Rho GTPase activating protein 44

Overview
NameRho GTPase activating protein 44
Smed IDSMED30019877
Length (bp)3484
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho GTPase activating protein 44 (SMED30019877) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho GTPase activating protein 44 (SMED30019877) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho GTPase activating protein 44 (SMED30019877) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho GTPase activating protein 44 (SMED30019877) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019877

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30019877SMESG000068429.1 dd_Smed_v4_10426_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019877SMESG000068429.1 dd_Smed_v4_10426_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho GTPase activating protein 44 vs. Ensembl Human
Match: ARHGAP44 (Rho GTPase activating protein 44 [Source:HGNC Symbol;Acc:HGNC:29096])

HSP 1 Score: 187.963 bits (476), Expect = 1.296e-49
Identity = 142/467 (30.41%), Postives = 223/467 (47.75%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQ-----SFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G            ++DK SKKLP   LAQ     S +L  D L      + K+  + GET +KLA E +++   VE +V+E L +  E  +P++ K R+HL K   D+   + R +    ++ + S   P       L+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P FG+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L +A +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N   ++ +L A+     KLP A  NN+ YLI FL+K+S Y D NKMTP+N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLELVKQVSHSTHKKLTAC-----------LQGQQG-----------AEADKRSKKLPLTTLAQCLMEGSAILGDDTL------LGKMLKLCGETEDKLAQELIHFELQVERDVIEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAA----------------------------------------NRVEICRDQLSADM-----------YSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLLEC-GMQEEGLFRVAPSASKLKKLKAALDCCVVD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNVQEQDKKLQALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLL 411          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Human
Match: ARHGAP44 (Rho GTPase activating protein 44 [Source:HGNC Symbol;Acc:HGNC:29096])

HSP 1 Score: 189.889 bits (481), Expect = 3.197e-49
Identity = 142/467 (30.41%), Postives = 223/467 (47.75%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQ-----SFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G            ++DK SKKLP   LAQ     S +L  D L      + K+  + GET +KLA E +++   VE +V+E L +  E  +P++ K R+HL K   D+   + R +    ++ + S   P       L+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P FG+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L +A +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N   ++ +L A+     KLP A  NN+ YLI FL+K+S Y D NKMTP+N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLELVKQVSHSTHKKLTAC-----------LQGQQG-----------AEADKRSKKLPLTTLAQCLMEGSAILGDDTL------LGKMLKLCGETEDKLAQELIHFELQVERDVIEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAA----------------------------------------NRVEICRDQLSADM-----------YSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKAALDCCVVD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNVQEQDKKLQALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLL 411          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Human
Match: ARHGAP44 (Rho GTPase activating protein 44 [Source:HGNC Symbol;Acc:HGNC:29096])

HSP 1 Score: 190.274 bits (482), Expect = 4.330e-49
Identity = 142/467 (30.41%), Postives = 223/467 (47.75%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQ-----SFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G            ++DK SKKLP   LAQ     S +L  D L      + K+  + GET +KLA E +++   VE +V+E L +  E  +P++ K R+HL K   D+   + R +    ++ + S   P       L+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P FG+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L +A +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N   ++ +L A+     KLP A  NN+ YLI FL+K+S Y D NKMTP+N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLELVKQVSHSTHKKLTAC-----------LQGQQG-----------AEADKRSKKLPLTTLAQCLMEGSAILGDDTL------LGKMLKLCGETEDKLAQELIHFELQVERDVIEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAA----------------------------------------NRVEICRDQLSADM-----------YSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKAALDCCVVD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNVQEQDKKLQALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLL 411          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Human
Match: ARHGAP44 (Rho GTPase activating protein 44 [Source:HGNC Symbol;Acc:HGNC:29096])

HSP 1 Score: 189.889 bits (481), Expect = 6.027e-49
Identity = 142/467 (30.41%), Postives = 223/467 (47.75%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQ-----SFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G            ++DK SKKLP   LAQ     S +L  D L      + K+  + GET +KLA E +++   VE +V+E L +  E  +P++ K R+HL K   D+   + R +    ++ + S   P       L+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P FG+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L +A +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N   ++ +L A+     KLP A  NN+ YLI FL+K+S Y D NKMTP+N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLELVKQVSHSTHKKLTAC-----------LQGQQG-----------AEADKRSKKLPLTTLAQCLMEGSAILGDDTL------LGKMLKLCGETEDKLAQELIHFELQVERDVIEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAA----------------------------------------NRVEICRDQLSADM-----------YSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKAALDCCVVD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNVQEQDKKLQALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLL 411          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Human
Match: ARHGAP17 (Rho GTPase activating protein 17 [Source:HGNC Symbol;Acc:HGNC:18239])

HSP 1 Score: 159.458 bits (402), Expect = 2.870e-39
Identity = 90/241 (37.34%), Postives = 132/241 (54.77%), Query Frame = 2
Query:  815 SKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSA 1534
            SK++ LK   DE  ++++  KD    + Y F +   +  K F+ LL  +A+YH++ L  + + LPE+ +        P FG  L +HL  S R IA  +E CV  L     + EEGLFRI  G +K+  L +A +           D   +A  LK YLR LPEPL+T +L+++W +  +  +++ +L  +     KLP   F N  YLI FLAK++  SD NKMTP+N+ IV GPNLL A
Sbjct:  171 SKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKTLPEMRAHQDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLE-TGMKEEGLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDLWRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWA 410          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Celegans
Match: rga-8 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:A0A2K5AU32])

HSP 1 Score: 114.775 bits (286), Expect = 8.838e-26
Identity = 68/200 (34.00%), Postives = 102/200 (51.00%), Query Frame = 2
Query:  935 TFLNLLRNEANYHQQCLRTIGQVLPELESSIANN-PIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNL 1525
            T +NL R+   Y ++      + +PE+E  IA   P PVFG  L +HL   +  I+  L  C   L     + E G+FR++G  +K+  + +A +  + +   K Y  D   +A  LK YLR LP+PL    L  DW+ A+N   EE R SA+  CL K+   +  NL YL+ FL  +    ++  M  +NL IVF P +
Sbjct:  203 TSMNLKRD---YFKKMYEMYEKAIPEVERMIATALPRPVFGVPLDEHLSIQKERISGVLTKCCDFLRQ-NGMNERGIFRVSGNASKIKRIRAALDAGQFDADEKHYNNDPHAVASTLKAYLRELPDPLTMDSLQSDWVEAINLEGEE-RFSAIDRCLKKMTRGHRQNLIYLMKFLCDLEAKREETSMNASNLAIVFAPTM 397          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Celegans
Match: rga-8 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:A0A2K5AU32])

HSP 1 Score: 114.005 bits (284), Expect = 9.382e-26
Identity = 68/200 (34.00%), Postives = 102/200 (51.00%), Query Frame = 2
Query:  935 TFLNLLRNEANYHQQCLRTIGQVLPELESSIANN-PIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNL 1525
            T +NL R+   Y ++      + +PE+E  IA   P PVFG  L +HL   +  I+  L  C   L     + E G+FR++G  +K+  + +A +  + +   K Y  D   +A  LK YLR LP+PL    L  DW+ A+N   EE R SA+  CL K+   +  NL YL+ FL  +    ++  M  +NL IVF P +
Sbjct:  203 TSMNLKRD---YFKKMYEMYEKAIPEVERMIATALPRPVFGVPLDEHLSIQKERISGVLTKCCDFLRQ-NGMNERGIFRVSGNASKIKRIRAALDAGQFDADEKHYNNDPHAVASTLKAYLRELPDPLTMDSLQSDWVEAINLEGEE-RFSAIDRCLKKMTRGHRQNLIYLMKFLCDLEAKREETSMNASNLAIVFAPTM 397          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Celegans
Match: rga-8 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:A0A2K5AU32])

HSP 1 Score: 114.39 bits (285), Expect = 9.511e-26
Identity = 68/200 (34.00%), Postives = 102/200 (51.00%), Query Frame = 2
Query:  935 TFLNLLRNEANYHQQCLRTIGQVLPELESSIANN-PIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNL 1525
            T +NL R+   Y ++      + +PE+E  IA   P PVFG  L +HL   +  I+  L  C   L     + E G+FR++G  +K+  + +A +  + +   K Y  D   +A  LK YLR LP+PL    L  DW+ A+N   EE R SA+  CL K+   +  NL YL+ FL  +    ++  M  +NL IVF P +
Sbjct:  211 TSMNLKRD---YFKKMYEMYEKAIPEVERMIATALPRPVFGVPLDEHLSIQKERISGVLTKCCDFLRQ-NGMNERGIFRVSGNASKIKRIRAALDAGQFDADEKHYNNDPHAVASTLKAYLRELPDPLTMDSLQSDWVEAINLEGEE-RFSAIDRCLKKMTRGHRQNLIYLMKFLCDLEAKREETSMNASNLAIVFAPTM 405          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Celegans
Match: rga-8 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:A0A2K5AU32])

HSP 1 Score: 114.39 bits (285), Expect = 9.524e-26
Identity = 68/200 (34.00%), Postives = 102/200 (51.00%), Query Frame = 2
Query:  935 TFLNLLRNEANYHQQCLRTIGQVLPELESSIANN-PIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNL 1525
            T +NL R+   Y ++      + +PE+E  IA   P PVFG  L +HL   +  I+  L  C   L     + E G+FR++G  +K+  + +A +  + +   K Y  D   +A  LK YLR LP+PL    L  DW+ A+N   EE R SA+  CL K+   +  NL YL+ FL  +    ++  M  +NL IVF P +
Sbjct:  203 TSMNLKRD---YFKKMYEMYEKAIPEVERMIATALPRPVFGVPLDEHLSIQKERISGVLTKCCDFLRQ-NGMNERGIFRVSGNASKIKRIRAALDAGQFDADEKHYNNDPHAVASTLKAYLRELPDPLTMDSLQSDWVEAINLEGEE-RFSAIDRCLKKMTRGHRQNLIYLMKFLCDLEAKREETSMNASNLAIVFAPTM 397          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Celegans
Match: rga-8 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:A0A2K5AU32])

HSP 1 Score: 114.39 bits (285), Expect = 9.712e-26
Identity = 68/200 (34.00%), Postives = 102/200 (51.00%), Query Frame = 2
Query:  935 TFLNLLRNEANYHQQCLRTIGQVLPELESSIANN-PIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNL 1525
            T +NL R+   Y ++      + +PE+E  IA   P PVFG  L +HL   +  I+  L  C   L     + E G+FR++G  +K+  + +A +  + +   K Y  D   +A  LK YLR LP+PL    L  DW+ A+N   EE R SA+  CL K+   +  NL YL+ FL  +    ++  M  +NL IVF P +
Sbjct:  211 TSMNLKRD---YFKKMYEMYEKAIPEVERMIATALPRPVFGVPLDEHLSIQKERISGVLTKCCDFLRQ-NGMNERGIFRVSGNASKIKRIRAALDAGQFDADEKHYNNDPHAVASTLKAYLRELPDPLTMDSLQSDWVEAINLEGEE-RFSAIDRCLKKMTRGHRQNLIYLMKFLCDLEAKREETSMNASNLAIVFAPTM 405          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Fly
Match: RhoGAP92B (gene:FBgn0038747 transcript:FBtr0344352)

HSP 1 Score: 119.013 bits (297), Expect = 2.092e-27
Identity = 70/193 (36.27%), Postives = 101/193 (52.33%), Query Frame = 2
Query:  956 NEANYHQQCLRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNV--FKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            N+ NYH++ L+ +   L  ++ +I       FG  L +HL ++ R I+Y +E+C   L     L EEGL R+     K+  +  A      K    +   D  VI   LK YLR LPEPLLT++L+ D++R     +E  R + +K  L+KLP   + NL YL  FL+ V   S  NKM+  NL IV  PN+L
Sbjct:   21 NQRNYHERALQHVNASLARIQDTIQGTEKSRFGTSLKEHLTSTNREISYIVELCCCCLLE-HGLEEEGLLRVGCASTKLRRMKHALEAQHVKTPLPLDYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYANLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNML 212          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Fly
Match: RhoGAP92B (gene:FBgn0038747 transcript:FBtr0344353)

HSP 1 Score: 119.783 bits (299), Expect = 2.395e-27
Identity = 70/193 (36.27%), Postives = 101/193 (52.33%), Query Frame = 2
Query:  956 NEANYHQQCLRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNV--FKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            N+ NYH++ L+ +   L  ++ +I       FG  L +HL ++ R I+Y +E+C   L     L EEGL R+     K+  +  A      K    +   D  VI   LK YLR LPEPLLT++L+ D++R     +E  R + +K  L+KLP   + NL YL  FL+ V   S  NKM+  NL IV  PN+L
Sbjct:  126 NQRNYHERALQHVNASLARIQDTIQGTEKSRFGTSLKEHLTSTNREISYIVELCCCCLLE-HGLEEEGLLRVGCASTKLRRMKHALEAQHVKTPLPLDYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYANLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNML 317          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Fly
Match: RhoGAP92B (gene:FBgn0038747 transcript:FBtr0344351)

HSP 1 Score: 119.783 bits (299), Expect = 3.371e-27
Identity = 70/193 (36.27%), Postives = 101/193 (52.33%), Query Frame = 2
Query:  956 NEANYHQQCLRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNV--FKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            N+ NYH++ L+ +   L  ++ +I       FG  L +HL ++ R I+Y +E+C   L     L EEGL R+     K+  +  A      K    +   D  VI   LK YLR LPEPLLT++L+ D++R     +E  R + +K  L+KLP   + NL YL  FL+ V   S  NKM+  NL IV  PN+L
Sbjct:  218 NQRNYHERALQHVNASLARIQDTIQGTEKSRFGTSLKEHLTSTNREISYIVELCCCCLLE-HGLEEEGLLRVGCASTKLRRMKHALEAQHVKTPLPLDYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYANLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNML 409          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Fly
Match: RhoGAP92B (gene:FBgn0038747 transcript:FBtr0083821)

