CCHC-type domain-containing protein

Overview
NameCCHC-type domain-containing protein
Smed IDSMED30019878
Length (bp)1237
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CCHC-type domain-containing protein (SMED30019878) t-SNE clustered cells

Violin plots show distribution of expression levels for CCHC-type domain-containing protein (SMED30019878) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CCHC-type domain-containing protein (SMED30019878) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CCHC-type domain-containing protein (SMED30019878) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019878

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30019878h1SMcG0001592 Contig4506GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymaSMED30019878h1SMcG0001592 dd_Smed_v4_9172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019878h1SMcG0016982 Contig4506GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 268.47 bits (685), Expect = 3.818e-84
Identity = 146/324 (45.06%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLG 1094
            SKK ++SRW+ +  + K VI GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK  Q P +  P +    + +D EY S M ELG       +PA +G
Sbjct:   14 SKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKF-QRPGD--PQSAQDKARMDKEYLSLMAELGE----APVPASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 267.314 bits (682), Expect = 1.782e-83
Identity = 146/324 (45.06%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLG 1094
            SKK ++SRW+ +  + K VI GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK  Q P +  P +    + +D EY S M ELG       +PA +G
Sbjct:   14 SKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKF-QRPGD--PQSAQDKARMDKEYLSLMAELGE----APVPASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 268.085 bits (684), Expect = 4.615e-83
Identity = 146/324 (45.06%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLG 1094
            SKK ++SRW+ +  + K VI GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK  Q P +  P +    + +D EY S M ELG       +PA +G
Sbjct:   14 SKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKF-QRPGD--PQSAQDKARMDKEYLSLMAELGE----APVPASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 268.085 bits (684), Expect = 4.821e-83
Identity = 146/324 (45.06%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLG 1094
            SKK ++SRW+ +  + K VI GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK  Q P +  P +    + +D EY S M ELG       +PA +G
Sbjct:   14 SKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKF-QRPGD--PQSAQDKARMDKEYLSLMAELGE----APVPASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 268.47 bits (685), Expect = 7.857e-83
Identity = 146/324 (45.06%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLG 1094
            SKK ++SRW+ +  + K VI GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK  Q P +  P +    + +D EY S M ELG       +PA +G
Sbjct:  139 SKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKF-QRPGD--PQSAQDKARMDKEYLSLMAELGE----APVPASVG 455          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: sfa-1 (SF1 protein; Splicing FActor [Source:UniProtKB/TrEMBL;Acc:G5EF97])

HSP 1 Score: 229.565 bits (584), Expect = 2.615e-68
Identity = 129/320 (40.31%), Postives = 185/320 (57.81%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDKIGG--RFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLG------EAQSC-----VTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELG 1055
            +KK R+SRWST    K  + GMPT +P ++       Y++QL+I D T KL+  ++    E   R PSP+P+Y  +GKR+NT+E R R+ LE  + + +  L  + P+  P  D      R  +KV+IPQ+ +PD+N +GL+IGPRG TLK LE E   KIIIRGKGSI  GK+     P+PGE+E LHAY+T      ++KA ++I ++I E    P+  N+LRK Q+++LA+LNGT+R  D  N  +         ++  C     VTN I C+ CG  GH+ +DCK   NP           + +D EY + M ELG
Sbjct:  186 AKKERRSRWSTT---KSFVPGMPTILPADLTEDQRNAYLLQLEIEDATRKLRLADF-GVAEGRERSPSPEPVYDANGKRLNTREVRKRQELEQLRHEKIQALLKINPNFKPPADYRAPNIRLHDKVWIPQEQFPDLNFVGLLIGPRGNTLKSLEAETGAKIIIRGKGSIKEGKLTNRLGPMPGENEPLHAYVTGTDMNVIKKACEKIKQVIAEATALPD-NNELRKLQLRELALLNGTFRPEDLANGARCSNCGSDEHKSWECPDAPNVTNQIKCTNCGAFGHISKDCK---NPKGM----YASEAGMDDEYSALMAELG 493          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 89.7373 bits (221), Expect = 9.339e-20
Identity = 49/125 (39.20%), Postives = 77/125 (61.60%), Query Frame = 3
Query:  498 EKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYIT-----SFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYR 848
            EKVF+P  ++PD N +G I+GPRG+T K LE+E   KI++RG+GS+ + K    N   P  +   E LH  I      + +K  + +A + + K++   +  PE E+DL++ Q+ +LAI+NGTYR
Sbjct:   90 EKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 211          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 89.7373 bits (221), Expect = 2.196e-19
Identity = 49/125 (39.20%), Postives = 77/125 (61.60%), Query Frame = 3
Query:  498 EKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYIT-----SFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYR 848
            EKVF+P  ++PD N +G I+GPRG+T K LE+E   KI++RG+GS+ + K    N   P  +   E LH  I      + +K  + +A + + K++   +  PE E+DL++ Q+ +LAI+NGTYR
Sbjct:   90 EKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 211          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 89.7373 bits (221), Expect = 3.044e-19
Identity = 49/125 (39.20%), Postives = 77/125 (61.60%), Query Frame = 3
Query:  498 EKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYIT-----SFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYR 848
            EKVF+P  ++PD N +G I+GPRG+T K LE+E   KI++RG+GS+ + K    N   P  +   E LH  I      + +K  + +A + + K++   +  PE E+DL++ Q+ +LAI+NGTYR
Sbjct:  162 EKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 283          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: gld-1 (Female germline-specific tumor suppressor gld-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17339])

HSP 1 Score: 89.3521 bits (220), Expect = 3.384e-19
Identity = 49/141 (34.75%), Postives = 84/141 (59.57%), Query Frame = 3
Query:  498 EKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSI--------HNGKVNVNNVPLPGEDECLHAYITSFSKEC-----VEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKML 881
            EK+++P+++YPD N +G I+GPRG+T K LE++   KI++RGKGS+        H GK N  ++    ED+ LH  +     E      ++ A +++ K++   I  PE  ++L++ Q+ +LAI+NGTYR     N  +++
Sbjct:  207 EKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKANWEHL----EDD-LHVLVQCEDTENRVHIKLQAALEQVKKLL---IPAPEGTDELKRKQLMELAIINGTYRPMKSPNPARVM 339          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: SF1 (gene:FBgn0025571 transcript:FBtr0083456)

HSP 1 Score: 279.256 bits (713), Expect = 2.526e-86
Identity = 148/322 (45.96%), Postives = 205/322 (63.66%), Query Frame = 3
Query:  138 KKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDKIG--GRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNV-NNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD-------GLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQS-SPLDGEYKSFMNELGSEGRP 1070
            K+ RKSRW  +E DK  I GMPT +P  ++P   E Y++Q QI +I+ KL+  +         R PSP+PIY  DGKR+NT+E+R R+RLE+++ QL++K+ T+ P+  P  D      R  +KV IPQ+ +PDIN +GL+IGPRG TLK +EK+   KIIIRGKGS+  GKV   +  PLPGEDE LHA+IT+ + E V KA D+I  +I++GI+ PE  NDLR+ Q+++LA LNGT RE D         +        +  +TNTI+C+ CGGTGHL +DC+  +  +  P +    S + +D EY S M ELG EG P
Sbjct:  271 KRKRKSRWGGSENDKTFIPGMPTILPSTLDPAQQEAYLVQFQIEEISRKLRTGDLGITQNPEERSPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLIVKMQTVNPEFKPPADYKPPVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGEDEPLHAFITAPNPEAVRKAVDKIKDVIRQGIEVPEGHNDLRRMQLRELAQLNGTLRENDIQRCTCGSTDHKSWQCPDKPIITNTIVCTSCGGTGHLTKDCRNKRPGSGVPGMACEDSQAKIDEEYMSLMAELG-EGPP 591          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0084178)

HSP 1 Score: 87.8113 bits (216), Expect = 1.024e-18
Identity = 50/126 (39.68%), Postives = 76/126 (60.32%), Query Frame = 3
Query:  498 EKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDEC---LHAYITSFSKECVEKATDRINKIIQEG----IDFPELENDLRKNQMKQLAILNGTYRET 854
            EKV++P  ++PD N +G I+GPRG+T K LE+E   KI++RGKGS+ + K    N   P  +     LH  IT    E   +AT ++ + + E     +   E E++L+K Q+ +LAI+NGTYR+T
Sbjct:  139 EKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTE--NRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRDT 262          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0100514)

