKLIPLTIFIMKETIMFCAFSDFKKKLCKYEKIKGNLEKSIQRIVRINKDFVPNKNNQEKSPKKFRSSTFNPEEFVKEFKTIPFKNQLSKFNKIFNGLANINWNFVSNKKYNEYFEIKKSQFTKISYECLDNDILISPLSFDLSYINSNSMNSTIRLQLVPTIVNSIKDYENIKIDINDEIEWTPKESKDMSWIEFILAEKNNFCYFFDQMITASNQRYFDAFQESNSKGLTQLSKSSSRAYSTFFSKPKESRTRSPIIKKPTIFSNLSKRIKKIRKFLG 829          
BLAST of SMED30019889 vs. Planmine SMEST
Match: SMESG000041235.1 (SMESG000041235.1)

HSP 1 Score: 110.923 bits (276), Expect = 1.299e-24
Identity = 111/428 (25.93%), Postives = 202/428 (47.20%), Query Frame = 2
Query: 1088 INKFQNLRSNSVL--STVKELDDIFKAFQKIFVFFSDLHKQLIIEEFPEDYCYGIEFLEIFGLVDEYYESYKQLFISLIDRVNFINNYSNSVKTLLKEFCKKNSHPDILSFFKLPIRSWLVXXXXXXXXXXXXRCYHPDIGAWCTVQEKISNLLNYFNTIENERINGVKQNLVAKCLSSIVELNENNQFWTCVDCVLFDETSKLIPLTIFIMKETIMFCAFSDFKKKLCKYEKIKGNLEKSIQRIVRINKDFVPNKNNQEKSP---KKFRSSTFNPEEFVKEFKTIPF-------------KNQLSKFNKIFNGLANINWNFVSNKKYNEYFEIKKSQFTKISYECLDNDILISPLSFDLSYINSNS-MNSTIRLQLVPTIVNSXXXXXXXXXXXXXXXXWTPKESKDMSWIEFILAEKNNFCYFFDQ 2314
            +N FQ +R++ ++  S +  + +IFK     F  F D+ + L+I  +  D C G+E L  +  + +Y+++Y   F  + D ++ I+  SN+VK  ++ F   N       F ++P R   +I     +I+ +T  +HPDI  +  + +K  ++     T+E++ I G  Q +V KC+ +   +   N++ T VDC+ + +       ++F+   TI+ C F              G L     R++   K+ + + NN  + P     +R+S F  E  +K  K+I                N  SKF+K+F GL+ +NW       Y+E   ++KS    +     + D+  S + F ++YI+  S +   ++L LVP +V     Y  I + +  + +W   ++K + W EFI+ EK NFC    Q
Sbjct:  387 LNNFQAIRTHKLIENSNLLLIFNIFKQITDFFQGFYDIFQPLVIN-YSIDCCIGMELLPHYNQLKKYFQTYNSKFNQMSDLIDRID--SNAVKEHIQHFVDSNEISSFKYFIEIPKRMLTLIQMQFDDIIKSTSKFHPDIVFFIEISQKNRHVTKLIETLEDKLIEGRNQIIVMKCIGNPAIVQIGNRYRTVVDCMHYCDDGLKCAKSLFLFDNTIVMCNFK---------ASAPGKL---FDRLIAHLKEQINSGNNLTRCPSIQSIYRNSPF-IEMNIKRKKSISSVTTVNSISVRKLEGNACSKFHKLFTGLSKLNWKENPENIYSETEILEKSSLISLISHRGNFDVQ-SQMFFTINYIDKQSNLLKNMKLFLVPRVVKHPFKYNKINVALPTDFDWEYNDNKGIKWDEFIVEEKRNFCAIIAQ 797          

HSP 2 Score: 65.0846 bits (157), Expect = 2.328e-10
Identity = 64/253 (25.30%), Postives = 120/253 (47.43%), Query Frame = 2
Query:  176 IFCVEDEKDTIFLYNYNPMAIIISPLELYNLWKENKAAFS-STTEKVLKNEMLYFCGFNLIELCRM---KVKALLMGAKVSDYITDSTSRVIISKMSYQNQEKLH-------SNCNQRTFSSNLIDYFWKNHSKNPKTNAGIIN---SFRAKLFMNCRFVIVGLVRESFNSVMKAIVKHGGSVYQLENVQIATHVIACREIDIIN---------LNERKFLSENEFKNVVSKDWIFDSVKRGFLMSMINYQII 865
            IFC++D+     + ++    +IIS   L + +K+ K  +S S    ++K   ++  GF   +   +   + K ++MG  +S    D T  V+     Y+  EK H       S+C+   F+ + I+++WK  S    T   + N   +F  + F NC+  ++G        ++  I  +GGS+YQL+++    H   C  I   N         +NE    S++  KNVV++DW + SV+  +L+   +Y+++
Sbjct:   45 IFCIDDQFIIDEIASHCKRTLIISSKFLISHFKKYKLIYSNSILGNIMKTWKVHLIGFEDEDDDLIIDLQFKIIIMGGSMSTDPDDVTHLVV-----YKMHEKAHGQIFKTFSDCSN-VFNVHYIEFYWKKCSLLISTYDILDNLQETFAVRYFQNCKMHLIGFDEYQLGEMLLCIFDNGGSIYQLDHL----HSPDCIFIVPNNSKSENVQRVINEE---SKDSMKNVVTEDWFWQSVENQYLVKFDDYRVL 284          