HSP 1 Score: 119.783 bits (299), Expect = 3.471e-27
Identity = 70/193 (36.27%), Postives = 101/193 (52.33%), Query Frame = 2
Query:  956 NEANYHQQCLRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNV--FKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            N+ NYH++ L+ +   L  ++ +I       FG  L +HL ++ R I+Y +E+C   L     L EEGL R+     K+  +  A      K    +   D  VI   LK YLR LPEPLLT++L+ D++R     +E  R + +K  L+KLP   + NL YL  FL+ V   S  NKM+  NL IV  PN+L
Sbjct:  218 NQRNYHERALQHVNASLARIQDTIQGTEKSRFGTSLKEHLTSTNREISYIVELCCCCLLE-HGLEEEGLLRVGCASTKLRRMKHALEAQHVKTPLPLDYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYANLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNML 409          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Fly
Match: RhoGAP92B (gene:FBgn0038747 transcript:FBtr0344354)

HSP 1 Score: 119.783 bits (299), Expect = 3.471e-27
Identity = 70/193 (36.27%), Postives = 101/193 (52.33%), Query Frame = 2
Query:  956 NEANYHQQCLRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNV--FKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            N+ NYH++ L+ +   L  ++ +I       FG  L +HL ++ R I+Y +E+C   L     L EEGL R+     K+  +  A      K    +   D  VI   LK YLR LPEPLLT++L+ D++R     +E  R + +K  L+KLP   + NL YL  FL+ V   S  NKM+  NL IV  PN+L
Sbjct:  218 NQRNYHERALQHVNASLARIQDTIQGTEKSRFGTSLKEHLTSTNREISYIVELCCCCLLE-HGLEEEGLLRVGCASTKLRRMKHALEAQHVKTPLPLDYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYANLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNML 409          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Zebrafish
Match: BX005094.1 (si:ch211-114m9.1 [Source:NCBI gene;Acc:567298])

HSP 1 Score: 186.808 bits (473), Expect = 7.978e-48
Identity = 138/462 (29.87%), Postives = 220/462 (47.62%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELES-SIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G    +   K+P      SKKLP   LAQ  +  A  L   +  + K+  + G+T  KLA E L +   +E +V+E L +  E  +P++ K R+HL K   D+   + R +    ++           H S++Q    +S S                             L    E +  N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P +G+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L ++ +   ++  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N  + + RL A+     KLP    NN  YLI FL+K++ Y D NKMTP N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLDLVKQVSHSTHKKLTAC-----------LQGQQGTEIEKRSVKSP------SKKLPLTTLAQCMVEGAAVLGD-DSLLGKMLKLCGDTEEKLAQELLVFELQIERDVVEPLYVLAEVEIPNIQKQRKHLAKLVLDMDSARTRWQQSSKSSG----------HPSNVQQGGAKSDS-----------------------------LREEMEETA-NRMEICRDQLSADM-----------YNFVAKEIDYANYFQTLIEVQAEYHRKSLEILQSVLPQIKAHQEAWIEKPSYGKALEEHLAISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKASLDCGVMD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQDMDKRLQALLCTCEKLPADNLNNFRYLIKFLSKLTEYQDSNKMTPGNIAIVLGPNLL 416          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Zebrafish
Match: si:ch211-114m9.1 (si:ch211-114m9.1 [Source:ZFIN;Acc:ZDB-GENE-120215-49])

HSP 1 Score: 186.808 bits (473), Expect = 9.184e-48
Identity = 138/462 (29.87%), Postives = 220/462 (47.62%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELES-SIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G    +   K+P      SKKLP   LAQ  +  A  L   +  + K+  + G+T  KLA E L +   +E +V+E L +  E  +P++ K R+HL K   D+   + R +    ++           H S++Q    +S S                             L    E +  N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P +G+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L ++ +   ++  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N  + + RL A+     KLP    NN  YLI FL+K++ Y D NKMTP N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLDLVKQVSHSTHKKLTAC-----------LQGQQGTEIEKRSVKSP------SKKLPLTTLAQCMVEGAAVLGD-DSLLGKMLKLCGDTEEKLAQELLVFELQIERDVVEPLYVLAEVEIPNIQKQRKHLAKLVLDMDSARTRWQQSSKSSG----------HPSNVQQGGAKSDS-----------------------------LREEMEETA-NRMEICRDQLSADM-----------YNFVAKEIDYANYFQTLIEVQAEYHRKSLEILQSVLPQIKAHQEAWIEKPSYGKALEEHLAISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKASLDCGVMD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQDMDKRLQALLCTCEKLPADNLNNFRYLIKFLSKLTEYQDSNKMTPGNIAIVLGPNLL 416          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Zebrafish
Match: si:ch211-114m9.1 (si:ch211-114m9.1 [Source:ZFIN;Acc:ZDB-GENE-120215-49])

HSP 1 Score: 186.808 bits (473), Expect = 9.184e-48
Identity = 138/462 (29.87%), Postives = 220/462 (47.62%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELES-SIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G    +   K+P      SKKLP   LAQ  +  A  L   +  + K+  + G+T  KLA E L +   +E +V+E L +  E  +P++ K R+HL K   D+   + R +    ++           H S++Q    +S S                             L    E +  N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P +G+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L ++ +   ++  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N  + + RL A+     KLP    NN  YLI FL+K++ Y D NKMTP N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLDLVKQVSHSTHKKLTAC-----------LQGQQGTEIEKRSVKSP------SKKLPLTTLAQCMVEGAAVLGD-DSLLGKMLKLCGDTEEKLAQELLVFELQIERDVVEPLYVLAEVEIPNIQKQRKHLAKLVLDMDSARTRWQQSSKSSG----------HPSNVQQGGAKSDS-----------------------------LREEMEETA-NRMEICRDQLSADM-----------YNFVAKEIDYANYFQTLIEVQAEYHRKSLEILQSVLPQIKAHQEAWIEKPSYGKALEEHLAISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKASLDCGVMD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQDMDKRLQALLCTCEKLPADNLNNFRYLIKFLSKLTEYQDSNKMTPGNIAIVLGPNLL 416          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Zebrafish
Match: arhgap44 (Rho GTPase activating protein 44 [Source:ZFIN;Acc:ZDB-GENE-120206-2])

HSP 1 Score: 181.8 bits (460), Expect = 1.270e-47
Identity = 128/406 (31.53%), Postives = 196/406 (48.28%), Query Frame = 2
Query:  335 SKKLPEQNLAQSFLLSADRLSVLNPH--VSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPEL----ESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSA 1534
            SKKLP  +LAQ  +  A   +VL     + K+  + GE  + LA E L +   +E +V+E L    E  +P++ K R+HL K   D+   + R      ++ + +  +P       L+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++    ES +     P +G+ L +HL  S R IA+ +E CV  L +   L EEGLFR+A   +K+  L ++ +   ++      D   IA  LK YLR LPEPLLT  L++DW++A N  +++ RL A+     KLPVA  NN  YLI FLAK++ Y + NKMTP N+ IV GPNLL A
Sbjct:   71 SKKLPLTSLAQCLVEGA---AVLGDDCLLGKMLKICGEAQDSLAQELLLFELQIERDVVEPLYTLSEVEIPNIQKQRKHLAKLVLDMDSARTRWHQSSKSSTLSNKETPTGAKADALREEMEEAA----------------------------------------NRMEICRDQLSADM-----------YSFVAKEIDYANYFQTLIEVQAEYHRKSLELLQSVLPQIKAQQESWVEK---PCYGKPLEEHLTLSGREIAFPIEACVTMLLDC-GLQEEGLFRVAPSASKLKKLKASLDCGVLDYQEYSADPHAIAGALKSYLRELPEPLLTFDLYEDWIQASNIADQDKRLQALLSTCEKLPVANSNNFKYLIKFLAKMNEYQEYNKMTPGNIAIVLGPNLLWA 418          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Zebrafish
Match: arhgap17b (Rho GTPase activating protein 17b [Source:ZFIN;Acc:ZDB-GENE-080220-26])

HSP 1 Score: 179.104 bits (453), Expect = 3.003e-47
Identity = 137/468 (29.27%), Postives = 217/468 (46.37%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPET-LCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSS 1549
            D++  IE+     + +S +V K++++C           L G+ G            D++K  KKLP   L+QS +    +L      + K+  + G+  NKLA E+      +E ++L+ L    E  +P++ K RRHL K   D    + R                   H +    PS  +A  M                                  +K++ LK   DE +++++  KD    + Y F S   + ++ ++ LL  +A YH++ L +I  VLP ++S        P FG  L +HL  + R +A  +E CV  L   ET + EEGLFRIA G +K+  L +A +    +      D   +A  LK YLR LPEPL+++ L+++W++A N  + + RL A+ +    LP A   N  YL+ FLAK++  SD NKMT +N+ IV GPNLL A +  S
Sbjct:   28 DDLLLIERRLENVRLVSHNVHKKMVMC-----------LQGNVGT-----------DAEKRHKKLPLMILSQSMVEGVAQLGE-ESLIGKMMDICGDAENKLAFEQSQHEVLLEKDILDPLNQLAEVDIPNIQKQRRHLAKLVLDYDSAKGRY------------------HQATKSFPSATNAQAM---------------------------------AAKVDMLKEEMDEAQNRMEICKDQVAADMYSFASKEGEYARYYVLLLEAQAEYHRRALASIESVLPNIQSQQDKWMEKPAFGTALEEHLKRTGREVALPIEACVMML--LETGMQEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMSYQLYEEWIQASNISDPDKRLQALWVVCDMLPKANKTNFRYLVKFLAKLALESDVNKMTASNIAIVLGPNLLWAKTEGS 419          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Xenopus
Match: tlx2 (T cell leukemia, homeobox 2 [Source:Xenbase;Acc:XB-GENE-5995963])

HSP 1 Score: 167.933 bits (424), Expect = 5.296e-44
Identity = 92/240 (38.33%), Postives = 139/240 (57.92%), Query Frame = 2
Query:  812 NSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
             +K + L+   +E  ++++  +D    + Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P FG+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L +A +   V+      D   IA  LK YLR LPEPL+T  L+++W++A N   ++ RL A+     KLP A +NNL Y+I FLAK++ Y D NKMTP+N+ IV GPNLL
Sbjct:   81 GAKADALREEMEEAANRVEICRDQLSADMYNFVAKEIDYANYFQMLIEVQAEYHRKSLALLTAVLPQIKAQQEAWIEKPSFGKPLEEHLTVSGREIAFPIEACVTMLLEC-GMQEEGLFRVAPSASKLKKLKAALDCCVVDVAEYSADPHAIAGALKSYLRELPEPLMTFELYEEWIQASNIQEQDKRLQALWNACEKLPKANYNNLKYVIKFLAKLTEYQDANKMTPSNMAIVLGPNLL 319          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Xenopus
Match: ARHGAP17 (Rho GTPase activating protein 17 [Source:NCBI gene;Acc:549590])

HSP 1 Score: 167.933 bits (424), Expect = 2.167e-43
Identity = 93/241 (38.59%), Postives = 137/241 (56.85%), Query Frame = 2
Query:  815 SKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSA 1534
             K++ LK   DE  ++++  +D  + + Y F S   +  K F+ LL  +A YH++ L  + + LPE+++        P FG  L +HL  S R IA  +E CV  L     + EEGLFRIA G +K+  L +A +    +      D   +A  LK YLR LPEPL+T +L+++W  A N P++ ++L A+ +   KLP     N  YL+ FLAK+S +SD NKMTP+N+ IV GPNLL A
Sbjct:  178 GKMDSLKEDMDEAMNKVEQCRDQLVADMYNFVSKEGEYGKYFVTLLETQAEYHRKALAALEKALPEIQAQQDKWTEKPAFGTPLEEHLKRSGREIALPIEACVMMLLE-TGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWNHAGNIPDQNTKLQALWVVCQKLPKPNLENFRYLVKFLAKLSHHSDINKMTPSNIAIVLGPNLLWA 417          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Xenopus
Match: ARHGAP17 (Rho GTPase activating protein 17 [Source:NCBI gene;Acc:549590])

HSP 1 Score: 171.4 bits (433), Expect = 4.747e-43
Identity = 93/241 (38.59%), Postives = 137/241 (56.85%), Query Frame = 2
Query:  815 SKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSA 1534
             K++ LK   DE  ++++  +D  + + Y F S   +  K F+ LL  +A YH++ L  + + LPE+++        P FG  L +HL  S R IA  +E CV  L     + EEGLFRIA G +K+  L +A +    +      D   +A  LK YLR LPEPL+T +L+++W  A N P++ ++L A+ +   KLP     N  YL+ FLAK+S +SD NKMTP+N+ IV GPNLL A
Sbjct:  171 GKMDSLKEDMDEAMNKVEQCRDQLVADMYNFVSKEGEYGKYFVTLLETQAEYHRKALAALEKALPEIQAQQDKWTEKPAFGTPLEEHLKRSGREIALPIEACVMMLLE-TGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWNHAGNIPDQNTKLQALWVVCQKLPKPNLENFRYLVKFLAKLSHHSDINKMTPSNIAIVLGPNLLWA 410          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Xenopus
Match: ARHGAP17 (Rho GTPase activating protein 17 [Source:NCBI gene;Acc:549590])