HSP 1 Score: 87.8113 bits (216), Expect = 1.089e-18
Identity = 50/126 (39.68%), Postives = 76/126 (60.32%), Query Frame = 3
Query:  498 EKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDEC---LHAYITSFSKECVEKATDRINKIIQEG----IDFPELENDLRKNQMKQLAILNGTYRET 854
            EKV++P  ++PD N +G I+GPRG+T K LE+E   KI++RGKGS+ + K    N   P  +     LH  IT    E   +AT ++ + + E     +   E E++L+K Q+ +LAI+NGTYR+T
Sbjct:  139 EKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTE--NRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRDT 262          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0301402)

HSP 1 Score: 87.8113 bits (216), Expect = 1.119e-18
Identity = 50/126 (39.68%), Postives = 76/126 (60.32%), Query Frame = 3
Query:  498 EKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDEC---LHAYITSFSKECVEKATDRINKIIQEG----IDFPELENDLRKNQMKQLAILNGTYRET 854
            EKV++P  ++PD N +G I+GPRG+T K LE+E   KI++RGKGS+ + K    N   P  +     LH  IT    E   +AT ++ + + E     +   E E++L+K Q+ +LAI+NGTYR+T
Sbjct:  139 EKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTE--NRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRDT 262          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0335195)

HSP 1 Score: 87.8113 bits (216), Expect = 1.130e-18
Identity = 50/126 (39.68%), Postives = 76/126 (60.32%), Query Frame = 3
Query:  498 EKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDEC---LHAYITSFSKECVEKATDRINKIIQEG----IDFPELENDLRKNQMKQLAILNGTYRET 854
            EKV++P  ++PD N +G I+GPRG+T K LE+E   KI++RGKGS+ + K    N   P  +     LH  IT    E   +AT ++ + + E     +   E E++L+K Q+ +LAI+NGTYR+T
Sbjct:  139 EKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTE--NRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRDT 262          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 264.618 bits (675), Expect = 1.123e-82
Identity = 148/324 (45.68%), Postives = 204/324 (62.96%), Query Frame = 3
Query:  138 KKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQS----CVTNTIICSLCGGTGHLPRDCKVNQN----PAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPT 1073
            KK ++SRWS+   D K VI GMPT IPP +       YI+QLQI D+T KL+  +    +    R PSP+PIY  +GKR+NT+EYR R++LE+ +  L+ ++  L P+  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE   KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D     ++L   QS     +TNT +C+ CGG GH+  DCK   +    P E PP +    + +D EY S M ELG    P+
Sbjct:   15 KKRKRSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSTEPRSITNTTLCTKCGGAGHISSDCKFTSSFAPRPGE-PPQSAQDKARMDKEYLSLMAELGEAPVPS 333          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 265.003 bits (676), Expect = 9.605e-82
Identity = 148/324 (45.68%), Postives = 204/324 (62.96%), Query Frame = 3
Query:  138 KKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQS----CVTNTIICSLCGGTGHLPRDCKVNQN----PAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPT 1073
            KK ++SRWS+   D K VI GMPT IPP +       YI+QLQI D+T KL+  +    +    R PSP+PIY  +GKR+NT+EYR R++LE+ +  L+ ++  L P+  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE   KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D     ++L   QS     +TNT +C+ CGG GH+  DCK   +    P E PP +    + +D EY S M ELG    P+
Sbjct:   87 KKRKRSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSTEPRSITNTTLCTKCGGAGHISSDCKFTSSFAPRPGE-PPQSAQDKARMDKEYLSLMAELGEAPVPS 405          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: qkib (QKI, KH domain containing, RNA binding b [Source:ZFIN;Acc:ZDB-GENE-081028-54])

HSP 1 Score: 95.5153 bits (236), Expect = 1.848e-21
Identity = 52/126 (41.27%), Postives = 76/126 (60.32%), Query Frame = 3
Query:  489 RFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD 857
            + +EK+++P  +YPD N +G I+GPRGLT K LE E   KI++RGKGS+ + K    N   P  +   E LH  IT      VE A +R    ++  ++  E E+ L+K Q+ +LAILNGTYR+ +
Sbjct:   81 QLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLIT------VEDAQNRAEIKLKRAVEEAEGEDSLKKMQLMELAILNGTYRDAN 200          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: qkib (QKI, KH domain containing, RNA binding b [Source:ZFIN;Acc:ZDB-GENE-081028-54])

HSP 1 Score: 95.1301 bits (235), Expect = 1.877e-21
Identity = 52/126 (41.27%), Postives = 76/126 (60.32%), Query Frame = 3
Query:  489 RFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD 857
            + +EK+++P  +YPD N +G I+GPRGLT K LE E   KI++RGKGS+ + K    N   P  +   E LH  IT      VE A +R    ++  ++  E E+ L+K Q+ +LAILNGTYR+ +
Sbjct:   81 QLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLIT------VEDAQNRAEIKLKRAVEEAEGEDSLKKMQLMELAILNGTYRDAN 200          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: qkib (QKI, KH domain containing, RNA binding b [Source:ZFIN;Acc:ZDB-GENE-081028-54])

HSP 1 Score: 93.9745 bits (232), Expect = 6.221e-21
Identity = 52/131 (39.69%), Postives = 80/131 (61.07%), Query Frame = 3
Query:  489 RFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYITSFSKECVEKATDRINKIIQEGI-----DFPELENDLRKNQMKQLAILNGTYRETD 857
            + +EK+++P  +YPD N +G I+GPRGLT K LE E   KI++RGKGS+ + K    N   P  +   E LH  IT   ++   +A  ++ + ++E +     DF E E+ L+K Q+ +LAILNGTYR+ +
Sbjct:   81 QLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLIT--VEDAQNRAEIKLKRAVEEVLVIFLRDFAEGEDSLKKMQLMELAILNGTYRDAN 209          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: men1 (menin 1 [Source:NCBI gene;Acc:549115])

HSP 1 Score: 266.159 bits (679), Expect = 1.855e-83
Identity = 146/327 (44.65%), Postives = 200/327 (61.16%), Query Frame = 3
Query:  120 SEFTISKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCK---VNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVL 1079
            S   +  K ++SRW+    D K +I GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA D+I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK   V   P E  P +    + +D EY S M ELG    PT +
Sbjct:   13 SASALKWKRKRSRWNDETPDQKTIIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVDQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFTSVTVRPGE--PQSAQDKARMDKEYLSLMAELGEAPVPTPM 337          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: men1 (menin 1 [Source:NCBI gene;Acc:549115])

HSP 1 Score: 266.159 bits (679), Expect = 1.480e-82
Identity = 146/323 (45.20%), Postives = 200/323 (61.92%), Query Frame = 3
Query:  132 ISKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCK---VNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVL 1079
             S+K ++SRW+    D K +I GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA D+I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK   V   P E  P +    + +D EY S M ELG    PT +
Sbjct:   47 FSRKRKRSRWNDETPDQKTIIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVDQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFTSVTVRPGE--PQSAQDKARMDKEYLSLMAELGEAPVPTPM 367          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: men1 (menin 1 [Source:NCBI gene;Acc:549115])

HSP 1 Score: 266.159 bits (679), Expect = 2.516e-82
Identity = 146/323 (45.20%), Postives = 200/323 (61.92%), Query Frame = 3
Query:  132 ISKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCK---VNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVL 1079
             S+K ++SRW+    D K +I GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA D+I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK   V   P E  P +    + +D EY S M ELG    PT +
Sbjct:   74 FSRKRKRSRWNDETPDQKTIIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVDQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFTSVTVRPGE--PQSAQDKARMDKEYLSLMAELGEAPVPTPM 394          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:Xenbase;Acc:XB-GENE-971062])

HSP 1 Score: 90.1225 bits (222), Expect = 1.484e-19
Identity = 50/131 (38.17%), Postives = 78/131 (59.54%), Query Frame = 3
Query:  489 RFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYITSFSKEC-----VEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD 857
            + +EK+++P  +YPD N +G I+GPRGLT K LE E   KI++RGKGS+ + K    N   P  +   E LH  IT    +      +++A + + K++   +   E E+ L+K Q+ +LAILNGTYR+ +
Sbjct:   82 QLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 209          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:Xenbase;Acc:XB-GENE-971062])