BLAST of SMED30019889 vs. Planmine SMEST
Match: SMESG000041220.1 (SMESG000041220.1)

HSP 1 Score: 52.373 bits (124), Expect = 1.486e-6
Identity = 98/418 (23.44%), Postives = 177/418 (42.34%), Query Frame = 2
Query: 1352 SVKTLLKEFCKKNSHPDILSFFKLPIRSWLVXXXXXXXXXXXXRCYHPDIG---AWCTVQEKISNLLNY---FNTIENERINGVKQNLVAKCLSSIVELNENNQFWTCVDCVLFDETSKLIPLTIFIMKETIMFCAFSDFKKKL-------------CKYEKIKGNLEKSIQRIVRINKDFVPNKNNQ-EKSPKKFRSSTFNPEEFVKEFKTIPFKNQLSKFNKIFNGLANINWNFVSNKKYNEYFEIKKSQFTKISYECLDNDILISPLSFDLSYINSNSMN-STIRLQLVPTIVNSXXXXXXXXXXXXXXXXWTPKESKDMSWIEFILAEKNNFCY----FFD----QMITASNQRYFDAFQESNSKGLTQLSKSSS---RAYSTFFS------KPKESRTRSPIIKKPTIFSNLS 2491
            ++K   +    K++   I SF ++P R    I   + EI+  T   HPDI        +   +S L+N    ++ +   +I   K  L A  L        +N + T VDC+ F      +P  + +++ +++    SDF  K+              K + +  N   SI+  + +++    N+N+  +++     +ST N  + ++           SK++K+F GL+ +NW   +++ +     ++KS    +         L   + F + Y +  S N      QLVP  V +I+ Y+ + +    E EW+  E KD+SW E + +EK NFCY     FD    +    +   Y ++  ES     T+ S  SS   R+   FF       KP + + ++P      I S +S
Sbjct:  303 TIKEKFEPLKSKHNVSSIKSFIEIPQRMLTQIELQLKEIVEKTENEHPDIKNLKEMLKITHDVSTLVNQVAQYHAVHKSQITINKYFLKADFLR------HDNPYSTVVDCMYFSADGSTLPKMLLVLENSVVI---SDFVNKIPPNQLYKKVKKNLKKVDTLNSNNSISIKNSLVVDE----NENSTVQRTSSNCSASTLNKRKRIEGI-------LCSKYHKLFTGLSEVNWKVENSEMFCTPLLLEKSNIVSVRSNA-SQWRLYDQMFFAIDYRDPKSQNIEQYTFQLVPRFVKNIQVYDKLNVGFPFEFEWSCPE-KDISWGELVSSEKRNFCYNLACHFDVEYSETYDLTKSLYLNSSNESMESVATKFSAYSSTPKRSVKKFFRRLTTFVKPVKEKHKTPTPSNGNIQSRIS 698          
The following BLAST results are available for this feature:
BLAST of SMED30019889 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019889 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019889 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019889 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019889 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019889 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019889 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019889 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019889 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019889 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019889 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
REV18.087e-727.27Deoxycytidyl transferase; involved in repair of ab... [more]
back to top
BLAST of SMED30019889 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019889 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30019889 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000055277.10.000e+0100.00SMESG000055277.1[more]