HSP 1 Score: 171.4 bits (433), Expect = 4.770e-43
Identity = 93/241 (38.59%), Postives = 137/241 (56.85%), Query Frame = 2
Query:  815 SKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSA 1534
             K++ LK   DE  ++++  +D  + + Y F S   +  K F+ LL  +A YH++ L  + + LPE+++        P FG  L +HL  S R IA  +E CV  L     + EEGLFRIA G +K+  L +A +    +      D   +A  LK YLR LPEPL+T +L+++W  A N P++ ++L A+ +   KLP     N  YL+ FLAK+S +SD NKMTP+N+ IV GPNLL A
Sbjct:  171 GKMDSLKEDMDEAMNKVEQCRDQLVADMYNFVSKEGEYGKYFVTLLETQAEYHRKALAALEKALPEIQAQQDKWTEKPAFGTPLEEHLKRSGREIALPIEACVMMLLE-TGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWNHAGNIPDQNTKLQALWVVCQKLPKPNLENFRYLVKFLAKLSHHSDINKMTPSNIAIVLGPNLLWA 410          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Xenopus
Match: ARHGAP17 (Rho GTPase activating protein 17 [Source:NCBI gene;Acc:549590])

HSP 1 Score: 171.4 bits (433), Expect = 5.315e-43
Identity = 93/241 (38.59%), Postives = 137/241 (56.85%), Query Frame = 2
Query:  815 SKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSA 1534
             K++ LK   DE  ++++  +D  + + Y F S   +  K F+ LL  +A YH++ L  + + LPE+++        P FG  L +HL  S R IA  +E CV  L     + EEGLFRIA G +K+  L +A +    +      D   +A  LK YLR LPEPL+T +L+++W  A N P++ ++L A+ +   KLP     N  YL+ FLAK+S +SD NKMTP+N+ IV GPNLL A
Sbjct:  171 GKMDSLKEDMDEAMNKVEQCRDQLVADMYNFVSKEGEYGKYFVTLLETQAEYHRKALAALEKALPEIQAQQDKWTEKPAFGTPLEEHLKRSGREIALPIEACVMMLLE-TGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWNHAGNIPDQNTKLQALWVVCQKLPKPNLENFRYLVKFLAKLSHHSDINKMTPSNIAIVLGPNLLWA 410          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Mouse
Match: Arhgap44 (Rho GTPase activating protein 44 [Source:MGI Symbol;Acc:MGI:2144423])

HSP 1 Score: 192.971 bits (489), Expect = 2.128e-50
Identity = 143/467 (30.62%), Postives = 224/467 (47.97%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQ-----SFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G            ++DK SKKLP   LAQ     S +L  D L      + K+  + GET +KLA E +++   VE +V+E L +  E  +P++ K R+HL K   D+   + R +    ++ + S   P       L+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P FG+ L +HL+ S R IA+ +E CV  L     + EEGLFR+A   +K+  L +A +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N   ++ RL A+     KLP A  NN+ YLI FL+K+S Y D NKMTP+N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLELVKQVSHSTHKKLTAC-----------LQGQQG-----------AEADKRSKKLPLTTLAQCLVEGSAILGDDTL------LGKMLKLCGETEDKLAQELIHFELQVERDVIEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAA----------------------------------------NRVEICRDQLSADM-----------YSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLMISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKAALDCCVVD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQEQDKRLQALWNACEKLPKANHNNIKYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLL 411          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Mouse
Match: Arhgap44 (Rho GTPase activating protein 44 [Source:MGI Symbol;Acc:MGI:2144423])

HSP 1 Score: 192.586 bits (488), Expect = 4.449e-50
Identity = 143/467 (30.62%), Postives = 224/467 (47.97%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQ-----SFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G            ++DK SKKLP   LAQ     S +L  D L      + K+  + GET +KLA E +++   VE +V+E L +  E  +P++ K R+HL K   D+   + R +    ++ + S   P       L+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P FG+ L +HL+ S R IA+ +E CV  L     + EEGLFR+A   +K+  L +A +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N   ++ RL A+     KLP A  NN+ YLI FL+K+S Y D NKMTP+N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLELVKQVSHSTHKKLTAC-----------LQGQQG-----------AEADKRSKKLPLTTLAQCLVEGSAILGDDTL------LGKMLKLCGETEDKLAQELIHFELQVERDVIEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAA----------------------------------------NRVEICRDQLSADM-----------YSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLMISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKAALDCCVVD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQEQDKRLQALWNACEKLPKANHNNIKYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLL 411          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Mouse
Match: Arhgap44 (Rho GTPase activating protein 44 [Source:MGI Symbol;Acc:MGI:2144423])

HSP 1 Score: 171.014 bits (432), Expect = 9.699e-44
Identity = 94/242 (38.84%), Postives = 143/242 (59.09%), Query Frame = 2
Query:  812 NSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
             +K + L+   +E  ++++  +D    + Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P FG+ L +HL+ S R IA+ +E CV  L     + EEGLFR+A   +K+  L +A +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N   ++ RL A+     KLP A  NN+ YLI FL+K+S Y D NKMTP+N+ IV GPNLL
Sbjct:   48 GAKADALREEMEEAANRVEICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLMISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKAALDCCVVD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQEQDKRLQALWNACEKLPKANHNNIKYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLL 286          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Mouse
Match: Arhgap17 (Rho GTPase activating protein 17 [Source:MGI Symbol;Acc:MGI:1917747])

HSP 1 Score: 159.458 bits (402), Expect = 1.346e-39
Identity = 90/241 (37.34%), Postives = 131/241 (54.36%), Query Frame = 2
Query:  815 SKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSA 1534
            SK++ LK   DE  ++++  KD    + Y F +   +  K F+ LL  +A+YH++ L  + + LPE+ +        P FG  L +HL  S R IA  +E CV  L     + EEGLFRI  G +K+  L +A +           D   +A  LK YLR LPEPL+T  L+++W +  +  +++ +L  +     KLP   F N  YLI FLAK++  SD NKMTP+N+ IV GPNLL A
Sbjct:  171 SKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKALPEMRAHQDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLE-TGMKEEGLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFSLYEEWTQVASVQDQDKKLQYLWTTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWA 410          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Mouse
Match: Arhgap17 (Rho GTPase activating protein 17 [Source:MGI Symbol;Acc:MGI:1917747])