HSP 1 Score: 86.2705 bits (212), Expect = 5.405e-18
Identity = 52/146 (35.62%), Postives = 81/146 (55.48%), Query Frame = 3
Query:  489 RFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNV------PLPGED------------ECLHAYITSFSKEC-----VEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD 857
            + +EK+++P  +YPD N +G I+GPRGLT K LE E   KI++RGKGS+ + K  V N+       L  E+            E LH  IT    +      +++A + + K++   +   E E+ L+K Q+ +LAILNGTYR+ +
Sbjct:  106 QLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKAVTNILECSILALNKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 248          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 268.085 bits (684), Expect = 4.193e-84
Identity = 146/324 (45.06%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLG 1094
            SKK ++SRW+ +  + K VI GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK  Q P +  P +    + +D EY S M ELG       +PA +G
Sbjct:   14 SKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKF-QRPGD--PQSAQDKARMDKEYLSLMAELGE----APVPASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 268.085 bits (684), Expect = 4.193e-84
Identity = 146/324 (45.06%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLG 1094
            SKK ++SRW+ +  + K VI GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK  Q P +  P +    + +D EY S M ELG       +PA +G
Sbjct:   14 SKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKF-QRPGD--PQSAQDKARMDKEYLSLMAELGE----APVPASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 267.7 bits (683), Expect = 1.088e-83
Identity = 146/324 (45.06%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLG 1094
            SKK ++SRW+ +  + K VI GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK  Q P +  P +    + +D EY S M ELG       +PA +G
Sbjct:   14 SKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKF-QRPGD--PQSAQDKARMDKEYLSLMAELGE----APVPASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 267.7 bits (683), Expect = 1.088e-83
Identity = 146/324 (45.06%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLG 1094
            SKK ++SRW+ +  + K VI GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK  Q P +  P +    + +D EY S M ELG       +PA +G
Sbjct:   14 SKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKF-QRPGD--PQSAQDKARMDKEYLSLMAELGE----APVPASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 268.085 bits (684), Expect = 3.798e-83
Identity = 146/324 (45.06%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLG 1094
            SKK ++SRW+ +  + K VI GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK  Q P +  P +    + +D EY S M ELG       +PA +G
Sbjct:   14 SKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKF-QRPGD--PQSAQDKARMDKEYLSLMAELGE----APVPASVG 330          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q15637|SF01_HUMAN (Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4)

HSP 1 Score: 268.085 bits (684), Expect = 2.315e-82
Identity = 146/324 (45.06%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLG 1094
            SKK ++SRW+ +  + K VI GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK  Q P +  P +    + +D EY S M ELG       +PA +G
Sbjct:   14 SKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKF-QRPGD--PQSAQDKARMDKEYLSLMAELGE----APVPASVG 330          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q64213|SF01_MOUSE (Splicing factor 1 OS=Mus musculus OX=10090 GN=Sf1 PE=1 SV=6)