SMESG000041235.11.299e-2425.93SMESG000041235.1[more]
SMESG000041220.11.486e-623.44SMESG000041220.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019889 ID=SMED30019889|Name=SMED30019889|organism=Schmidtea mediterranea sexual|type=transcript|length=2543bp
GCAATAGCACTTTTAATAATTTTAAATTCATATTTCGATGAAAATTTTCA
TTTACAAACCTGCAAATGCTATTATATTGAAGAATTGTAAAATAAAATCA
CCAATAGTTGTATATTTTTCTAAGCTTCAAGATATAAATAATCTCATTGA
AATTTCAAAAGTTTCCAATAAATACATTTTTTGTGTGGAAGATGAAAAGG
ATACAATTTTTCTTTATAATTACAATCCAATGGCAATAATTATTAGTCCT
CTTGAATTATATAATTTATGGAAAGAAAATAAGGCTGCATTTTCAAGTAC
AACAGAAAAAGTATTGAAAAATGAAATGCTTTATTTTTGTGGTTTCAATT
TAATTGAACTTTGCCGCATGAAAGTGAAAGCTCTGCTTATGGGAGCAAAA
GTATCTGATTACATAACCGATTCAACCTCTCGAGTAATCATTTCCAAAAT
GTCTTATCAAAACCAGGAAAAACTCCATTCAAATTGCAATCAACGAACCT
TTTCCTCGAATTTAATTGATTACTTTTGGAAAAATCATTCTAAAAATCCC
AAAACCAATGCGGGAATTATAAATTCGTTTAGAGCAAAACTATTTATGAA
TTGTCGATTCGTTATTGTTGGATTGGTTCGAGAGAGTTTTAATAGTGTCA
TGAAGGCGATTGTGAAACACGGCGGAAGTGTTTATCAACTAGAAAATGTG
CAAATTGCCACTCACGTTATCGCTTGTCGGGAAATTGATATAATCAATCT
AAATGAAAGGAAATTTCTTTCGGAAAATGAGTTCAAAAATGTCGTAAGCA
AAGATTGGATTTTCGATTCTGTGAAACGTGGATTTTTGATGAGCATGATT
AATTATCAGATTATTAGAGATAGGCAGCATATCAATTTTGATGATTTGGA
ATATGAGGAGAATCAATTTGGTAAAAATATAACTGAGTGCCCGTCAATAA
AAACACTATTAAGTCTCCCAAGTAACGAATATATTACACCAAAAACAACT
GACATTATCACTGTAAACGATTCAAGCAATCGTCTTATCATTATCAGTAA
CCTAAGAACATTTCTATGGAATAATATTGTTAGTGAGATTAATAAATTTC
AGAACTTGAGGAGCAATAGTGTTTTATCAACAGTCAAGGAACTGGATGAC
ATTTTCAAAGCATTTCAAAAGATTTTTGTCTTCTTTTCTGACCTTCATAA
ACAACTTATAATCGAAGAATTCCCCGAGGATTATTGTTATGGAATTGAAT
TCCTGGAAATATTTGGTCTCGTCGATGAGTACTATGAGTCGTACAAACAA
TTATTCATCTCATTGATAGATCGAGTGAACTTTATCAACAATTATAGCAA
TTCCGTCAAAACTTTATTAAAGGAATTCTGTAAAAAGAATTCTCACCCAG
ACATTCTAAGCTTTTTCAAATTACCAATCAGGAGTTGGCTTGTTATAAAT
ACAATAATTACCGAAATTCTGACCAATACTCGTTGCTATCATCCGGATAT
CGGTGCTTGGTGTACTGTGCAAGAGAAGATTTCTAATTTGTTGAATTACT
TCAACACCATTGAAAATGAGCGCATAAATGGAGTGAAACAGAATTTGGTT
GCTAAATGTTTGAGCTCAATTGTGGAACTAAACGAGAACAATCAGTTTTG
GACATGTGTCGATTGTGTTTTGTTTGACGAAACTAGTAAATTAATACCAT
TAACAATTTTTATAATGAAGGAAACAATTATGTTTTGCGCCTTTAGTGAT
TTTAAAAAGAAGTTGTGTAAATATGAGAAAATAAAGGGAAACTTAGAAAA
GAGCATACAGCGCATTGTGAGGATCAATAAAGACTTTGTACCAAATAAAA
ACAACCAAGAAAAATCTCCGAAAAAATTTAGAAGTTCTACTTTCAATCCA
GAAGAATTCGTTAAAGAGTTTAAAACGATTCCTTTTAAAAATCAATTATC
AAAATTCAATAAAATATTTAATGGACTCGCAAATATCAATTGGAACTTTG
TTTCGAATAAAAAATATAATGAGTATTTTGAAATTAAAAAAAGTCAGTTT
ACAAAAATTTCTTATGAATGCTTGGATAATGATATTCTTATAAGCCCGTT
ATCATTTGATTTGAGTTACATTAATAGTAACTCAATGAACTCTACTATAC
GACTGCAATTGGTACCGACAATTGTCAACAGCATAAAGGATTATGAAAAT
ATAAAAATTGACATAAACGATGAAATCGAATGGACACCTAAAGAAAGTAA
AGATATGTCATGGATTGAATTTATTTTAGCAGAGAAAAATAATTTTTGCT
ATTTTTTCGATCAAATGATAACGGCATCTAATCAACGATATTTCGATGCA