HSP 1 Score: 159.458 bits (402), Expect = 1.421e-39
Identity = 90/246 (36.59%), Postives = 132/246 (53.66%), Query Frame = 2
Query:  815 SKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSS 1549
            SK++ LK   DE  ++++  KD    + Y F +   +  K F+ LL  +A+YH++ L  + + LPE+ +        P FG  L +HL  S R IA  +E CV  L     + EEGLFRI  G +K+  L +A +           D   +A  LK YLR LPEPL+T  L+++W +  +  +++ +L  +     KLP   F N  YLI FLAK++  SD NKMTP+N+ IV GPNLL A    +
Sbjct:  171 SKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKALPEMRAHQDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLE-TGMKEEGLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFSLYEEWTQVASVQDQDKKLQYLWTTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWAKQEGT 415          
BLAST of Rho GTPase activating protein 44 vs. UniProt/SwissProt
Match: sp|Q5SSM3|RHG44_MOUSE (Rho GTPase-activating protein 44 OS=Mus musculus OX=10090 GN=Arhgap44 PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 3.112e-49
Identity = 143/467 (30.62%), Postives = 224/467 (47.97%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQ-----SFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G            ++DK SKKLP   LAQ     S +L  D L      + K+  + GET +KLA E +++   VE +V+E L +  E  +P++ K R+HL K   D+   + R +    ++ + S   P       L+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P FG+ L +HL+ S R IA+ +E CV  L     + EEGLFR+A   +K+  L +A +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N   ++ RL A+     KLP A  NN+ YLI FL+K+S Y D NKMTP+N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLELVKQVSHSTHKKLTAC-----------LQGQQG-----------AEADKRSKKLPLTTLAQCLVEGSAILGDDTL------LGKMLKLCGETEDKLAQELIHFELQVERDVIEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAA----------------------------------------NRVEICRDQLSADM-----------YSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLMISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKAALDCCVVD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQEQDKRLQALWNACEKLPKANHNNIKYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLL 411          
BLAST of Rho GTPase activating protein 44 vs. UniProt/SwissProt
Match: sp|F1LQX4|RHG44_RAT (Rho GTPase-activating protein 44 OS=Rattus norvegicus OX=10116 GN=Arhgap44 PE=1 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 1.078e-48
Identity = 142/467 (30.41%), Postives = 224/467 (47.97%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQ-----SFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G            ++DK SKKLP   LAQ     S +L  D L      + K+  + GET ++LA E +++   VE +V+E L +  E  +P++ K R+HL K   D+   + R +    ++ + S   P       L+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P FG+ L +HL+ S R IA+ +E CV  L     + EEGLFR+A   +K+  L +A +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N   ++ RL A+     KLP A  NN+ YLI FL+K+S Y D NKMTP+N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLELVKQVSHSTHKKLTAC-----------LQGQQG-----------AEADKRSKKLPLTTLAQCLMEGSAILGDDTL------LGKMLKLCGETEDELAQELIHFELRVERDVIEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAA----------------------------------------NRVEICRDQLSADM-----------YSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLMISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKAALDCCVVD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQEQDKRLQALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLL 411          
BLAST of Rho GTPase activating protein 44 vs. UniProt/SwissProt
Match: sp|Q17R89|RHG44_HUMAN (Rho GTPase-activating protein 44 OS=Homo sapiens OX=9606 GN=ARHGAP44 PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 2.894e-48
Identity = 142/467 (30.41%), Postives = 223/467 (47.75%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQ-----SFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G            ++DK SKKLP   LAQ     S +L  D L      + K+  + GET +KLA E +++   VE +V+E L +  E  +P++ K R+HL K   D+   + R +    ++ + S   P       L+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P FG+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L +A +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N   ++ +L A+     KLP A  NN+ YLI FL+K+S Y D NKMTP+N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLELVKQVSHSTHKKLTAC-----------LQGQQG-----------AEADKRSKKLPLTTLAQCLMEGSAILGDDTL------LGKMLKLCGETEDKLAQELIHFELQVERDVIEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALREEMEEAA----------------------------------------NRVEICRDQLSADM-----------YSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQIKAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKAALDCCVVD--VQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNVQEQDKKLQALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLL 411          
BLAST of Rho GTPase activating protein 44 vs. UniProt/SwissProt
Match: sp|D3ZFJ3|3BP1_RAT (SH3 domain-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Sh3bp1 PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 3.029e-40
Identity = 130/417 (31.18%), Postives = 191/417 (45.80%), Query Frame = 2
Query:  320 DSDKISKKLPEQNLAQSFLLSADRLSVLNPHVS--KLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPEL-------ESSIANNPIP---VFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTL--SSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            D DK  KKLP   L+ +    A+    L+P  S  K   M     N+LA     +   +E +VL+ L    EE +P+++K ++ L K  SD   L+ RL     N+            ++H+                                             +K+  LK   +EL+ +++  KD  L + Y F +     +  F +LL  +A+YH++ L ++   L EL       +SS      P   V+G  L  HL    R IA  +E CV  L + E + EEGLFR+A G + +  L  + A +   +E+     D   +A  LK YLR LPEPL+T  L+DDWMRA +     +RL A+    S+LP   FNNL YL+ FLA ++   D NKMTP+N+ IV GPNLL
Sbjct:   64 DMDKRVKKLPLMALSTAM---AESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLERDVLQPLNRLSEEELPAILKRKKSLQKLVSDWNTLKSRLSQAAKNSGSSQSLGGGSSSHTHMAT------------------------------------------ANKVETLKEDEEELKRKVEQCKDEYLADLYHFSTKEDSYANYFTHLLEIQADYHRKSLTSLDTALAELRDNHSQADSSPLTTAAPFSRVYGVSLRTHLQDLGRDIALPIEACVLLLLS-EGMQEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCS--DPHAVAGALKSYLRELPEPLMTSDLYDDWMRAASLKEPGARLEALHDVCSRLPQENFNNLRYLMKFLALLAEEQDVNKMTPSNIAIVLGPNLL 432          
BLAST of Rho GTPase activating protein 44 vs. UniProt/SwissProt
Match: sp|Q68EM7|RHG17_HUMAN (Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17 PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.684e-38
Identity = 91/243 (37.45%), Postives = 133/243 (54.73%), Query Frame = 2
Query:  815 SKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPEL---ESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSA 1534
            SK++ LK   DE  ++++  KD    + Y F +   +  K F+ LL  +A+YH++ L  + + LPE+   +   A  P   FG  L +HL  S R IA  +E CV  L     + EEGLFRI  G +K+  L +A +           D   +A  LK YLR LPEPL+T +L+++W +  +  +++ +L  +     KLP   F N  YLI FLAK++  SD NKMTP+N+ IV GPNLL A
Sbjct:  171 SKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKTLPEMRAHQDKWAEKP--AFGTPLEEHLKRSGREIALPIEACVMLLLE-TGMKEEGLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDLWRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWA 410          
BLAST of Rho GTPase activating protein 44 vs. TrEMBL
Match: A0A5K3EQM2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 7.299e-68
Identity = 156/488 (31.97%), Postives = 257/488 (52.66%), Query Frame = 2
Query:  338 KKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELV--PSLVKSRRHLWKQNSDLKVLQDRLK----SLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXX---------------XXXXQNGQLSSS-------HENSKLNQLKVTRDELESQIDHLKDLSLREHYRFES-SVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANNPI-PVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSA------DSSSS---GLYNNCISSTNTIRKKLRSV-----SNANQMMKKQSGNIIDSTKN 1669
            KK+PE  LA++ L +++RL+ L P +S L    G+ +++LA  R+NW A V++ V+  ++   E       + ++RR  W+   +L+ + +R      S+ S     + +S  L  +  + N  +++ SP +S PS  T    S  +  S               +  +Q G    +          +K  QL   +++LE++   LK+ +L E + FE+ S ++ S+  ++++   A YH++C   +  + P L + +    + PV+GR L  HL  +   IAY L+ CVR L+N   LCEEG+FRIAG K KVDTL SA N  + E +I QYD +VIAD +KQYLRSLPEPLLT  L D W   +   + + ++  ++   S++P AY  N  YL  FL +V+ +++KN+MTPANL I+FGP L +A      D++S+   G  N  + S        R V      +AN++ ++     +D + +
Sbjct:  164 KKMPEVALARTCLEASERLAALQPTLSHLLFGCGQASSQLAQARVNWGARVQDCVIGPMKRVAEATSHNSEMARTRRQAWRAGGELRSVSERAARAATSVGSGHNASTDDSQSLASSERIPNLLLETVSPPISAPSRKTINSQSGGDRRSPKGVPSPLFPDGSPPSKASQAGYFPVTPNGEGNLMRTAKATQLNAIKEDLEAESQLLKEKALHELFNFETMSTLECSQALVDMVEITATYHRRCAAILEDLAPLLRAELDEQCLLPVYGRNLETHLAVTHARIAYPLQQCVRSLNNMAALCEEGIFRIAGSKTKVDTLKSALNSLRAENVIAQYDPYVIADAMKQYLRSLPEPLLTSLLLDQWSSTLEMTDSDEQIRHLQATASQMPEAYHRNAGYLFRFLNRVTEFAEKNRMTPANLSIIFGPTLFAAPHATLDDAASTADNGNQNGAVPSQFAFHGAFRGVIELLIIHANEVFRQYENEDLDGSDD 651          
BLAST of Rho GTPase activating protein 44 vs. TrEMBL
Match: A0A0V0J4W2 (Rho-GAP domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR127411 PE=4 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.595e-67
Identity = 166/454 (36.56%), Postives = 237/454 (52.20%), Query Frame = 2
Query:  338 KKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVP--SLVKSRRHLWKQNSDLKVLQDRLK------------------SLESNAYVLSPNSPIL-----------------PHNSHLQ------NPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLK-DL----------SLREHYRFES-SVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANN-PIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLS 1531
            KK+PE  LA++ L S++RLS L P +S LF   G+  +++A  RLNW   V+++V+  LR   E   P   LVKSRR  W+   +L+ + +R                    S E +  V S +SP L                   NS ++      + S +S    L  P+   S LN +          NG  +S+  +   +Q  + R    +Q++ +K DL          +L E Y FES S+++  K  ++L+   A+YH+ C+  + ++ P L+  +    P+PVFGR+L  HL  + R IAY ++VCVR L+ P  L EEGLFRIAG K KVDTL SA N  + E II QYD FVIAD LKQYLR LPEPLLT  LF +W    +      +++ +    SKLP A   N  YL  FL +++ Y+DKN+MT  NLGI+ GP LL+
Sbjct:  184 KKIPESVLARTCLESSERLSNLQPTLSHLFFGCGQAASQMACARLNWGNRVQSSVVAPLRRIVEATAPNGELVKSRRQAWRAGGELRSVSERAARAVAASTSCVGSSSAIDSSDELSPLVQSLSSPPLEATVYEHCKGSSRLQSSAKNSQIEKSLSDLSASSKSLITPLRSPTTVKSSLNCARPVTGTYIAGNGGSTSNIRDEDRSQKVLIRTAKATQLNAIKQDLEVEAQLMKEKALHELYNFESMSILECGKALVDLVEISASYHRTCVAILEELSPMLKEELDEQCPLPVFGRQLETHLQATGRRIAYPIKVCVRALNKPRVLAEEGLFRIAGSKKKVDTLQSALNTLRAENIIDQYDSFVIADVLKQYLRRLPEPLLTRKLFTEWTAVQHISGAHLQVAHLCQTASKLPEASRVNAGYLFRFLQELAKYADKNRMTATNLGIILGPTLLA 637          
BLAST of Rho GTPase activating protein 44 vs. TrEMBL
Match: A0A0X3Q510 (Rho GTPase-activating protein 17 OS=Schistocephalus solidus OX=70667 GN=RHG17 PE=4 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.539e-66
Identity = 166/454 (36.56%), Postives = 237/454 (52.20%), Query Frame = 2
Query:  338 KKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVP--SLVKSRRHLWKQNSDLKVLQDRLK------------------SLESNAYVLSPNSPIL-----------------PHNSHLQ------NPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLK-DL----------SLREHYRFES-SVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANN-PIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLS 1531
            KK+PE  LA++ L S++RLS L P +S LF   G+  +++A  RLNW   V+++V+  LR   E   P   LVKSRR  W+   +L+ + +R                    S E +  V S +SP L                   NS ++      + S +S    L  P+   S LN +          NG  +S+  +   +Q  + R    +Q++ +K DL          +L E Y FES S+++  K  ++L+   A+YH+ C+  + ++ P L+  +    P+PVFGR+L  HL  + R IAY ++VCVR L+ P  L EEGLFRIAG K KVDTL SA N  + E II QYD FVIAD LKQYLR LPEPLLT  LF +W    +      +++ +    SKLP A   N  YL  FL +++ Y+DKN+MT  NLGI+ GP LL+
Sbjct:  184 KKIPESVLARTCLESSERLSNLQPTLSHLFFGCGQAASQMACARLNWGNRVQSSVVAPLRRIVEATAPNGELVKSRRQAWRAGGELRSVSERAARAVAASTSCVGSSSAIDSSDELSPLVQSLSSPPLEATVYEHCKGSSRLQSSAKNSQIEKSLSDLSASSKSLITPLRSPTTVKSSLNCARPVTGTYIAGNGGSTSNIRDEDRSQKVLIRTAKATQLNAIKQDLEVEAQLMKEKALHELYNFESMSILECGKALVDLVEISASYHRTCVAILEELSPMLKEELDEQCPLPVFGRQLETHLQATGRRIAYPIKVCVRALNKPRVLAEEGLFRIAGSKKKVDTLQSALNTLRAENIIDQYDSFVIADVLKQYLRRLPEPLLTRKLFTEWTAVQHISGAHLQVAHLCQTASKLPEASRVNAGYLFRFLQELAKYADKNRMTATNLGIILGPTLLA 637          
BLAST of Rho GTPase activating protein 44 vs. TrEMBL
Match: A0A5K3ES84 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.334e-65
Identity = 146/429 (34.03%), Postives = 235/429 (54.78%), Query Frame = 2
Query:  338 KKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELV--PSLVKSRRHLWKQNSDLKVLQDRLK----SLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXX---------------XXXXQNGQLSSS-------HENSKLNQLKVTRDELESQIDHLKDLSLREHYRFES-SVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANNPI-PVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSA 1534
            KK+PE  LA++ L +++RL+ L P +S L    G+ +++LA  R+NW A V++ V+  ++   E       + ++RR  W+   +L+ + +R      S+ S     + +S  L  +  + N  +++ SP +S PS  T    S  +  S               +  +Q G    +          +K  QL   +++LE++   LK+ +L E + FE+ S ++ S+  ++++   A YH++C   +  + P L + +    + PV+GR L  HL  +   IAY L+ CVR L+N   LCEEG+FRIAG K KVDTL SA N  + E +I QYD +VIAD +KQYLRSLPEPLLT  L D W   +   + + ++  ++   S++P AY  N  YL  FL +V+ +++KN+MTPANL I+FGP L +A
Sbjct:  164 KKMPEVALARTCLEASERLAALQPTLSHLLFGCGQASSQLAQARVNWGARVQDCVIGPMKRVAEATSHNSEMARTRRQAWRAGGELRSVSERAARAATSVGSGHNASTDDSQSLASSERIPNLLLETVSPPISAPSRKTINSQSGGDRRSPKGVPSPLFPDGSPPSKASQAGYFPVTPNGEGNLMRTAKATQLNAIKEDLEAESQLLKEKALHELFNFETMSTLECSQALVDMVEITATYHRRCAAILEDLAPLLRAELDEQCLLPVYGRNLETHLAVTHARIAYPLQQCVRSLNNMAALCEEGIFRIAGSKTKVDTLKSALNSLRAENVIAQYDPYVIADAMKQYLRSLPEPLLTSLLLDQWSSTLEMTDSDEQIRHLQATASQMPEAYHRNAGYLFRFLNRVTEFAEKNRMTPANLSIIFGPTLFAA 592          
BLAST of Rho GTPase activating protein 44 vs. TrEMBL
Match: A0A158QD39 (Rho-GAP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS2369 PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 9.925e-65
Identity = 147/429 (34.27%), Postives = 241/429 (56.18%), Query Frame = 2
Query:  338 KKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVP--SLVKSRRHLWKQNSDLKVLQDR-------LKSLESNAY--VLSPNSPILPHN--SHLQNPSVQ-SASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSH-----------ENSKLNQLKVTRDELESQIDHLKDLSLREHYRFES-SVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANN-PIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSS 1543
            KK+PE  LA++ L +++RL+ L P +S L    G+ +++LA  RL+W A V+  V+  ++   E   P   +V+SRR  W+   +L+ + +R       L   + +A     SP+  +   N  SH   P+ + S S +    +I  S+         + ++ +  L  S            +  K  QL   +++LE++   LK+ +LRE + FE+ S ++ S+  + ++   A YH+ C   + ++ P L + +    P+PV+GR L  HL+ +   IAY L++C+R L+    LCEEGLFRIAG K KVDTL SA N  + E II QYD++VIAD +KQYLRSLP+PLLT HL ++W  A+   ++  ++  ++    K+P+ Y  N  YL  +L ++   +++N+MTPA+L I+FGP+LL+A  S
Sbjct:   12 KKMPETVLARTCLEASERLANLQPTLSHLLFGCGQASSQLAQARLSWGARVQETVIGPMKRVAEAAGPNSEMVRSRRQAWRAGGELRSVSERAARAANSLTHSQGSATDEAQSPDHKVPSENLPSHEPTPNRKDSGSKLHPAKTILKSISIPISQTNHHQSSNSSMLKGSLGGIINGEGNILKTVKATQLNAIKEDLEAESQLLKEKALRELFNFETMSTLECSQALVEMVEISAAYHRTCATILDELAPLLRAELDEQCPLPVYGRSLETHLVVTHAKIAYPLKICIRVLNTDAALCEEGLFRIAGSKTKVDTLKSALNSLRAESIIDQYDYYVIADAMKQYLRSLPQPLLTTHLLNEWAGALQIKDKSVQILRLQQIARKMPLEYERNCGYLFRYLFRLIERTEQNRMTPASLAIIFGPSLLNASYS 440          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Cavefish
Match: si:ch211-114m9.1 (si:ch211-114m9.1 [Source:ZFIN;Acc:ZDB-GENE-120215-49])

HSP 1 Score: 179.489 bits (454), Expect = 1.130e-45
Identity = 138/462 (29.87%), Postives = 219/462 (47.40%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G    +   K+P      SKKLP   LAQ  +  A  L   +  + K+  M G+T  KLA E + +   +E +V+E L +  E  +P++ K R+HL K   D+   + R +    ++             S+LQ    +S S                             L    E +  N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P +G+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L ++ +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+++W++A N  + + RL A+     KLP    NN  YLI FL+K++ Y D NKMTP N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLDLVKQVSHSTHKKLTAC-----------LQGQQGADVEKRSVKSP------SKKLPLTTLAQCMVEGAAVLGD-DSLLGKMLKMCGDTEEKLAQELILFEFQIERDVVEPLYVLAEVDIPNIQKQRKHLAKLVLDMDSARTRWQQSSKSSSH----------PSNLQPGGAKSDS-----------------------------LREEMEETA-NRMEICRDQLSADM-----------YNFVAKEIDYANYFQTLIEVQAEYHRKSLEILQSVLPQIKAQQEAWIEKPSYGKPLEEHLTLSGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKASLDCGVVD--VQEYSADPHAIAGALKSYLRELPEPLMTSELYEEWIQASNIQDMDKRLQALLNSCEKLPTDNLNNFRYLIKFLSKLTEYQDSNKMTPGNIAIVLGPNLL 416          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Cavefish
Match: ARHGAP17 (Rho GTPase activating protein 17 [Source:NCBI gene;Acc:103031684])

HSP 1 Score: 174.866 bits (442), Expect = 7.191e-45
Identity = 123/409 (30.07%), Postives = 196/409 (47.92%), Query Frame = 2
Query:  326 DKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSS 1549
            DK  KK+P   L+Q+ L   ++L   +  + K+  + GE  NKLA E+      +E ++L+ +    E  +P+++K R+ L K   D      R + L++   +L+  +          NP++                                       ++K + LK   DE  ++++  KD    + Y F S   + +  ++ LL  +A YH++ L +I  +LP + S        P FG  L +HL  + R IA  +E CV  L     + EEGLFRIA G +K+  L +A +    +      D   +A  LK YLR LPEPL+T  L+D+W++A N  + + RL A+ +    LP A   NL YL+ FLAK++  S+ NKMTP+N+ IV GPNLL A +  +
Sbjct:   63 DKRHKKMPLSGLSQAMLEGWNQLGEES-MIGKIMEVCGEAENKLAYEQSQHEVQLERDILDPINQLAEVDIPNILKQRKQLAKLVLDYD--SARARYLQATKAILTATN----------NPAM---------------------------------------SAKADSLKEEMDEAHNKVEICKDQLAADMYAFSSKEGEYACYYVVLLEAQAEYHKRSLASIESLLPSIRSKQDTWTEKPAFGTALEEHLKRTNREIALPIEACVMMLLE-TGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTFQLYDEWIQASNISDSDKRLQALWVICDSLPKANKANLRYLVKFLAKLAQESEVNKMTPSNIAIVLGPNLLWAKTEGT 418          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Cavefish
Match: ARHGAP17 (Rho GTPase activating protein 17 [Source:NCBI gene;Acc:103031684])