HSP 1 Score: 266.929 bits (681), Expect = 1.011e-81
Identity = 146/324 (45.06%), Postives = 203/324 (62.65%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLG 1094
            SKK ++SRW+ +  + K VI GMPT IPP +  +    YI+QLQI D+T KL+  +         R PSP+PIY  +GKR+NT+E+R R++LE+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE N KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK  Q P +  P +    + +D EY S M ELG       +PA +G
Sbjct:   14 SKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKF-QRPGD--PQSAQDKARMDKEYLSLMAELGE----APVPASVG 330          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NIW7|BBP_NEUCR (Branchpoint-bridging protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=bbp-1 PE=3 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 5.732e-57
Identity = 129/358 (36.03%), Postives = 186/358 (51.96%), Query Frame = 3
Query:  111 PTHSEFTISKKNRKSRWSTNEFDKCV-IAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD-KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYR--ETDGLNKLKMLG-------EAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEF---------PPLNIPQSS---PLDGEYKSFMNELGSEG-RPTVLPAYLGFLPEFP 1112
            P  SE    ++ +++RW     +K   + G+PT I  NM  +  E Y + L+I +IT KL+  +         R PSP P Y   G+R+NT+EYR R++LED + +L+ K     P+  P +D +   + +EKV++P +DYP+IN IGL+IGPRG TLK +E E   KI IRGKGS+  GK   +      ++E LH  I + ++E V KA   I+ II+     PE +N+L++NQ+++LA LNGT R  E         +G       E Q+   N IIC +CG  GH+ RDC   Q  A +             I  S     +D EY+  M ELG  G  P  + A  G     P
Sbjct:   69 PERSEDGPKRRKKRNRWGEATENKAAGLMGLPTAIVANMTSEQLEAYTLHLRIEEITQKLKIDDVVPA--DGDRSPSPAPQYDNHGRRVNTREYRYRKKLEDERHKLIEKAMKTIPNYHPPSDYRRPTKTQEKVYVPVNDYPEINFIGLLIGPRGNTLKKMETESGAKIAIRGKGSVKEGKGRSDAAHSSNQEEDLHCLIMADTEEKVNKAKKLIHNIIETAASIPEGQNELKRNQLRELAALNGTLRDDENQACQNCGQIGHRKYDCPEKQNYTAN-IICRVCGNAGHMARDCPDRQRGASWRNDGPGAGRTAGRIGSSGGGDAVDREYEQLMQELGGTGAAPARIEAGPGSFSNGP 423          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P0CO44|BBP_CRYNJ (Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=BBP PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 5.786e-56
Identity = 119/326 (36.50%), Postives = 180/326 (55.21%), Query Frame = 3
Query:  141 KNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEI--EAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD---KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKL-KMLGE---------AQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPT 1073
            + R+SRW  +   K  + GMP  +  N++  + + Y I +++ +I  KL+    T ++      R PSP P Y   G+R NT+E R R++LED + +L+ +     P+  P  D   K G R ++KV+IP  ++P+IN  GL++GPRG +LK +E+E   KI IRGKGS+  GK    N P   EDE LH  IT+  +  V+     INK+I+     PE END ++NQ+++LA LNGT R+ +  N+L +  GE          Q   +  +IC +CGG GH+ RDC+   +P+    L   + +  D EY + M ELG  G  T
Sbjct:  129 RKRRSRWG-DASAKVNVPGMPVAVMGNVSQTELDNYAIHVRLEEINRKLR----TGDVVPPEGQRSPSPTPQYDAYGRRTNTRELRYRKKLEDERTRLIDRAVKSDPNFRPPVDFQHKRGSRPQDKVYIPVKEFPEINFFGLLVGPRGNSLKKMERESGAKISIRGKGSVKEGKGRAGNFPQDEEDE-LHCLITADDESKVKTCVALINKVIETAASTPEGENDHKRNQLRELASLNGTLRDDE--NQLCQNCGEKGHRRWECPQQRVYSANVICRICGGAGHMARDCRGRGDPS----LTQNKQTAFDSEYTALMAELGEGGGST 442          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P0CO45|BBP_CRYNB (Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=BBP PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 5.786e-56
Identity = 119/326 (36.50%), Postives = 180/326 (55.21%), Query Frame = 3
Query:  141 KNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEI--EAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD---KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKL-KMLGE---------AQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPT 1073
            + R+SRW  +   K  + GMP  +  N++  + + Y I +++ +I  KL+    T ++      R PSP P Y   G+R NT+E R R++LED + +L+ +     P+  P  D   K G R ++KV+IP  ++P+IN  GL++GPRG +LK +E+E   KI IRGKGS+  GK    N P   EDE LH  IT+  +  V+     INK+I+     PE END ++NQ+++LA LNGT R+ +  N+L +  GE          Q   +  +IC +CGG GH+ RDC+   +P+    L   + +  D EY + M ELG  G  T
Sbjct:  129 RKRRSRWG-DASAKVNVPGMPVAVMGNVSQTELDNYAIHVRLEEINRKLR----TGDVVPPEGQRSPSPTPQYDAYGRRTNTRELRYRKKLEDERTRLIDRAVKSDPNFRPPVDFQHKRGSRPQDKVYIPVKEFPEINFFGLLVGPRGNSLKKMERESGAKISIRGKGSVKEGKGRAGNFPQDEEDE-LHCLITADDESKVKTCVALINKVIETAASTPEGENDHKRNQLRELASLNGTLRDDE--NQLCQNCGEKGHRRWECPQQRVYSANVICRICGGAGHMARDCRGRGDPS----LTQNKQTAFDSEYTALMAELGEGGGST 442          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: G4VNH1 (Putative zinc finger protein OS=Schistosoma mansoni OX=6183 GN=Smp_021540 PE=4 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 1.907e-100
Identity = 162/335 (48.36%), Postives = 219/335 (65.37%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDKIG--GRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNV-NNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCK-----------VNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLGF 1097
            + + RKSRWS  E D+  I GMPT +PPN+ P+   VYIIQLQI D++ +L+  +         R PSP+PIY  DGKR+NT+EYR R++LED +  L+ +L  + P+  P +D      R  +KVFIPQD++PDIN +GL+IGPRG TLK LEK+   K+IIRGKGS+  GKV   + +PLPGEDE LHA+I++ S ECV+KA  +IN+II++GI+ PE +NDLR+ Q+++LA+LNGT RE +GL KL+ + EAQS  TN I C +CGG GHL  DCK           +N NP+E         + +D EY + M ELG  G   + P   GF
Sbjct:   30 APRKRKSRWSAAETDRIFIPGMPTQLPPNLTPQQERVYIIQLQIEDMSRRLKSGDLGIPKNPEDRSPSPEPIYSSDGKRLNTREYRTRKKLEDDRHALVQQLMEINPEYKPPSDYKAPQNRITDKVFIPQDNHPDINFVGLLIGPRGNTLKALEKDTGAKVIIRGKGSVKEGKVGRRDGLPLPGEDEPLHAFISAPSAECVDKAVKKINEIIRQGIEIPESQNDLRRAQLRELALLNGTLREHEGLMKLRAMAEAQSIATNKIQCGICGGAGHLSTDCKALLGGQAYLDQLNANPSE--------RAKMDSEYTALMAELGVGGSQGLPPGLRGF 356          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A5K4F2D9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.290e-100
Identity = 162/335 (48.36%), Postives = 219/335 (65.37%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDKIG--GRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNV-NNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCK-----------VNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLGF 1097
            + + RKSRWS  E D+  I GMPT +PPN+ P+   VYIIQLQI D++ +L+  +         R PSP+PIY  DGKR+NT+EYR R++LED +  L+ +L  + P+  P +D      R  +KVFIPQD++PDIN +GL+IGPRG TLK LEK+   K+IIRGKGS+  GKV   + +PLPGEDE LHA+I++ S ECV+KA  +IN+II++GI+ PE +NDLR+ Q+++LA+LNGT RE +GL KL+ + EAQS  TN I C +CGG GHL  DCK           +N NP+E         + +D EY + M ELG  G   + P   GF
Sbjct:   30 APRKRKSRWSAAETDRIFIPGMPTQLPPNLTPQQERVYIIQLQIEDMSRRLKSGDLGIPKNPEDRSPSPEPIYSSDGKRLNTREYRTRKKLEDDRHALVQQLMEINPEYKPPSDYKAPQNRITDKVFIPQDNHPDINFVGLLIGPRGNTLKALEKDTGAKVIIRGKGSVKEGKVGRRDGLPLPGEDEPLHAFISAPSAECVDKAVKKINEIIRQGIEIPESQNDLRRAQLRELALLNGTLREHEGLMKLRAMAEAQSIATNKIQCGICGGAGHLSTDCKALLGGQAYLDQLNANPSE--------RAKMDSEYTALMAELGVGGSQGLPPGLRGF 356          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A183KMC8 (KH domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS16201 PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 5.017e-100
Identity = 162/335 (48.36%), Postives = 218/335 (65.07%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDKIG--GRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNV-NNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCK-----------VNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLGF 1097
            + + RKSRWS  E D+  I GMPT +PPN+ P+   VYIIQLQI D++ +L+  +         R PSP+PIY  DGKR+NT+EYR R++LED +  L+ +L  + P+  P +D      R  +KVFIPQD++PDIN +GL+IGPRG TLK LEK+   K+IIRGKGS+  GKV   + +PLPGEDE LHA+I++ S ECV+KA  +IN+II++GI+ PE +NDLR+ Q+++LA+LNGT RE +GL KL+ + EAQS  TN I C +CGG GHL  DCK           +N NP E         + +D EY + M ELG  G   + P   GF
Sbjct:   30 APRKRKSRWSAVETDRIFIPGMPTQLPPNLTPQQERVYIIQLQIEDMSRRLKSGDLGIPKNPEDRSPSPEPIYSSDGKRLNTREYRTRKKLEDDRHALVQQLMEINPEYKPPSDYKAPQNRITDKVFIPQDNHPDINFVGLLIGPRGNTLKALEKDTGAKVIIRGKGSVKEGKVGRRDGLPLPGEDEPLHAFISAPSAECVDKAVKKINEIIRQGIEIPESQNDLRRAQLRELALLNGTLREHEGLMKLRAMAEAQSIATNKIQCGICGGAGHLSTDCKALLGGQAYLDQLNANPGE--------RAKMDSEYTALMAELGVGGSQGLPPGLRGF 356          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A4Z2DU10 (Splicing factor 1 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_005638 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 4.539e-99
Identity = 158/321 (49.22%), Postives = 214/321 (66.67%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNV-NNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCK-----------VNQNPAEFPPLNIPQSSPLDGEYKSFMNELG 1055
            + + RKSRWS  E D+  I GMPT +PPN+ P+   VYIIQLQI D++ +L+  +         R PSP+PIY  DGKR+NT+EYR R++LED +  L+ +L  + P+  P +D      R  +KVFIPQD++PDIN +GL+IGPRG TLK LEK+   K+IIRGKGS+  GKV   + +PLPGEDE LHA+I++ S ECV+KA  +IN+II++GI+ PE +NDLR+ Q+++LA+LNGT RE +GL KL+ + EAQS  TN I C +CGG GHL  DCK           +N NP+E         + +D EY + M ELG
Sbjct:   30 APRKRKSRWSAAETDRIFIPGMPTQLPPNLTPQQERVYIIQLQIEDMSRRLKSGDLGIPKNPEDRSPSPEPIYSSDGKRLNTREYRTRKKLEDDRHALVQQLMEINPEYKPPSDYKPPQNRITDKVFIPQDNHPDINFVGLLIGPRGNTLKALEKDTGAKVIIRGKGSVKEGKVGRRDGLPLPGEDEPLHAFISAPSAECVDKAVKKINEIIRQGIEIPESQNDLRRAQLRELALLNGTLREHEGLMKLRAMAEAQSIATNKIQCGICGGAGHLSTDCKALLGGQAYLDQLNANPSE--------RAKMDSEYTALMAELG 342          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A4Z2DTV8 (Splicing factor 1 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_005638 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.409e-98
Identity = 158/321 (49.22%), Postives = 214/321 (66.67%), Query Frame = 3
Query:  135 SKKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNV-NNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCK-----------VNQNPAEFPPLNIPQSSPLDGEYKSFMNELG 1055
            + + RKSRWS  E D+  I GMPT +PPN+ P+   VYIIQLQI D++ +L+  +         R PSP+PIY  DGKR+NT+EYR R++LED +  L+ +L  + P+  P +D      R  +KVFIPQD++PDIN +GL+IGPRG TLK LEK+   K+IIRGKGS+  GKV   + +PLPGEDE LHA+I++ S ECV+KA  +IN+II++GI+ PE +NDLR+ Q+++LA+LNGT RE +GL KL+ + EAQS  TN I C +CGG GHL  DCK           +N NP+E         + +D EY + M ELG
Sbjct:   30 APRKRKSRWSAAETDRIFIPGMPTQLPPNLTPQQERVYIIQLQIEDMSRRLKSGDLGIPKNPEDRSPSPEPIYSSDGKRLNTREYRTRKKLEDDRHALVQQLMEINPEYKPPSDYKPPQNRITDKVFIPQDNHPDINFVGLLIGPRGNTLKALEKDTGAKVIIRGKGSVKEGKVGRRDGLPLPGEDEPLHAFISAPSAECVDKAVKKINEIIRQGIEIPESQNDLRRAQLRELALLNGTLREHEGLMKLRAMAEAQSIATNKIQCGICGGAGHLSTDCKALLGGQAYLDQLNANPSE--------RAKMDSEYTALMAELG 342          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 265.774 bits (678), Expect = 1.780e-81
Identity = 144/320 (45.00%), Postives = 199/320 (62.19%), Query Frame = 3
Query:  117 HSEFTISKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEF---PPLNIPQSSPLDGEYKSFMNELG 1055
             S+    KK +KSRWS+   D K VI GMPT IPP +  +    YI+QLQI D+T KL+  +    +    R PSP+PIY  +GKR+NT+EYR R++LE+ +  L+ ++  L P+  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE   KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK   +  +    PP +    + +D EY S M ELG
Sbjct:  160 QSQGGDQKKRKKSRWSSETPDQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSEPRSITNTTLCTKCGGAGHIASDCKFTSSYTQRQGEPPQSAQDKARMDKEYLSLMAELG 479          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: qki2 (protein quaking-B [Source:NCBI gene;Acc:103029551])