TTTCAAGAATCCAATTCCAAAGGTCTGACACAGTTATCAAAATCTTCGTC
TAGGGCATATTCAACTTTTTTTTCTAAACCGAAAGAAAGTAGAACTCGAT
CTCCCATAATTAAAAAACCCACTATTTTCTCAAACTTGTCTAAAAGAATA
AAGAAGATAAGGAAATTTTTAGGATAAACTATTTGAAAGTTAT
back to top

protein sequence of SMED30019889-orf-1

>SMED30019889-orf-1 ID=SMED30019889-orf-1|Name=SMED30019889-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=830bp
MKIFIYKPANAIILKNCKIKSPIVVYFSKLQDINNLIEISKVSNKYIFCV
EDEKDTIFLYNYNPMAIIISPLELYNLWKENKAAFSSTTEKVLKNEMLYF
CGFNLIELCRMKVKALLMGAKVSDYITDSTSRVIISKMSYQNQEKLHSNC
NQRTFSSNLIDYFWKNHSKNPKTNAGIINSFRAKLFMNCRFVIVGLVRES
FNSVMKAIVKHGGSVYQLENVQIATHVIACREIDIINLNERKFLSENEFK
NVVSKDWIFDSVKRGFLMSMINYQIIRDRQHINFDDLEYEENQFGKNITE
CPSIKTLLSLPSNEYITPKTTDIITVNDSSNRLIIISNLRTFLWNNIVSE
INKFQNLRSNSVLSTVKELDDIFKAFQKIFVFFSDLHKQLIIEEFPEDYC
YGIEFLEIFGLVDEYYESYKQLFISLIDRVNFINNYSNSVKTLLKEFCKK
NSHPDILSFFKLPIRSWLVINTIITEILTNTRCYHPDIGAWCTVQEKISN
LLNYFNTIENERINGVKQNLVAKCLSSIVELNENNQFWTCVDCVLFDETS
KLIPLTIFIMKETIMFCAFSDFKKKLCKYEKIKGNLEKSIQRIVRINKDF
VPNKNNQEKSPKKFRSSTFNPEEFVKEFKTIPFKNQLSKFNKIFNGLANI
NWNFVSNKKYNEYFEIKKSQFTKISYECLDNDILISPLSFDLSYINSNSM
NSTIRLQLVPTIVNSIKDYENIKIDINDEIEWTPKESKDMSWIEFILAEK
NNFCYFFDQMITASNQRYFDAFQESNSKGLTQLSKSSSRAYSTFFSKPKE
SRTRSPIIKKPTIFSNLSKRIKKIRKFLG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036420BRCT_dom_sf
IPR035899DBL_dom_sf
IPR001357BRCT_dom
IPR000219DH-domain
Vocabulary: molecular function
TermDefinition
GO:0005089Rho guanyl-nucleotide exchange factor activity
GO:0003677DNA binding
GO:0003684damaged DNA binding
GO:0003887DNA-directed DNA polymerase activity
GO:0005515protein binding
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
GO:0017125deoxycytidyl transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
GO:0042276error-prone translesion synthesis
GO:0070987error-free translesion synthesis
GO:0071897DNA biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005657replication fork
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001357BRCT domainSMARTSM00292BRCT_7coord: 90..170
e-value: 140.0
score: 1.6
coord: 183..265
e-value: 1.1E-5
score: 34.9
IPR001357BRCT domainPFAMPF16589BRCT_2coord: 183..273
e-value: 4.3E-8
score: 33.5
IPR001357BRCT domainPROSITEPS50172BRCTcoord: 181..275
score: 13.673
IPR036420BRCT domain superfamilyGENE3DG3DSA:3.40.50.10190coord: 175..275
e-value: 7.6E-11
score: 43.9
IPR036420BRCT domain superfamilySUPERFAMILYSSF52113BRCT domaincoord: 60..145
IPR036420BRCT domain superfamilySUPERFAMILYSSF52113BRCT domaincoord: 183..275
NoneNo IPR availableCDDcd17719BRCT_Rev1coord: 185..275
e-value: 1.16159E-6
score: 45.2525
IPR035899Dbl homology (DH) domain superfamilySUPERFAMILYSSF48065DBL homology domain (DH-domain)coord: 356..510