HSP 1 Score: 174.481 bits (441), Expect = 2.266e-44
Identity = 123/409 (30.07%), Postives = 196/409 (47.92%), Query Frame = 2
Query:  326 DKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSS 1549
            DK  KK+P   L+Q+ L   ++L   +  + K+  + GE  NKLA E+      +E ++L+ +    E  +P+++K R+ L K   D      R + L++   +L+  +          NP++                                       ++K + LK   DE  ++++  KD    + Y F S   + +  ++ LL  +A YH++ L +I  +LP + S        P FG  L +HL  + R IA  +E CV  L     + EEGLFRIA G +K+  L +A +    +      D   +A  LK YLR LPEPL+T  L+D+W++A N  + + RL A+ +    LP A   NL YL+ FLAK++  S+ NKMTP+N+ IV GPNLL A +  +
Sbjct:   63 DKRHKKMPLSGLSQAMLEGWNQLGEES-MIGKIMEVCGEAENKLAYEQSQHEVQLERDILDPINQLAEVDIPNILKQRKQLAKLVLDYD--SARARYLQATKAILTATN----------NPAM---------------------------------------SAKADSLKEEMDEAHNKVEICKDQLAADMYAFSSKEGEYACYYVVLLEAQAEYHKRSLASIESLLPSIRSKQDTWTEKPAFGTALEEHLKRTNREIALPIEACVMMLLE-TGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTFQLYDEWIQASNISDSDKRLQALWVICDSLPKANKANLRYLVKFLAKLAQESEVNKMTPSNIAIVLGPNLLWAKTEGT 418          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Cavefish
Match: si:ch211-114m9.1 (si:ch211-114m9.1 [Source:ZFIN;Acc:ZDB-GENE-120215-49])

HSP 1 Score: 159.073 bits (401), Expect = 1.538e-39
Identity = 89/238 (37.39%), Postives = 136/238 (57.14%), Query Frame = 2
Query:  824 NQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSI-ANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++   A    P +G+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L ++ +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+++W++A N  + + RL A+     KLP    NN  YLI FL+K++ Y D NKMTP N+ IV GPNLL
Sbjct:  172 NRMEICRDQLSADM-----------YNFVAKEIDYANYFQTLIEVQAEYHRKSLEILQSVLPQIKAQQEAWIEKPSYGKPLEEHLTLSGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKASLDCGVVD--VQEYSADPHAIAGALKSYLRELPEPLMTSELYEEWIQASNIQDMDKRLQALLNSCEKLPTDNLNNFRYLIKFLSKLTEYQDSNKMTPGNIAIVLGPNLL 395          

HSP 2 Score: 50.8322 bits (120), Expect = 8.249e-6
Identity = 33/96 (34.38%), Postives = 51/96 (53.12%), Query Frame = 2
Query:  320 DSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDR 607
            D +K SKKLP   LAQ  +  A  L   +  + K+  M G+T  KLA E + +   +E +V+E L +  E  +P++ K R+HL K   D+   + R
Sbjct:   45 DVEKRSKKLPLTTLAQCMVEGAAVLGD-DSLLGKMLKMCGDTEEKLAQELILFEFQIERDVVEPLYVLAEVDIPNIQKQRKHLAKLVLDMDSARTR 139          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Cavefish
Match: si:ch211-114m9.1 (si:ch211-114m9.1 [Source:ZFIN;Acc:ZDB-GENE-120215-49])

HSP 1 Score: 157.918 bits (398), Expect = 7.962e-39
Identity = 90/241 (37.34%), Postives = 136/241 (56.43%), Query Frame = 2
Query:  824 NQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPEL----ESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++    E+ I     P +G+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L ++ +   V+  +++Y  D   IA  LK YLR LPEPL+T  L+++W++A N  + + RL A+     KLP    NN  YLI FL+K++ Y D NKMTP N+ IV GPNLL
Sbjct:  193 NRMEICRDQLSADM-----------YNFVAKEIDYANYFQTLIEVQAEYHRKSLEILQSVLPQIKAQQEAWIEK---PSYGKPLEEHLTLSGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKASLDCGVVD--VQEYSADPHAIAGALKSYLRELPEPLMTSELYEEWIQASNIQDMDKRLQALLNSCEKLPTDNLNNFRYLIKFLSKLTEYQDSNKMTPGNIAIVLGPNLL 416          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007074.1 (pep scaffold:Pmarinus_7.0:GL479940:7219:11207:1 gene:ENSPMAG00000006391.1 transcript:ENSPMAT00000007074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 3.428e-20
Identity = 58/187 (31.02%), Postives = 96/187 (51.34%), Query Frame = 2
Query: 1046 VFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKI--IKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSSGLYNNCISSTNTIRKKL 1600
            VFG++L+QHL  S       L +C   ++    +   G++R +G    +  L   FN  KV  +  I Q  H   ++  K Y R LP+PLLT+ L+D++  A+  P E  +L  M+  +  LP   +  L +L+  L  + +++DK KMT  NL IV+GPNLL   +    + +  + +T   R+ +
Sbjct:  144 VFGKDLAQHLGNSGHDGERVLTMCTELIEKHGIV--SGIYRCSGLVTDIKQLREEFNSGKVPDLTGIVQRIH-CFSNLCKLYFRELPDPLLTYKLYDEFTEALVAPTEHEKLLRMQDVIQLLPGPNYRTLQHLMRHLLLLESHADKTKMTSMNLSIVWGPNLLRRQTVEEAVSDPKMVATEMSRQSM 327          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 84.7297 bits (208), Expect = 1.528e-18
Identity = 55/191 (28.80%), Postives = 96/191 (50.26%), Query Frame = 2
Query:  965 NYHQQCLRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNV--FKVEKIIKQYDHF-VIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            N H+QC     +V+P        +   V+  +L+  +    R     +++C++ ++    L  EGL+R++G    ++ +  AF+    K +     YD   +I   LK Y R LP PL+T+  +  ++ A    + + RL  +   L  LP A++ +L YL+  L +V+ YS +N M+  NL IVFGP L+
Sbjct:    6 NVHKQC----SKVVPHDCEPDLKHVKKVYSCDLTTLVKAHNRKRPMVVDMCIKEIEM-RGLRSEGLYRVSGFSEHIEDVKMAFDRDGEKADISANSYDDINIITGALKLYFRDLPIPLITYDAYPKFIEASKLMDADERLEGIHEALRLLPPAHYESLRYLMAHLKRVTLYSKENLMSAENLAIVFGPTLM 191          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Sea Lamprey
Match: arhgap5 (Rho GTPase activating protein 5 [Source:ZFIN;Acc:ZDB-GENE-081014-1])

HSP 1 Score: 87.4261 bits (215), Expect = 1.591e-17
Identity = 58/180 (32.22%), Postives = 84/180 (46.67%), Query Frame = 2
Query: 1031 NNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFV-----------IADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSAD 1537
            +NPIP+F                  +E CV +L++   +  EGL+R++G K + D+L   F            DH +           +A  LK +   LP+PLL + +  D M A+N P++  RL A++  L KLP        Y+I  L KVS YS +N MT  NL I F P L+  D
Sbjct: 1232 DNPIPLF------------------VEKCVLYLESC-GITTEGLYRVSGNKTEQDSLQKQFEC----------DHSISYEAMDVNVNTVAGSLKIFFAELPDPLLPYDIHQDLMEAINIPDKTGRLLALRGKLKKLPHVNHEVFKYIITHLHKVSQYSSENYMTSENLSICFWPTLMRPD 1382          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008956.1 (pep scaffold:Pmarinus_7.0:GL484257:7565:13095:-1 gene:ENSPMAG00000008104.1 transcript:ENSPMAT00000008956.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 1.625e-17
Identity = 49/139 (35.25%), Postives = 68/139 (48.92%), Query Frame = 2
Query: 1154 EGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFV-----------IADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSAD 1537
            EGL+R++G K + D+L   F            DH +           +A  LK +   LP+PLL + +  D M A+N P++  RL A++  L KLP        Y+I  L KVS YS +N MT  NL I F P L+  D
Sbjct:    5 EGLYRVSGNKTEQDSLQKQFEC----------DHSISYEAMDVNVNTVAGSLKIFFAELPDPLLPYDIHQDLMEAINIPDKTGRLLALRGKLKKLPHVNHEVFKYIITHLHKVSQYSSENYMTSENLSICFWPTLMRPD 133          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 82.0333 bits (201), Expect = 4.475e-17
Identity = 59/196 (30.10%), Postives = 98/196 (50.00%), Query Frame = 2
Query:  965 NYHQQCLRTIGQVLPELESSIANNP--IP-VFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVF--KVEKIIKQYDHF-VIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFL--AKVSTYSDKNKMTPANLGIVFGPNLL 1528
            N H+QC R +        +    +P  +P VFG +L+  +   R  +   +E+C+  ++    L  EGL+R++G  + V+ + +AF+    K +   K Y+   VI   LK Y R LP PL+T+  +  ++ A    +   RL  ++  L  LP A+++ L  L+  L   +VS     N M+  NL IVFGP L+
Sbjct:   86 NVHKQCCRLV-------PTDCQPDPRRLPKVFGCDLTALVKAHRGRLPMVVEMCIGEIEA-RGLKSEGLYRVSGVSDLVEEVRTAFDKEGEKADISAKAYEDVNVITGALKLYFRELPTPLVTYQAYPHFVEAAKVSDPAERLEQLRRALQTLPPAHYDTLHCLMAHLHRRRVSQQEKHNLMSSENLSIVFGPTLM 273          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Yeast
Match: RGA1 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; RGA1 has a paralog, RGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000005653])

HSP 1 Score: 77.411 bits (189), Expect = 1.003e-14
Identity = 52/189 (27.51%), Postives = 87/189 (46.03%), Query Frame = 2
Query: 1046 VFGRELSQHLLTSRRHIAYTLEVCVRHLD-NPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEK------IIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAV---------------------NNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            ++G  L          I   L VC+  ++ + E +  EG++R +G +  ++ +   F+ +KV++      I+ + D  V+   LK+YLR LP P+ T  +++  MR V                     N+    S  SA+K  L  LP  ++  L  L   + KV+ YS  N+MT  NL +VF P L+
Sbjct:  788 LYGSSLVARCNYENNEIPMILSVCIDFIESDEENMRSEGIYRKSGSQLVIEEIEKQFSAWKVQQNTETPNILTEQDLNVVTGVLKRYLRKLPNPIFTFQIYEPLMRLVKSKKMMENLPFVGGKLSLEAKNSDTYMSSKSALKNILEDLPREHYRVLRVLSEHIEKVTRYSHWNRMTLYNLALVFAPGLI 976          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Yeast
Match: BEM2 (Rho GTPase activating protein (RhoGAP); involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence; potential GAP for Rho4p [Source:SGD;Acc:S000000957])

HSP 1 Score: 70.0922 bits (170), Expect = 1.757e-12
Identity = 50/156 (32.05%), Postives = 76/156 (48.72%), Query Frame = 2
Query: 1109 EVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAF-------NVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDW------MRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSAD 1537
            E+ +R LD      E GL+RI G    ++ L +AF       N F +E   + ++   IA C K YLR LP+ L +H + +D+       +A    NEE +   M   L KLP  Y+  L  ++  L KV  +   NKM  +NL IVF  + ++ +
Sbjct: 1990 EIELRGLD------EVGLYRIPGSIGSINALKNAFDEEGATDNSFTLEDD-RWFEVNAIAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMVNEEYK-RMMNELLQKLPTCYYQTLKRIVFHLNKVHQHVVNNKMDASNLAIVFSMSFINQE 2137          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 53.1434 bits (126), Expect = 2.622e-7
Identity = 43/156 (27.56%), Postives = 70/156 (44.87%), Query Frame = 2
Query: 1154 EGLFRIAGGKNKVDTLSSAFN----------VFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRL---------SAMKMCLSK------------LPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            EGL+R +G +  V+ + + F             K+  ++ Q D   +A  LK+YLR LP+P+L+  ++D  +  V N     RL         S  K+ + +            LPV +   L  L   + KV   S++N M   NL +VF P+L+
Sbjct:  822 EGLYRKSGSQTLVEEIENEFAQNNSLHSDTLSPKLNALLNQ-DIHAVASVLKRYLRKLPDPVLSFSIYDALIDLVRNNQLIERLPLNNDKFLDSPQKVTIYEMVLKSLLEIFKILPVEHQEVLKVLAAHIGKVRRCSERNLMNLHNLSLVFAPSLI 976          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Yeast
Match: LRG1 (GTPase-activating protein (GAP); contains Rho1p-specific GAP activity, interacting with activated forms of Rho1p; functions along with Sac7p as a negative regulator of the Pkc1p-mediated cell wall integrity signaling pathway; negative regulator of cell wall 1,3-beta-glucan biosynthesis; required for efficient cell fusion; contains a RhoGAP domain and three Lin-11-Isl1-Mec-3 (LIM) domains [Source:SGD;Acc:S000002399])