HSP 1 Score: 90.8929 bits (224), Expect = 4.157e-20
Identity = 52/138 (37.68%), Postives = 81/138 (58.70%), Query Frame = 3
Query:  474 DKIG--GRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYITSFSKEC-----VEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD 857
            D +G   + +EK+++P  +YPD N +G I+GPRGLT K LE E   KI++RGKGS+ + K    N   P  +   E LH  IT    +      +++A + + K++   +   E E+ L+K Q+ +LAILNGTYR+ +
Sbjct:   74 DAVGPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 208          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: qki2 (protein quaking-B [Source:NCBI gene;Acc:103029551])

HSP 1 Score: 90.8929 bits (224), Expect = 4.631e-20
Identity = 52/138 (37.68%), Postives = 81/138 (58.70%), Query Frame = 3
Query:  474 DKIG--GRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYITSFSKEC-----VEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD 857
            D +G   + +EK+++P  +YPD N +G I+GPRGLT K LE E   KI++RGKGS+ + K    N   P  +   E LH  IT    +      +++A + + K++   +   E E+ L+K Q+ +LAILNGTYR+ +
Sbjct:   74 DAVGPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 208          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: qki2 (protein quaking-B [Source:NCBI gene;Acc:103029551])

HSP 1 Score: 91.2781 bits (225), Expect = 5.345e-20
Identity = 52/138 (37.68%), Postives = 81/138 (58.70%), Query Frame = 3
Query:  474 DKIG--GRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYITSFSKEC-----VEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD 857
            D +G   + +EK+++P  +YPD N +G I+GPRGLT K LE E   KI++RGKGS+ + K    N   P  +   E LH  IT    +      +++A + + K++   +   E E+ L+K Q+ +LAILNGTYR+ +
Sbjct:   74 DAVGPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 208          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: qkib (QKI, KH domain containing, RNA binding b [Source:ZFIN;Acc:ZDB-GENE-081028-54])

HSP 1 Score: 90.8929 bits (224), Expect = 5.390e-20
Identity = 51/131 (38.93%), Postives = 79/131 (60.31%), Query Frame = 3
Query:  489 RFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYITSFSKEC-----VEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD 857
            + +EK+++P  +YPD N +G I+GPRGLT K LE E   KI++RGKGS+ + K    N   P  +   E LH  IT    +      +++A + +NK++   +   E E+ L+K Q+ +LAILNGTYR+ +
Sbjct:   81 QLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKVRANRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVNKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 208          
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 266.159 bits (679), Expect = 1.220e-82
Identity = 141/313 (45.05%), Postives = 200/313 (63.90%), Query Frame = 3
Query:  138 KKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVN-NVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYR--ETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSE 1061
            KK ++SRW T   +K  + GMPT +PP +N      YI+QLQI D+  KL+  +         R PSP+PIY  +GKR+NT+EYR R+++ED +  L+ +++ L PD  P  D      +  E++ IPQD++PDIN IGLIIGPRG TLK +EKE N KI+IRGKGS+  GK+      PLPGEDE LHA +T+ +++ V KA D+I  I+++GI+ PE +N+LR+ Q+++LA LNGT R  E+  L   +   E +S VTN  IC+ CGG GH+  DC+++   +  PP    + + +D EY S M ELG E
Sbjct:   86 KKAKRSRWDTEMTEKIAVPGMPTVLPPGLNKDQERAYIVQLQIEDMNRKLRTGDLGIPPNPEERSPSPEPIYNNEGKRLNTREYRTRKKIEDDRHVLIQEMYRLNPDYKPPADYKPPAQKISERIMIPQDEHPDINFIGLIIGPRGNTLKKIEKECNAKIMIRGKGSVKEGKIGHKPGQPLPGEDEPLHALVTASTQDNVRKAVDQIKNILKQGIEVPEGQNELRRMQLRELARLNGTLRDDESRVLRPWQAPPETRS-VTNMTICNRCGGAGHIASDCRIS---SMGPPQGNQERARMDEEYLSLMAELGEE 394          
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Match: khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:NCBI gene;Acc:768147])

HSP 1 Score: 59.3066 bits (142), Expect = 4.414e-10
Identity = 37/125 (29.60%), Postives = 66/125 (52.80%), Query Frame = 3
Query:  489 RFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED------ECLHAYITSFSKECVEKATDRINKIIQEGIDF--PELENDLRKNQMKQLAILNG 839
            +  E+V IP   +P  N +G ++GPRG +LK +++E   K+ I GKGS+ + K     +   GE+      E LH  I  F+     +A  R+   + E   +  P+  +++R+ Q+++L+ L G
Sbjct:   36 KLAERVIIPAKQHPKFNFVGKLLGPRGNSLKRMQEETGTKMSILGKGSMRD-KALEEEMRKSGENKYAHLSEELHVLIEVFAPPS--EAYSRMGHALDEVKKYLVPDYNDEIRQEQLRELSFLKG 157          
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Match: KHDRBS3 (KH RNA binding domain containing, signal transduction associated 3 [Source:HGNC Symbol;Acc:HGNC:18117])

HSP 1 Score: 56.9954 bits (136), Expect = 1.747e-9
Identity = 38/122 (31.15%), Postives = 66/122 (54.10%), Query Frame = 3
Query:  498 EKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGE------DECLHAYITSFSKECVEKATDRINKIIQEGIDF--PELENDLRKNQMKQLAILNG 839
            E+V IP   +P  N IG ++GPRG +LK L++E   K+ I GKGS+ + +    ++   GE      +E LH  I  F+     +A  R+   + E   +  P+  +++R+ Q+++L+ L G
Sbjct:   39 ERVIIPVRQHPKFNFIGKLLGPRGNSLKRLKEETGTKLSILGKGSMRD-RDKEEDLRKSGEAKYAHLNEDLHVLIEVFAPPS--QAYRRMGHALDEVKKYLVPDYNDEIRQQQLRELSFLKG 157          
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Match: khdrbs1a (KH domain containing, RNA binding, signal transduction associated 1a [Source:ZFIN;Acc:ZDB-GENE-000210-25])

HSP 1 Score: 53.1434 bits (126), Expect = 4.348e-8
Identity = 35/126 (27.78%), Postives = 64/126 (50.79%), Query Frame = 3
Query:  489 RFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGE------DECLHAYITSFSKECVEKATDRINKIIQEGIDF--PELENDLRKNQMKQLAILNGT 842
            +  EKV IP   +P  N +G ++GP+G TLK L+ E   ++ I GKG + + +     +   GE      +E LH  I  ++   + +A  R+   ++E   F  P+  +++ + Q+ ++  LNG 
Sbjct:   60 KLAEKVLIPAKQHPKFNFVGKLLGPQGNTLKRLQVETGTRMAIMGKGCMKD-RAKEEELRNSGEAKYVHLNEELHVLIEVYAP--LPEAYSRMGHALEEVKKFFNPDYNDEICQEQLMEMTYLNGV 182          
BLAST of CCHC-type domain-containing protein vs. Ensembl Yeast
Match: MSL5 (Component of commitment complex; which defines first step in splicing pathway; essential protein that interacts with Mud2p and Prp40p, forming a bridge between the intron ends; also involved in nuclear retention of pre-mRNA; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000004106])

HSP 1 Score: 167.162 bits (422), Expect = 1.739e-47
Identity = 104/284 (36.62%), Postives = 160/284 (56.34%), Query Frame = 3
Query:  153 SRWSTN--EFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLM-LKLHTLRPDLVPHTD-KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGE---DECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD------GLNKLKMLGEAQSCVTNT--IICSLCGGTGHLPRDC 959
            S W  N  E D      +P+ I   +  +    Y +  +I +IT KL+  ++        R PSP P+Y   GKR NT+E R R++LED + +L+ + L T+ P  VP  D K   +F++K +IP D YPD+N +GL++GPRG TL+ L+++ N KI IRG+GS+  GK N +++P PG    ++ LH  I + S++ ++K       I+ + +  PE +NDL++ Q+++LA LNGT RE +      GL   K        + N   I+C +CG TGH  RDC
Sbjct:   33 SLWRKNTVESDVHRFNSLPSKISGALTREQIYSYQVMFRIQEITIKLRTNDFVPP-SRKNRSPSPPPVYDAQGKRTNTREQRYRKKLEDERIKLVEIALKTI-PYFVPPDDYKRPTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGK-NASDLP-PGAMNFEDPLHCLIIADSEDKIQKGIKVCQNIVIKAVTSPEGQNDLKRGQLRELAELNGTLREDNRPCPICGLKDHKRYDCPNRKIPNIQGIVCKICGQTGHFSRDC 312          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO45484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSV9])

HSP 1 Score: 172.17 bits (435), Expect = 4.999e-51
Identity = 96/215 (44.65%), Postives = 133/215 (61.86%), Query Frame = 3
Query:  108 EPTHSEFTISKKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDKIGG--RFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGK------VNVNNVPLPGEDECLHAYITSFSKECV 728
            E T S     KK RKSRW   E  K +I GMPTT+PPN+ P   + Y++QL+I +I+  L+  +         R PSP+PIY  DGKR+NT+++R R+RLED + + +  +  + PD  P  D      + ++KV IPQD+ P++N IGL+IGPRG TLK++EKE N KI+IRGKGSI +GK      + + N    GEDE LHA +T  + E V
Sbjct:   51 EKTPSGREDRKKKRKSRWG-GEDKKMIIPGMPTTLPPNLKPDQQKAYLMQLRIEEISRMLRTGDLGIPDNPEDRSPSPEPIYNTDGKRLNTRDFRVRKRLEDERHKFIQDMMKINPDFKPPADYKPPLIKIQDKVMIPQDENPEVNFIGLLIGPRGNTLKNMEKETNAKIMIRGKGSIKDGKQGRGRDMQLMNS---GEDEPLHALVTGPTAESV 261          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO30297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T170])

HSP 1 Score: 83.1889 bits (204), Expect = 9.224e-19
Identity = 47/127 (37.01%), Postives = 76/127 (59.84%), Query Frame = 3
Query:  498 EKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGE---DECLHAYITSFSKE--C---VEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRET 854
            EKV+ P  ++P  N +G +IGPRG+TL+++E     K+++RGKGS+ + K+       P     DE LH  I+    E  C   +EKA +R+  +++      E E++++K Q+K LA+LNGT RE+
Sbjct:   55 EKVYAPVKEFPKFNFVGRVIGPRGMTLREIESTTGCKLLVRGKGSMKDKKLEEEKRGQPNYEHLDEDLHVLISCEDTEERCHTRLEKAVERVQSLLR---PVEEGEDEIKKKQLKDLALLNGTLRES 178          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO44127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWI4])

HSP 1 Score: 60.077 bits (144), Expect = 8.393e-11
Identity = 38/124 (30.65%), Postives = 66/124 (53.23%), Query Frame = 3
Query:  489 RFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDECLHAYITSFSKECVE------KATDRINKIIQEGIDF--PELENDLRKNQMKQLAILN 836
            +  EKVFIP  D+P  N +G ++GPRG T K L+     K+ I GKGS+ + +       L   ++  +A++       +E      +A  R+   I+E   +  PE+ +++ + QM+++AILN
Sbjct:   48 KLSEKVFIPVKDHPKFNFVGKLLGPRGNTFKRLQNSTGTKMSILGKGSMRDKE---KEEELRATEDPKYAHLGEELHVLIEVEAPPGQAHARLGIAIEEIKKYLIPEMNDEIHQEQMREMAILN 168          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO28641 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5W9])

HSP 1 Score: 56.9954 bits (136), Expect = 5.580e-10
Identity = 22/54 (40.74%), Postives = 38/54 (70.37%), Query Frame = 3
Query:  489 RFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKV 650
            +  EKV+ P  ++P  N +G +IGPRG+TL+++E     K+++RGKGS+ + K+
Sbjct:   91 KLVEKVYAPVKEFPKFNFVGRVIGPRGMTLREIESTTGCKLLVRGKGSMKDKKL 144          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO27543 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8Z1])

HSP 1 Score: 54.6842 bits (130), Expect = 1.833e-9
Identity = 28/65 (43.08%), Postives = 41/65 (63.08%), Query Frame = 3
Query:  117 HSEFTIS-------KKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQ 290
            H++ +IS       KK RKSRW   E  K +I GMPTT+PPN+ P   + Y++QL+I +I+  L+
Sbjct:    3 HTKSSISYLGREDRKKKRKSRWG-GEDKKMIIPGMPTTLPPNLKPDQQKAYLMQLRIEEISRMLR 66          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: sf1 (splicing factor 1 [Source:NCBI gene;Acc:101157648])

HSP 1 Score: 265.388 bits (677), Expect = 7.057e-82
Identity = 145/328 (44.21%), Postives = 199/328 (60.67%), Query Frame = 3
Query:  120 SEFTISKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEF------PPLNIPQSSPLDGEYKSFMNELGSEGRPT 1073
            S+    KK +KSRWS+   D K +I GMPT IPP +       YI+QLQI D+T KL+  +    +    R PSP+PIY  +GKR+NT+EYR R+++E+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE   KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK     A        PP +    + +D EY S M ELG    P+
Sbjct:   80 SKSDFGKKRKKSRWSSETPDQKTIIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHALITEMIGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQNSEPRSITNTTLCTKCGGAGHISSDCKYTSTFAAHRATGGEPPQSAQDKARMDKEYLSLMAELGEAPVPS 407          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: sf1 (splicing factor 1 [Source:NCBI gene;Acc:101157648])

HSP 1 Score: 265.003 bits (676), Expect = 8.009e-82
Identity = 145/328 (44.21%), Postives = 199/328 (60.67%), Query Frame = 3
Query:  120 SEFTISKKNRKSRWSTNEFD-KCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTD--KIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP-LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEF------PPLNIPQSSPLDGEYKSFMNELGSEGRPT 1073
            S+    KK +KSRWS+   D K +I GMPT IPP +       YI+QLQI D+T KL+  +    +    R PSP+PIY  +GKR+NT+EYR R+++E+ +  L+ ++  L PD  P  D      R  +KV IPQD+YP+IN +GL+IGPRG TLK++EKE   KI+IRGKGS+  GKV   +   LPGEDE LHA +T+ + E V+KA ++I  I+++GI+ PE +NDLRK Q+++LA LNGT RE D              +TNT +C+ CGG GH+  DCK     A        PP +    + +D EY S M ELG    P+
Sbjct:   80 SKSDFGKKRKKSRWSSETPDQKTIIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHALITEMIGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQNSEPRSITNTTLCTKCGGAGHISSDCKYTSTFAAHRATGGEPPQSAQDKARMDKEYLSLMAELGEAPVPS 407          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045137.1 (protein quaking-B-like [Source:NCBI gene;Acc:101161529])