HSP 1 Score: 50.447 bits (119), Expect = 1.571e-6
Identity = 36/131 (27.48%), Postives = 65/131 (49.62%), Query Frame = 2
Query: 1154 EGLFRIAGGKNKVDTLSSAFNVFKVEKI-IKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSD-----KNKMTPANLGIVFGPNLL 1528
            EG+FR  G   ++  L++  +    E     + +   ++  LK+++R LP+P+L+  L++ W++A     E+ +   + +  S LP    N L  L+ FL   S++S       +KM   NL  V  PN+L
Sbjct:  773 EGIFRKNGNIRRLRELTANIDSNPTEAPDFSKENAIQLSALLKKFIRELPQPILSTDLYELWIKAAKIDLEDEKQRVILLIYSLLPTYNRNLLEALLSFLHWTSSFSYIENEMGSKMDIHNLSTVITPNIL 903          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Yeast
Match: BEM3 (Rho GTPase activating protein (RhoGAP); involved in control of the cytoskeleton organization; targets the essential Rho-GTPase Cdc42p, which controls establishment and maintenance of cell polarity, including bud-site assembly [Source:SGD;Acc:S000006036])

HSP 1 Score: 48.1358 bits (113), Expect = 8.597e-6
Identity = 48/158 (30.38%), Postives = 69/158 (43.67%), Query Frame = 2
Query: 1115 CVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNV-FKV------EKIIKQYDHF---------VIADCLKQYLRSLPEPLLTHHLFDDWMRAV----NNPNEESRLSAMKMCLSKL-PVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNL 1525
            C+ +L     + EEG+FR++G    + TL   F+  + V      E I  + D            ++  LK YLR LP  L     F  + R V    NNP + S L   ++  S L P A  + +  L   L +++  S  NKM   NL IVF P L
Sbjct:  933 CLEYLYKNRGIQEEGIFRLSGSSTVIKTLQERFDKEYDVDLCRYNESIEAKDDEASPSLYIGVNTVSGLLKLYLRKLPHLLFGDEQFLSFKRVVDENHNNPVQIS-LGFKELIESGLVPHANLSLMYALFELLVRINENSKFNKMNLRNLCIVFSPTL 1089          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Nematostella
Match: EDO47995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ0])

HSP 1 Score: 157.147 bits (396), Expect = 4.561e-41
Identity = 88/251 (35.06%), Postives = 139/251 (55.38%), Query Frame = 2
Query:  812 NSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANNPI-PVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSSGLYN 1561
             SK + LK   +   ++ +  +D    E   F +   + ++  +  +  +  YH+     +  VLP L++ + ++ +  VFG  L +HL   RR IA+ LE C+ +L + E L E+GLFR+AG   K+  L +AF+   V+      D   I   LKQYLR LPEPL+T  L+DDW++A +  +  +RL A    + KLP A  +NL YLI FL K++ YS+ NKMT +N+ IV  PN++ ++  +S   N
Sbjct:  173 QSKADALKEELENETAKFEACQDGFTTEALTFVAREAEFAEWMIKFIEAQQEYHKSASMILQDVLPLLKTQVESSSLRSVFGCPLEEHLKVQRRSIAFVLEECLTYL-HEEALQEQGLFRMAGSSGKIRKLKAAFDAGMVDLTEFDCDVHAITGVLKQYLRELPEPLMTFALYDDWIQAASIQDSGARLQAYWGLVDKLPKANKDNLRYLICFLGKLADYSEVNKMTASNIAIVIAPNIIYSEQDTSDAIN 422          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Nematostella
Match: EDO42176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S254])

HSP 1 Score: 83.5741 bits (205), Expect = 1.107e-16
Identity = 56/213 (26.29%), Postives = 95/213 (44.60%), Query Frame = 2
Query:  965 NYHQQCLRTIGQVLPELESSIANNPIP-------VFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKII----------KQYDHF-VIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSS 1549
            N H+QC +           +I NN  P        FG +L+  +        + +++C+  ++    L  EGL+R++G  + ++ L ++F+       +            YD    I    K Y R LP PL+T   +  ++ A    ++  R+  +   L +LP A++  + +L+G L +VS    KN MT  NL IVFGP L+ A    S
Sbjct:  229 NAHKQCTK-----------AIPNNCKPDKKYIKRAFGVDLTTLVKLHNTKRPFVVDICINEVEK-RGLDSEGLYRVSGFADDIEALKNSFDKGNTHTTVNYSDGESVNLSTYDDINTITGVCKLYFRQLPLPLITFETYSKFIAAAKTQDKHLRIEELSKALGELPQAHYETMKFLMGHLHRVSQRRSKNMMTEENLSIVFGPTLMRAPEGDS 429          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Nematostella
Match: EDO49053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHX5])

HSP 1 Score: 83.5741 bits (205), Expect = 2.141e-16
Identity = 49/142 (34.51%), Postives = 78/142 (54.93%), Query Frame = 2
Query: 1115 CVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADS 1540
            C+  ++    L E GL+R+ G +  +  L   F   K + + +  D  V+   LK +LR+L EPL+T+HL+  ++ A N  +++   SAM   +S+LP A  + L+ L+  L KVS  +D  KM  +NL  VFGP L+   S
Sbjct:  389 CISEIEK-RGLNEVGLYRVPGAERSIKELKDKFLHGKTQNLHETIDIHVVCGVLKDFLRNLAEPLVTYHLWGAFVNAANKDDDQDSFSAMYQAVSELPQANRDTLACLVVHLQKVSQCTD-CKMPVSNLARVFGPTLVGHSS 528          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Nematostella
Match: EDO31406 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY14])

HSP 1 Score: 81.6481 bits (200), Expect = 6.981e-16
Identity = 43/132 (32.58%), Postives = 75/132 (56.82%), Query Frame = 2
Query: 1154 EGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY---DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADS 1540
            +G++R++G  + +  L   F+  +  ++  +Y   D   I+  LK Y R LP PLLT+ L+D ++ A+   +E+ R  A+   + +LP  ++  L YL+  LAKV++++ +  M   NL IV+ PNLL   S
Sbjct:  310 DGIYRLSGSSSIIQKLRFLFDGDEPPELDDEYYLRDVHCISSLLKMYFRELPNPLLTYSLYDKFVSAIQITDEKERKVAIHHVVQQLPPPHYRTLEYLLQHLAKVASHAGQTAMHAKNLAIVWAPNLLKPRS 441          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Nematostella
Match: EDO47441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM51])

HSP 1 Score: 81.2629 bits (199), Expect = 1.542e-15
Identity = 57/176 (32.39%), Postives = 84/176 (47.73%), Query Frame = 2
Query: 1013 LESSIANNPIPVFGRELSQHLLTSRRHIAYTLEV--CVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAF--NVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +E   + N + VFG ++    +TSR      L V  CVR ++    L E G++R++G  + V  L   F  N      ++ + D   +A   K YLR LPEPL T  L+D +++A    + E +   M      LP        YL   L KV+  S+ +KM   NL  VFGPN+L
Sbjct:  598 IERKKSVNSVGVFGVDIET--VTSRESCDIPLIVIGCVREIEK-RGLEEVGIYRLSGASSDVKRLKEGFDENSQSALVLVSEADIHAVAGLFKMYLRDLPEPLFTDELYDKFVKAYAMADAEEKRETMLELFQSLPTPNRLTACYLFQHLRKVAEKSEVHKMGLNNLSTVFGPNVL 770          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Medaka
Match: si:ch211-114m9.1 (rho GTPase-activating protein 44 [Source:NCBI gene;Acc:101169113])

HSP 1 Score: 183.726 bits (465), Expect = 2.714e-47
Identity = 133/411 (32.36%), Postives = 201/411 (48.91%), Query Frame = 2
Query:  320 DSDKISKKLPEQNLAQ-----SFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELES-SIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++K SKKLP   LAQ     + +L  D L      + K+  + GET  KLA E L +   +E +V+E L +  E  +P++ K R+HL K   D+   + R +    ++             S LQ P  +S S                             L    E +  N++++ RD+L + +           Y F +  ID +  F  L+  +  YH++ L  +  VLP++++   A    P FG+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L ++ +   ++  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N  + + RL A+     KLP    NN  YLI FLAK+S Y D NKMTP N+ IV GPNLL
Sbjct:   61 ETEKKSKKLPLTMLAQCMEEGAAVLGDDSL------LGKMLKLCGETEEKLAQELLQFEVQIERDVVEPLYVLAEVDIPNIQKQRKHLAKLVLDMDSARTRYQQSSKSSSH----------PSTLQ-PGAKSES-----------------------------LREEMEEAA-NRMEICRDQLSADM-----------YNFVAKEIDYANYFQTLIEMQVEYHKKSLEILHGVLPQIKAHQEAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKASLDCGVID--VQEYSSDPHAIAGALKSYLRELPEPLMTTELYDEWIQASNIQDMDKRLQALMGVCEKLPTDNLNNFRYLIKFLAKLSDYQDSNKMTPGNVAIVLGPNLL 410          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Medaka
Match: ENSORLT00000015714.2 (rho GTPase-activating protein 44 [Source:NCBI gene;Acc:101158144])

HSP 1 Score: 182.185 bits (461), Expect = 4.816e-47
Identity = 135/462 (29.22%), Postives = 215/462 (46.54%), Query Frame = 2
Query:  152 DNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            +++ ++E+     K++S    K+L  C           L G  G           +D +K SKKLP   LAQ  +  A  +      + K+  + GET  +LA E + +   +E +V++ L    E  +P++ K R+HL K   D+   + R      ++ V +   P      HL+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++        P +G+ L +HL+ S R IA+ +E CV  L     + EEGLFRIA   +K+  L ++ +   ++  +++Y  D   IA  LK YLR LPEPL+T  L+ DW++A N  + E RL A+     KLP A  NN  YLI FL+K++ Y D NKMTP N+ IV GPNLL
Sbjct:   27 EDLLQVEKRLELVKQVSHSTHKKLTAC-----------LQGQQG-----------VDVEKKSKKLPLTTLAQCMVEGAVVVGD-ESLLGKMLKLCGETQERLAQELILFELTIERDVVDPLCELAEVEIPNIQKQRKHLAKLVLDMDSARTRYYQSTKSSGVSTNLQPTGAKADHLREEMEEAA----------------------------------------NRMEICRDQLSADM-----------YSFVAKEIDYASYFQTLIEVQAEYHRKSLELLQSVLPQIKAHQETWVEKPCYGKPLEEHLVLSGRDIAFPIEACVTMLLEC-GMEEEGLFRIAPSASKLKKLKASLDCGVLD--VQEYSADPHAIAGALKSYLRELPEPLMTFQLYSDWIQASNIQDHEKRLQALYAACEKLPPANNNNFKYLIKFLSKLTEYQDLNKMTPGNIAIVLGPNLL 411          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Medaka
Match: ENSORLT00000028184.1 (rho GTPase-activating protein 44 [Source:NCBI gene;Acc:101158144])

HSP 1 Score: 177.948 bits (450), Expect = 1.110e-45
Identity = 124/401 (30.92%), Postives = 193/401 (48.13%), Query Frame = 2
Query:  335 SKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            SKKLP   LAQ  +  A  +      + K+  + GET  +LA E + +   +E +V++ L    E  +P++ K R+HL K   D+   + R      ++ V +   P      HL+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++        P +G+ L +HL+ S R IA+ +E CV  L     + EEGLFRIA   +K+  L ++ +   ++  +++Y  D   IA  LK YLR LPEPL+T  L+ DW++A N  + E RL A+     KLP A  NN  YLI FL+K++ Y D NKMTP N+ IV GPNLL
Sbjct:   71 SKKLPLTTLAQCMVEGAVVVGD-ESLLGKMLKLCGETQERLAQELILFELTIERDVVDPLCELAEVEIPNIQKQRKHLAKLVLDMDSARTRYYQSTKSSGVSTNLQPTGAKADHLREEMEEAA----------------------------------------NRMEICRDQLSADM-----------YSFVAKEIDYASYFQTLIEVQAEYHRKSLELLQSVLPQIKAHQETWVEKPCYGKPLEEHLVLSGRDIAFPIEACVTMLLEC-GMEEEGLFRIAPSASKLKKLKASLDCGVLD--VQEYSADPHAIAGALKSYLRELPEPLMTFQLYSDWIQASNIQDHEKRLQALYAACEKLPPANNNNFKYLIKFLSKLTEYQDLNKMTPGNIAIVLGPNLL 416          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Medaka
Match: ENSORLT00000015713.2 (rho GTPase-activating protein 44 [Source:NCBI gene;Acc:101158144])