HSP 1 Score: 90.5077 bits (223), Expect = 5.601e-20
Identity = 51/132 (38.64%), Postives = 81/132 (61.36%), Query Frame = 3
Query:  486 GRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYIT-----SFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD 857
             + +EK+++P  +YPD N +G I+GPRGLT K LE E   KI++RGKGS+ + K    N   P  +   E LH  IT     + +K  +++A + + K++   +   E E++L+K Q+ +LAILNGTYR+ +
Sbjct:   82 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEMNRGKPNWEHLNEDLHVLITVEDTHNRAKIKLQRAINEVKKLL---VPAAEGEDNLKKMQLMELAILNGTYRDAN 210          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044982.1 (protein quaking-B-like [Source:NCBI gene;Acc:101161529])

HSP 1 Score: 90.5077 bits (223), Expect = 6.476e-20
Identity = 51/132 (38.64%), Postives = 81/132 (61.36%), Query Frame = 3
Query:  486 GRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYIT-----SFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD 857
             + +EK+++P  +YPD N +G I+GPRGLT K LE E   KI++RGKGS+ + K    N   P  +   E LH  IT     + +K  +++A + + K++   +   E E++L+K Q+ +LAILNGTYR+ +
Sbjct:   82 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEMNRGKPNWEHLNEDLHVLITVEDTHNRAKIKLQRAINEVKKLL---VPAAEGEDNLKKMQLMELAILNGTYRDAN 210          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033069.1 (protein quaking-B-like [Source:NCBI gene;Acc:101161529])

HSP 1 Score: 90.8929 bits (224), Expect = 6.747e-20
Identity = 51/132 (38.64%), Postives = 81/132 (61.36%), Query Frame = 3
Query:  486 GRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYIT-----SFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETD 857
             + +EK+++P  +YPD N +G I+GPRGLT K LE E   KI++RGKGS+ + K    N   P  +   E LH  IT     + +K  +++A + + K++   +   E E++L+K Q+ +LAILNGTYR+ +
Sbjct:   82 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEMNRGKPNWEHLNEDLHVLITVEDTHNRAKIKLQRAINEVKKLL---VPAAEGEDNLKKMQLMELAILNGTYRDAN 210          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031862.1 (SMESG000031862.1)

HSP 1 Score: 756.903 bits (1953), Expect = 0.000e+0
Identity = 368/368 (100.00%), Postives = 368/368 (100.00%), Query Frame = 3
Query:   69 MKRKSITSTTKPNEPTHSEFTISKKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDKIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLGFLPEFPPPNASVDGANSFVRKFVFNG 1172
            MKRKSITSTTKPNEPTHSEFTISKKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDKIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLGFLPEFPPPNASVDGANSFVRKFVFNG
Sbjct:    1 MKRKSITSTTKPNEPTHSEFTISKKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDKIGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLGFLPEFPPPNASVDGANSFVRKFVFNG 368          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031867.1 (SMESG000031867.1)

HSP 1 Score: 458.759 bits (1179), Expect = 3.123e-159
Identity = 228/365 (62.47%), Postives = 274/365 (75.07%), Query Frame = 3
Query:   78 KSITSTTKPNEPTHSEFTISKKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDKI-GGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIP-QSSPLDGEYKSFMNELGSEGRPTVLPAYLGFLPEFPPPNASVDGANSFVRKFVF 1166
            K   S    +   +SE    K+ R+S+WS+ +            +P  + P DAEVY IQ+QI  +T+KL +QNYT EIEAM R PSPDP+YG DGKRINTKEYRARER+E+RK+ L+L+L+ LRPDLVPH DK+ G R EEKVFIPQDDYPDIN  GLIIGPRG+T KDLEKE   KI++RGKGS   GK+N  + PLPGEDE LHAYITS S+E V++A ++I KIIQ+GI+FPEL+NDLRKNQMKQLAILNGTYRETDGLNKLK+L EAQS  TNTIICSLCGGTGHLPRDCKVN N  E P +  P Q   L+GEY +F+NELG +   +  PAYLGF+P+    N+S  GA+SFVR F+F
Sbjct:  154 KQEASVKTEDSDNNSEKATRKRKRESKWSSGQ----------AKVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSN--EIPMMEFPVQHVQLEGEYNNFINELGID-EASAKPAYLGFMPQQSSGNSS-QGASSFVRNFIF 504          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000060577.1 (SMESG000060577.1)

HSP 1 Score: 433.335 bits (1113), Expect = 1.041e-149
Identity = 222/388 (57.22%), Postives = 279/388 (71.91%), Query Frame = 3
Query:   18 TTYIISKYL-KNFILNSKMKRKSITSTTKPNEPTHSEFTISKKNRKSRWSTNEFDKCVIAGMPTTIPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDK-IGGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQN---PAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLGFLPEFPPPNASVDGANSFVRKFVF 1166
            T Y   +Y     IL S  K ++  ++   +E T       K+ R+S+W T +            +P  +N +DAEVY IQ+Q+  +T+KL ++NY  EIEAM R PSPDP+Y  +GKRINTKE+RARERL+DRK+ L+L+LH LRP+LVPH DK IG R EE++FIPQ+DYPDIN  GLIIGPRG+T K+LEKE   KI+IRGKGS   G+ N +  PLPGEDE LHAY+TS S+E V+KA ++I KIIQ+GI+FPEL+NDLRKNQMKQLAI NGTYRET+GLNKLK+LGEAQS VTNTIICSLCGGTGHLPRDC VN N      FP    PQ + L+GEY +F+NELG +G  T  PA+LGF+P+    N +  G +SFV+ F+F
Sbjct:  116 TDYDTRRYSPTQHILRSDHKEENFFNSDNNSESTR------KRKRESKWGTGQ----------AKVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGAPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFP----PQHAKLEGEYDNFINELGVDGTDTK-PAFLGFIPQHNSGN-TTQGTSSFVKNFIF 481          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000068399.1 (SMESG000068399.1)

HSP 1 Score: 99.7525 bits (247), Expect = 4.949e-23
Identity = 58/134 (43.28%), Postives = 83/134 (61.94%), Query Frame = 3
Query:  492 FEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHN--------GKVNVNNVPLPGEDECLHAYIT--SFSKECVEK---ATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRET 854
             +EKV++P D+ P+ N IG I+GPRGLT K LE+E   K++IRGKGS+ N        GK N  ++     ++ LH  IT   +    V K   A D I K I++GI  P+ E+D++K Q+ +LAI+NGTYR+T
Sbjct:   92 LQEKVYVPVDENPNYNFIGRILGPRGLTAKQLEQELQCKLMIRGKGSLRNKEKEDELRGKPNWEHL-----NDKLHINITVEDYENRAVIKLKWALDAIEKFIEQGIKMPDGEDDIKKRQLMELAIINGTYRDT 220          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000080790.1 (SMESG000080790.1)