HSP 1 Score: 178.333 bits (451), Expect = 1.278e-45
Identity = 124/401 (30.92%), Postives = 193/401 (48.13%), Query Frame = 2
Query:  335 SKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIAN-NPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            SKKLP   LAQ  +  A  +      + K+  + GET  +LA E + +   +E +V++ L    E  +P++ K R+HL K   D+   + R      ++ V +   P      HL+    ++A                                        N++++ RD+L + +           Y F +  ID +  F  L+  +A YH++ L  +  VLP++++        P +G+ L +HL+ S R IA+ +E CV  L     + EEGLFRIA   +K+  L ++ +   ++  +++Y  D   IA  LK YLR LPEPL+T  L+ DW++A N  + E RL A+     KLP A  NN  YLI FL+K++ Y D NKMTP N+ IV GPNLL
Sbjct:   71 SKKLPLTTLAQCMVEGAVVVGD-ESLLGKMLKLCGETQERLAQELILFELTIERDVVDPLCELAEVEIPNIQKQRKHLAKLVLDMDSARTRYYQSTKSSGVSTNLQPTGAKADHLREEMEEAA----------------------------------------NRMEICRDQLSADM-----------YSFVAKEIDYASYFQTLIEVQAEYHRKSLELLQSVLPQIKAHQETWVEKPCYGKPLEEHLVLSGRDIAFPIEACVTMLLEC-GMEEEGLFRIAPSASKLKKLKASLDCGVLD--VQEYSADPHAIAGALKSYLRELPEPLMTFQLYSDWIQASNIQDHEKRLQALYAACEKLPPANNNNFKYLIKFLSKLTEYQDLNKMTPGNIAIVLGPNLL 416          
BLAST of Rho GTPase activating protein 44 vs. Ensembl Medaka
Match: si:ch211-114m9.1 (rho GTPase-activating protein 44 [Source:NCBI gene;Acc:101169113])

HSP 1 Score: 176.022 bits (445), Expect = 1.655e-44
Identity = 121/375 (32.27%), Postives = 184/375 (49.07%), Query Frame = 2
Query:  413 VSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELES-SIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQY--DHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            + K+  + GET  KLA E L +   +E +V+E L +  E  +P++ K R+HL K   D+   + R +    ++             S LQ P  +S S                             L    E +  N++++ RD+L + +           Y F +  ID +  F  L+  +  YH++ L  +  VLP++++   A    P FG+ L +HL  S R IA+ +E CV  L     + EEGLFR+A   +K+  L ++ +   ++  +++Y  D   IA  LK YLR LPEPL+T  L+D+W++A N  + + RL A+     KLP    NN  YLI FLAK+S Y D NKMTP N+ IV GPNLL
Sbjct:   96 LGKMLKLCGETEEKLAQELLQFEVQIERDVVEPLYVLAEVDIPNIQKQRKHLAKLVLDMDSARTRYQQSSKSSSH----------PSTLQ-PGAKSES-----------------------------LREEMEEAA-NRMEICRDQLSADM-----------YNFVAKEIDYANYFQTLIEMQVEYHKKSLEILHGVLPQIKAHQEAWVEKPSFGKSLEEHLNISGREIAFPIEACVTMLLE-CGMQEEGLFRVAPSASKLKKLKASLDCGVID--VQEYSSDPHAIAGALKSYLRELPEPLMTTELYDEWIQASNIQDMDKRLQALMGVCEKLPTDNLNNFRYLIKFLAKLSDYQDSNKMTPGNVAIVLGPNLL 415          
BLAST of Rho GTPase activating protein 44 vs. Planmine SMEST
Match: SMESG000068429.1 (SMESG000068429.1)

HSP 1 Score: 1815.43 bits (4701), Expect = 0.000e+0
Identity = 959/962 (99.69%), Postives = 959/962 (99.69%), Query Frame = 2
Query:   83 MKHMLINKFLRNDKNIEAPSNWPDNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSSGLYNNCISSTNTIRKKLRSVSNANQMMKKQSGNIIDSTKNGNSVDSNGLLSIGDSMRNGKLNYRYEEDSMSKSMMASNNHCFVIELLISNFNYFFPNQTTQFSSNIPPKVFPNNFRTKRQNSFNGHSSNDCAHIIHKINLTSSSVKNNPSTDNSTDSYVXXXXXXXXXXTQYPRRVSMDSSTPTEMSTSVTKSLATTPTGKKSTDFRNGTVFPSCLYRRRVSDGTLSNLKNCNNDNFIGXXXXXXXXXXXXXXXXXXXXXXAKSSNDCEDFLDTRSFLTSVLDTDSLEPPTNSQSAKYVPKSFHADVYDTLFALQSLNSYAASTDDYLTRVRSVYERRILSKPSDKAQTPLVRRQTINTSTNEDPMSKSVTNDSSIKYFDDQNLTSKTSIIRRPKPVINIKLKNYRESSPANXXXXXXXXXXXXXXXXAHFKQVKCETKPFNKLSLEADDSRAAASSLIRYSMPILPAKGINN 2968
            MKHMLINKFLRNDKNIEAPSNWPDNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSISTSVLNSSLNCVSNSNTQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSSGLYNNCISSTNTIRKKLRSVSNANQMMKKQSGNIIDSTKNGNSVDSNGLLSIGDSMRNGKLNYRYEEDSMSKSMMASNNHCFVIELLISNFNYFFPNQTTQFSSNIPPKVFPNNFRTKRQNSFNGHSSNDCAHIIHKINLTSSSVKNNPSTDNSTDSYVNNSLQQSSLSTQYPRRVSMDSSTPTEMSTSVTKSLATTPTGKKSTDFRNGTVFPSCLYRRRVSDGTLSNLKNCNNDNFIGSLDISDLPDIDSSCIDDCQSSSAKSSNDCEDFLDTRSFLTSVLDTDSLEPP NSQSAKYVPKSFHADVYDTLFALQSLNSYAASTDDYL RVRSVYERRILSKPSDKAQTPLVRRQTINTSTNEDPMSKSVTNDSSIKY DDQNLTSKTSIIRRPKPVINIKLKNYRESSPANIQTLSSDSIDQIDSTIAHFKQVKCETKPFNKLSLEADDSRAAASSLIRYSMPILPAKGINN
Sbjct:    1 MKHMLINKFLRNDKNIEAPSNWPDNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSISTSVLNSSLNCVSNSNTQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSSGLYNNCISSTNTIRKKLRSVSNANQMMKKQSGNIIDSTKNGNSVDSNGLLSIGDSMRNGKLNYRYEEDSMSKSMMASNNHCFVIELLISNFNYFFPNQTTQFSSNIPPKVFPNNFRTKRQNSFNGHSSNDCAHIIHKINLTSSSVKNNPSTDNSTDSYVNNSLQQSSLSTQYPRRVSMDSSTPTEMSTSVTKSLATTPTGKKSTDFRNGTVFPSCLYRRRVSDGTLSNLKNCNNDNFIGSLDISDLPDIDSSCIDDCQSSSAKSSNDCEDFLDTRSFLTSVLDTDSLEPPNNSQSAKYVPKSFHADVYDTLFALQSLNSYAASTDDYLNRVRSVYERRILSKPSDKAQTPLVRRQTINTSTNEDPMSKSVTNDSSIKYIDDQNLTSKTSIIRRPKPVINIKLKNYRESSPANIQTLSSDSIDQIDSTIAHFKQVKCETKPFNKLSLEADDSRAAASSLIRYSMPILPAKGINN 962          
BLAST of Rho GTPase activating protein 44 vs. Planmine SMEST
Match: SMESG000068429.1 (SMESG000068429.1)

HSP 1 Score: 1808.5 bits (4683), Expect = 0.000e+0
Identity = 956/959 (99.69%), Postives = 956/959 (99.69%), Query Frame = 2
Query:   92 MLINKFLRNDKNIEAPSNWPDNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSIXXXXXXXXXXXXXXXXXQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSSGLYNNCISSTNTIRKKLRSVSNANQMMKKQSGNIIDSTKNGNSVDSNGLLSIGDSMRNGKLNYRYEEDSMSKSMMASNNHCFVIELLISNFNYFFPNQTTQFSSNIPPKVFPNNFRTKRQNSFNGHSSNDCAHIIHKINLTSSSVKNNPSTDNSTDSYVXXXXXXXXXXTQYPRRVSMDSSTPTEMSTSVTKSLATTPTGKKSTDFRNGTVFPSCLYRRRVSDGTLSNLKNCNNDNFIGXXXXXXXXXXXXXXXXXXXXXXAKSSNDCEDFLDTRSFLTSVLDTDSLEPPTNSQSAKYVPKSFHADVYDTLFALQSLNSYAASTDDYLTRVRSVYERRILSKPSDKAQTPLVRRQTINTSTNEDPMSKSVTNDSSIKYFDDQNLTSKTSIIRRPKPVINIKLKNYRESSPANXXXXXXXXXXXXXXXXAHFKQVKCETKPFNKLSLEADDSRAAASSLIRYSMPILPAKGINN 2968
            MLINKFLRNDKNIEAPSNWPDNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSISTSVLNSSLNCVSNSNTQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSSGLYNNCISSTNTIRKKLRSVSNANQMMKKQSGNIIDSTKNGNSVDSNGLLSIGDSMRNGKLNYRYEEDSMSKSMMASNNHCFVIELLISNFNYFFPNQTTQFSSNIPPKVFPNNFRTKRQNSFNGHSSNDCAHIIHKINLTSSSVKNNPSTDNSTDSYVNNSLQQSSLSTQYPRRVSMDSSTPTEMSTSVTKSLATTPTGKKSTDFRNGTVFPSCLYRRRVSDGTLSNLKNCNNDNFIGSLDISDLPDIDSSCIDDCQSSSAKSSNDCEDFLDTRSFLTSVLDTDSLEPP NSQSAKYVPKSFHADVYDTLFALQSLNSYAASTDDYL RVRSVYERRILSKPSDKAQTPLVRRQTINTSTNEDPMSKSVTNDSSIKY DDQNLTSKTSIIRRPKPVINIKLKNYRESSPANIQTLSSDSIDQIDSTIAHFKQVKCETKPFNKLSLEADDSRAAASSLIRYSMPILPAKGINN
Sbjct:    1 MLINKFLRNDKNIEAPSNWPDNIKKIEQEALEFKKISQDVTKRLLLCPIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLSADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEELVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQNPSVQSASPMLSEPSISTSVLNSSLNCVSNSNTQNGQLSSSHENSKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSSGLYNNCISSTNTIRKKLRSVSNANQMMKKQSGNIIDSTKNGNSVDSNGLLSIGDSMRNGKLNYRYEEDSMSKSMMASNNHCFVIELLISNFNYFFPNQTTQFSSNIPPKVFPNNFRTKRQNSFNGHSSNDCAHIIHKINLTSSSVKNNPSTDNSTDSYVNNSLQQSSLSTQYPRRVSMDSSTPTEMSTSVTKSLATTPTGKKSTDFRNGTVFPSCLYRRRVSDGTLSNLKNCNNDNFIGSLDISDLPDIDSSCIDDCQSSSAKSSNDCEDFLDTRSFLTSVLDTDSLEPPNNSQSAKYVPKSFHADVYDTLFALQSLNSYAASTDDYLNRVRSVYERRILSKPSDKAQTPLVRRQTINTSTNEDPMSKSVTNDSSIKYIDDQNLTSKTSIIRRPKPVINIKLKNYRESSPANIQTLSSDSIDQIDSTIAHFKQVKCETKPFNKLSLEADDSRAAASSLIRYSMPILPAKGINN 959          
BLAST of Rho GTPase activating protein 44 vs. Planmine SMEST
Match: SMESG000073994.1 (SMESG000073994.1)

HSP 1 Score: 176.022 bits (445), Expect = 3.955e-45
Identity = 94/243 (38.68%), Postives = 142/243 (58.44%), Query Frame = 2
Query:  815 SKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANNPIP-VFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEK-IIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRA---VNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            SKL   ++  +  E + +  +DL L + +  ES  I +++  L   +    Y+ +C   + + +PEL+  I +N    VF   L +H+ ++ R ++Y LE C+R LDN E+L EEGLFRI+G KNKV+ L +A NV + +  I+K  D  V A  LKQYLR LP PL+T  L+D W      + N + E   S +K CLS +P+ Y +NL YL+ FL K+S     NKM+ +NL ++ GPNL+
Sbjct:  192 SKLVNAQLAEENNEKEFELKRDLYLSKLFCLESEKIIVAEKMLEFFKEHLEYYIECKNILTKCIPELQLIIEDNKKNFVFHLSLEEHIASTNRKLSYVLETCIRELDNEESLQEEGLFRISGSKNKVELLKNALNVMRADDYILKSCDSSVFAGVLKQYLRELPIPLMTFQLYDKWCEVGSKIKNNDVEGAKSQIKECLSLMPICYLDNLVYLMEFLKKISLNEYVNKMSSSNLALMLGPNLI 434          
BLAST of Rho GTPase activating protein 44 vs. Planmine SMEST
Match: SMESG000073994.1 (SMESG000073994.1)

HSP 1 Score: 175.637 bits (444), Expect = 4.024e-45
Identity = 94/243 (38.68%), Postives = 142/243 (58.44%), Query Frame = 2
Query:  815 SKLNQLKVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANNPIP-VFGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEK-IIKQYDHFVIADCLKQYLRSLPEPLLTHHLFDDWMRA---VNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLL 1528
            SKL   ++  +  E + +  +DL L + +  ES  I +++  L   +    Y+ +C   + + +PEL+  I +N    VF   L +H+ ++ R ++Y LE C+R LDN E+L EEGLFRI+G KNKV+ L +A NV + +  I+K  D  V A  LKQYLR LP PL+T  L+D W      + N + E   S +K CLS +P+ Y +NL YL+ FL K+S     NKM+ +NL ++ GPNL+
Sbjct:  190 SKLVNAQLAEENNEKEFELKRDLYLSKLFCLESEKIIVAEKMLEFFKEHLEYYIECKNILTKCIPELQLIIEDNKKNFVFHLSLEEHIASTNRKLSYVLETCIRELDNEESLQEEGLFRISGSKNKVELLKNALNVMRADDYILKSCDSSVFAGVLKQYLRELPIPLMTFQLYDKWCEVGSKIKNNDVEGAKSQIKECLSLMPICYLDNLVYLMEFLKKISLNEYVNKMSSSNLALMLGPNLI 432          
BLAST of Rho GTPase activating protein 44 vs. Planmine SMEST
Match: SMESG000025126.1 (SMESG000025126.1)