HSP 1 Score: 75.0998 bits (183), Expect = 8.758e-15
Identity = 45/128 (35.16%), Postives = 74/128 (57.81%), Query Frame = 3
Query:  495 EEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGED---ECLHAYITSFSKECVEKATDRINKI-------IQEGIDFPELENDLRKNQMKQLAILNGTYR 848
            +EK+F+P  + P+ N +G I+GPRG T K LE++ + KI+IRG+GS+ +      N   P  +   E LH  I     +C  +  +++N I       IQEG++ PE  + L++ Q+ +L+ILN + R
Sbjct:   64 QEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLIN--ISDCENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 189          
The following BLAST results are available for this feature:
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SF13.818e-8445.06splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
SF11.782e-8345.06splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
SF14.615e-8345.06splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
SF14.821e-8345.06splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
SF17.857e-8345.06splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfa-12.615e-6840.31SF1 protein; Splicing FActor [Source:UniProtKB/Tr... [more]
asd-29.339e-2039.20RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
asd-22.196e-1939.20RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
asd-23.044e-1939.20RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
gld-13.384e-1934.75Female germline-specific tumor suppressor gld-1 [... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SF12.526e-8645.96gene:FBgn0025571 transcript:FBtr0083456[more]
how1.024e-1839.68gene:FBgn0264491 transcript:FBtr0084178[more]
how1.089e-1839.68gene:FBgn0264491 transcript:FBtr0100514[more]
how1.119e-1839.68gene:FBgn0264491 transcript:FBtr0301402[more]
how1.130e-1839.68gene:FBgn0264491 transcript:FBtr0335195[more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf11.123e-8245.68splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
sf19.605e-8245.68splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
qkib1.848e-2141.27QKI, KH domain containing, RNA binding b [Source:Z... [more]
qkib1.877e-2141.27QKI, KH domain containing, RNA binding b [Source:Z... [more]
qkib6.221e-2139.69QKI, KH domain containing, RNA binding b [Source:Z... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
men11.855e-8344.65menin 1 [Source:NCBI gene;Acc:549115][more]
men11.480e-8245.20menin 1 [Source:NCBI gene;Acc:549115][more]
men12.516e-8245.20menin 1 [Source:NCBI gene;Acc:549115][more]
spsb31.484e-1938.17splA/ryanodine receptor domain and SOCS box contai... [more]
spsb35.405e-1835.62splA/ryanodine receptor domain and SOCS box contai... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sf14.193e-8445.06splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
Sf14.193e-8445.06splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
Sf11.088e-8345.06splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
Sf11.088e-8345.06splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
Sf13.798e-8345.06splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15637|SF01_HUMAN2.315e-8245.06Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 P... [more]
sp|Q64213|SF01_MOUSE1.011e-8145.06Splicing factor 1 OS=Mus musculus OX=10090 GN=Sf1 ... [more]
sp|Q8NIW7|BBP_NEUCR5.732e-5736.03Branchpoint-bridging protein OS=Neurospora crassa ... [more]
sp|P0CO44|BBP_CRYNJ5.786e-5636.50Branchpoint-bridging protein OS=Cryptococcus neofo... [more]
sp|P0CO45|BBP_CRYNB5.786e-5636.50Branchpoint-bridging protein OS=Cryptococcus neofo... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VNH11.907e-10048.36Putative zinc finger protein OS=Schistosoma manson... [more]
A0A5K4F2D92.290e-10048.36Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183KMC85.017e-10048.36KH domain-containing protein OS=Schistosoma curass... [more]
A0A4Z2DU104.539e-9949.22Splicing factor 1 isoform 1 OS=Schistosoma japonic... [more]
A0A4Z2DTV81.409e-9849.22Splicing factor 1 isoform 2 OS=Schistosoma japonic... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf11.780e-8145.00splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
qki24.157e-2037.68protein quaking-B [Source:NCBI gene;Acc:103029551][more]
qki24.631e-2037.68protein quaking-B [Source:NCBI gene;Acc:103029551][more]
qki25.345e-2037.68protein quaking-B [Source:NCBI gene;Acc:103029551][more]
qkib5.390e-2038.93QKI, KH domain containing, RNA binding b [Source:Z... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sf11.220e-8245.05splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
khdrbs24.414e-1029.60KH domain containing, RNA binding, signal transduc... [more]
KHDRBS31.747e-931.15KH RNA binding domain containing, signal transduct... [more]
khdrbs1a4.348e-827.78KH domain containing, RNA binding, signal transduc... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MSL51.739e-4736.62Component of commitment complex; which defines fir... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454844.999e-5144.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302979.224e-1937.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441278.393e-1130.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286415.580e-1040.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275431.833e-943.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf17.057e-8244.21splicing factor 1 [Source:NCBI gene;Acc:101157648][more]
sf18.009e-8244.21splicing factor 1 [Source:NCBI gene;Acc:101157648][more]
ENSORLT00000045137.15.601e-2038.64protein quaking-B-like [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000044982.16.476e-2038.64protein quaking-B-like [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000033069.16.747e-2038.64protein quaking-B-like [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031862.10.000e+0100.00SMESG000031862.1[more]
SMESG000031867.13.123e-15962.47SMESG000031867.1[more]
SMESG000060577.11.041e-14957.22SMESG000060577.1[more]
SMESG000068399.14.949e-2343.28SMESG000068399.1[more]
SMESG000080790.18.758e-1535.16SMESG000080790.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019878 ID=SMED30019878|Name=CCHC-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1237bp
TGTGGTATAATTAATTAACTACATACATAATTTCTAAATATTTAAAAAAC
TTTATTTTAAATTCCAAAATGAAACGTAAATCTATTACATCAACAACAAA
ACCTAATGAGCCTACTCATTCTGAATTTACTATATCTAAGAAAAATCGTA
AAAGTCGTTGGTCAACTAATGAATTTGACAAATGTGTTATTGCTGGAATG
CCAACTACAATACCTCCTAATATGAACCCTAAAGATGCAGAAGTATATAT
TATTCAGTTACAGATCACGGATATTACAAGTAAACTTCAAAAGCAGAACT
ACACTTCTGAAATAGAAGCAATGACCCGATTACCATCACCAGATCCAATT
TATGGGCCTGATGGTAAAAGGATAAATACAAAGGAATACCGTGCAAGAGA
AAGATTAGAAGATCGAAAAAAGCAATTGATGTTAAAATTGCATACTTTAC
GACCTGATCTAGTTCCGCATACTGATAAAATTGGTGGAAGGTTTGAAGAA
AAAGTATTCATACCACAAGATGATTACCCTGATATTAATCTTATTGGGTT
AATAATTGGTCCTAGGGGATTAACATTAAAAGATTTAGAAAAAGAATATA
ATGTGAAAATAATTATTCGTGGAAAAGGTAGTATTCATAATGGTAAAGTT
AATGTTAACAATGTTCCCTTACCTGGCGAAGATGAATGCTTGCATGCGTA
TATTACTTCATTTTCTAAAGAATGCGTAGAAAAGGCCACAGATCGAATTA
ACAAAATTATTCAAGAGGGAATTGATTTTCCTGAGTTGGAAAATGATTTG
AGAAAGAATCAAATGAAACAGTTAGCTATTCTTAATGGTACTTACCGAGA
AACTGATGGCTTGAATAAGCTAAAGATGCTAGGTGAAGCTCAATCATGCG
TGACTAATACAATCATTTGTAGCTTATGTGGGGGAACTGGTCACTTACCA
AGAGATTGTAAGGTTAATCAGAATCCTGCGGAATTCCCACCTTTAAATAT
TCCTCAAAGTTCACCATTAGATGGAGAATACAAAAGTTTCATGAATGAAT
TAGGATCAGAAGGTCGGCCTACTGTGTTGCCCGCATATCTTGGATTTCTT
CCAGAATTTCCGCCTCCAAATGCATCTGTAGACGGAGCTAATTCTTTTGT
GAGGAAATTTGTGTTTAATGGCTGATTTTTTCTTTCTATGATATTTAATT
ACTTTATTAATATATTTGTAAATATTTCTTACTATTT
back to top

protein sequence of SMED30019878-orf-1

>SMED30019878-orf-1 ID=SMED30019878-orf-1|Name=SMED30019878-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=369bp
MKRKSITSTTKPNEPTHSEFTISKKNRKSRWSTNEFDKCVIAGMPTTIPP
NMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGK
RINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDKIGGRFEEKVFIPQ
DDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVP
LPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMK
QLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVN
QNPAEFPPLNIPQSSPLDGEYKSFMNELGSEGRPTVLPAYLGFLPEFPPP
NASVDGANSFVRKFVFNG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR031150BBP/SF1
IPR004087KH_dom
IPR032570SF1-HH
IPR004088KH_dom_type_1
IPR001878Znf_CCHC
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0008270zinc ion binding
GO:0045131pre-mRNA branch point binding
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004087K Homology domainSMARTSM00322kh_6coord: 140..232
e-value: 6.4E-11
score: 52.3
IPR032570Splicing factor 1, helix-hairpin domainPFAMPF16275SF1-HHcoord: 27..133
e-value: 1.1E-23
score: 83.7
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 70..266
e-value: 1.7E-41
score: 144.5
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 142..260
IPR004088K Homology domain, type 1PFAMPF00013KH_1coord: 145..228
e-value: 6.2E-7
score: 29.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..27
NoneNo IPR availablePANTHERPTHR11208RNA-BINDING PROTEIN RELATEDcoord: 18..334
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 157..227
score: 8.722
NoneNo IPR availableCDDcd02395SF1_like-KHcoord: 144..260
e-value: 1.31352E-40
score: 137.375
IPR031150BBP/SF1 familyPANTHERPTHR11208:SF45SPLICING FACTOR 1coord: 18..334
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 284..298
score: 8.763