HSP 1 Score: 139.428 bits (350), Expect = 1.503e-34
Identity = 80/248 (32.26%), Postives = 134/248 (54.03%), Query Frame = 2
Query:  833 KVTRDEL---ESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQCLRTIGQVLPELESSIANNPIPV-FGRELSQHLLTSRRHIAYTLEVCVRHLDNPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQYLRSLPEPLL---THHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLSYLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSSGL 1555
            ++ RD++   ++  D+L +L L+  + +E++    ++    ++     YH++C +++ ++LP+  S +     PV FG  L  HL  ++R IAY LE CV+ L +   L +EGLFR++G  NK + L S  N+ K E +  ++   V+AD LK+YLR +P  LL    H  ++         N++     +K  L +LP +Y+ NL YLI FL  V      N M   N+ +VF PNL  + ++S GL
Sbjct:  173 QLMRDQIINAQNDCDNLTELYLQRVFAYEAATFQNAEVLHEIIILRTEYHEKCAKSLMKILPQCNSYMEEKRSPVSFGTPLENHLRETKRFIAYPLEYCVKALSDVNLLQQEGLFRVSGSMNKANLLCSILNLMKTEYVSIEWPPHVVADALKRYLREMPVSLLGKINHSEWETCFEMSKKDNKQGSYQKIKELLGQLPKSYYQNLEYLIRFLNLVVREKSYNLMGIQNICMVFVPNLFKSSATSLGL 420          
The following BLAST results are available for this feature:
BLAST of Rho GTPase activating protein 44 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGAP441.296e-4930.41Rho GTPase activating protein 44 [Source:HGNC Symb... [more]
ARHGAP443.197e-4930.41Rho GTPase activating protein 44 [Source:HGNC Symb... [more]
ARHGAP444.330e-4930.41Rho GTPase activating protein 44 [Source:HGNC Symb... [more]
ARHGAP446.027e-4930.41Rho GTPase activating protein 44 [Source:HGNC Symb... [more]
ARHGAP172.870e-3937.34Rho GTPase activating protein 17 [Source:HGNC Symb... [more]
back to top
BLAST of Rho GTPase activating protein 44 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rga-88.838e-2634.00Rho GTPase Activating protein [Source:UniProtKB/T... [more]
rga-89.382e-2634.00Rho GTPase Activating protein [Source:UniProtKB/T... [more]
rga-89.511e-2634.00Rho GTPase Activating protein [Source:UniProtKB/T... [more]
rga-89.524e-2634.00Rho GTPase Activating protein [Source:UniProtKB/T... [more]
rga-89.712e-2634.00Rho GTPase Activating protein [Source:UniProtKB/T... [more]
back to top
BLAST of Rho GTPase activating protein 44 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RhoGAP92B2.092e-2736.27gene:FBgn0038747 transcript:FBtr0344352[more]
RhoGAP92B2.395e-2736.27gene:FBgn0038747 transcript:FBtr0344353[more]
RhoGAP92B3.371e-2736.27gene:FBgn0038747 transcript:FBtr0344351[more]
RhoGAP92B3.471e-2736.27gene:FBgn0038747 transcript:FBtr0083821[more]
RhoGAP92B3.471e-2736.27gene:FBgn0038747 transcript:FBtr0344354[more]
back to top
BLAST of Rho GTPase activating protein 44 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX005094.17.978e-4829.87si:ch211-114m9.1 [Source:NCBI gene;Acc:567298][more]
si:ch211-114m9.19.184e-4829.87si:ch211-114m9.1 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
si:ch211-114m9.19.184e-4829.87si:ch211-114m9.1 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
arhgap441.270e-4731.53Rho GTPase activating protein 44 [Source:ZFIN;Acc:... [more]
arhgap17b3.003e-4729.27Rho GTPase activating protein 17b [Source:ZFIN;Acc... [more]
back to top
BLAST of Rho GTPase activating protein 44 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tlx25.296e-4438.33T cell leukemia, homeobox 2 [Source:Xenbase;Acc:XB... [more]
ARHGAP172.167e-4338.59Rho GTPase activating protein 17 [Source:NCBI gene... [more]
ARHGAP174.747e-4338.59Rho GTPase activating protein 17 [Source:NCBI gene... [more]
ARHGAP174.770e-4338.59Rho GTPase activating protein 17 [Source:NCBI gene... [more]
ARHGAP175.315e-4338.59Rho GTPase activating protein 17 [Source:NCBI gene... [more]
back to top
BLAST of Rho GTPase activating protein 44 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arhgap442.128e-5030.62Rho GTPase activating protein 44 [Source:MGI Symbo... [more]
Arhgap444.449e-5030.62Rho GTPase activating protein 44 [Source:MGI Symbo... [more]
Arhgap449.699e-4438.84Rho GTPase activating protein 44 [Source:MGI Symbo... [more]
Arhgap171.346e-3937.34Rho GTPase activating protein 17 [Source:MGI Symbo... [more]
Arhgap171.421e-3936.59Rho GTPase activating protein 17 [Source:MGI Symbo... [more]
back to top
BLAST of Rho GTPase activating protein 44 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5SSM3|RHG44_MOUSE3.112e-4930.62Rho GTPase-activating protein 44 OS=Mus musculus O... [more]
sp|F1LQX4|RHG44_RAT1.078e-4830.41Rho GTPase-activating protein 44 OS=Rattus norvegi... [more]
sp|Q17R89|RHG44_HUMAN2.894e-4830.41Rho GTPase-activating protein 44 OS=Homo sapiens O... [more]
sp|D3ZFJ3|3BP1_RAT3.029e-4031.18SH3 domain-binding protein 1 OS=Rattus norvegicus ... [more]
sp|Q68EM7|RHG17_HUMAN1.684e-3837.45Rho GTPase-activating protein 17 OS=Homo sapiens O... [more]
back to top
BLAST of Rho GTPase activating protein 44 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EQM27.299e-6831.97Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0V0J4W21.595e-6736.56Rho-GAP domain-containing protein OS=Schistocephal... [more]
A0A0X3Q5101.539e-6636.56Rho GTPase-activating protein 17 OS=Schistocephalu... [more]
A0A5K3ES841.334e-6534.03Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158QD399.925e-6534.27Rho-GAP domain-containing protein OS=Hymenolepis d... [more]
back to top
BLAST of Rho GTPase activating protein 44 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-114m9.11.130e-4529.87si:ch211-114m9.1 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
ARHGAP177.191e-4530.07Rho GTPase activating protein 17 [Source:NCBI gene... [more]
ARHGAP172.266e-4430.07Rho GTPase activating protein 17 [Source:NCBI gene... [more]
si:ch211-114m9.11.538e-3937.39si:ch211-114m9.1 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
si:ch211-114m9.17.962e-3937.34si:ch211-114m9.1 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
back to top
BLAST of Rho GTPase activating protein 44 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007074.13.428e-2031.02pep scaffold:Pmarinus_7.0:GL479940:7219:11207:1 ge... [more]
chn21.528e-1828.80chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
arhgap51.591e-1732.22Rho GTPase activating protein 5 [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000008956.11.625e-1735.25pep scaffold:Pmarinus_7.0:GL484257:7565:13095:-1 g... [more]
chn24.475e-1730.10chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
back to top
BLAST of Rho GTPase activating protein 44 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RGA11.003e-1427.51GTPase-activating protein for polarity-establishme... [more]
BEM21.757e-1232.05Rho GTPase activating protein (RhoGAP); involved i... [more]
RGA22.622e-727.56GTPase-activating protein for polarity-establishme... [more]
LRG11.571e-627.48GTPase-activating protein (GAP); contains Rho1p-sp... [more]
BEM38.597e-630.38Rho GTPase activating protein (RhoGAP); involved i... [more]
back to top
BLAST of Rho GTPase activating protein 44 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO479954.561e-4135.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421761.107e-1626.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490532.141e-1634.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314066.981e-1632.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474411.542e-1532.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho GTPase activating protein 44 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-114m9.12.714e-4732.36rho GTPase-activating protein 44 [Source:NCBI gene... [more]
ENSORLT00000015714.24.816e-4729.22rho GTPase-activating protein 44 [Source:NCBI gene... [more]
ENSORLT00000028184.11.110e-4530.92rho GTPase-activating protein 44 [Source:NCBI gene... [more]
ENSORLT00000015713.21.278e-4530.92rho GTPase-activating protein 44 [Source:NCBI gene... [more]
si:ch211-114m9.11.655e-4432.27rho GTPase-activating protein 44 [Source:NCBI gene... [more]
back to top
BLAST of Rho GTPase activating protein 44 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068429.10.000e+099.69SMESG000068429.1[more]
SMESG000068429.10.000e+099.69SMESG000068429.1[more]
SMESG000073994.13.955e-4538.68SMESG000073994.1[more]
SMESG000073994.14.024e-4538.68SMESG000073994.1[more]
SMESG000025126.11.503e-3432.26SMESG000025126.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019877 ID=SMED30019877|Name=Rho GTPase activating protein 44|organism=Schmidtea mediterranea sexual|type=transcript|length=3484bp
CTTCCGATCTTAATTATAAATGCTTTTCTTTGGTTTGTTATTTTAATTTA
TTTTGTCATCTGAGAAGTGGATATTCATTCAGATGAAACATATGTTAATT
AATAAGTTTTTAAGAAATGATAAAAACATTGAAGCTCCATCAAATTGGCC
CGATAATATTAAAAAAATAGAACAAGAAGCATTAGAGTTTAAAAAGATAT
CTCAAGATGTCACCAAACGACTTTTATTATGCCCTATTTTTATTGGATGT
TGTCATAATAATTCTTTAGTTGGATCAACGGGAAATGTTTGGAATCAAAA
TTGGTCGAAAACACCTATTGATTCTGATAAAATTTCGAAAAAACTACCTG
AACAAAATTTAGCTCAATCTTTTCTTCTCTCAGCCGACAGATTATCAGTA
CTTAATCCTCATGTTTCAAAGTTATTTTCAATGCTTGGAGAAACGAACAA
TAAGCTAGCAATCGAAAGACTTAATTGGGCTGCAAATGTGGAAAATAATG
TCTTAGAAAAGCTTCGAATCTGTTATGAAGAACTTGTTCCTTCATTAGTT
AAAAGTCGGCGTCATTTGTGGAAGCAGAATTCTGATCTCAAAGTTCTTCA
AGATAGATTAAAATCTTTAGAAAGTAATGCATATGTTCTAAGTCCAAATA
GTCCAATCTTGCCTCATAATTCTCATCTTCAAAATCCATCAGTACAATCC
GCGAGTCCTATGCTTTCTGAGCCATCAATTTCGACTAGTGTTCTCAATTC
GTCTCTCAATTGTGTTTCGAACTCTAATACTCAGAATGGTCAATTGTCCT
CATCTCATGAGAATTCCAAATTGAATCAGCTTAAAGTGACCAGAGATGAA
CTCGAGAGTCAAATTGACCATTTAAAAGACTTGTCTCTTCGAGAACATTA
CAGATTCGAAAGCTCTGTGATCGATATATCTAAAACATTTCTTAATCTTT
TACGCAACGAAGCCAATTATCATCAACAATGTCTAAGAACAATTGGACAA
GTATTACCAGAATTAGAATCATCAATAGCTAATAATCCCATCCCAGTTTT
TGGCAGAGAATTGAGTCAACATTTGCTTACATCGAGGAGACATATCGCCT
ATACTCTGGAAGTATGCGTTAGGCATTTAGACAATCCTGAAACTCTATGT
GAAGAGGGCTTATTCAGAATTGCTGGAGGCAAAAACAAAGTCGATACTTT
ATCAAGCGCCTTTAACGTTTTCAAAGTCGAGAAAATCATCAAACAATACG
ATCATTTTGTGATCGCCGACTGCTTGAAACAATATCTCCGATCTCTGCCC
GAGCCGCTCCTGACCCATCATTTGTTTGATGATTGGATGAGGGCTGTTAA
TAATCCAAATGAAGAGAGTCGTCTTTCTGCAATGAAAATGTGCCTGAGCA
AGCTGCCTGTGGCATATTTCAATAATCTCAGTTATTTGATAGGATTTCTG
GCGAAAGTATCCACATATAGTGATAAAAATAAAATGACTCCTGCCAATCT
TGGAATTGTATTTGGACCGAATTTATTGTCGGCAGACAGCTCATCGAGTG
GACTTTATAACAATTGCATAAGTTCTACGAACACAATCAGGAAAAAATTG
CGAAGTGTGTCCAATGCCAATCAAATGATGAAAAAGCAATCCGGTAATAT
CATTGATAGCACTAAAAATGGCAATTCTGTAGATAGCAATGGGTTGTTAT
CAATTGGTGATTCAATGCGAAATGGGAAACTAAATTACCGATATGAAGAG
GATAGCATGTCCAAATCTATGATGGCATCAAATAATCACTGTTTCGTCAT
TGAACTTCTTATTAGCAATTTCAACTATTTCTTTCCAAACCAGACAACCC
AATTTTCTTCAAACATTCCACCGAAGGTCTTTCCAAATAACTTTCGAACG
AAACGCCAAAACAGTTTTAATGGTCACAGTTCAAATGATTGTGCACATAT
AATACATAAAATAAATTTAACATCATCCTCAGTGAAAAATAATCCTTCTA
CTGACAACAGTACTGATTCATATGTAAATAACTCTCTACAACAATCTTCT
TTATCTACCCAATATCCTCGTCGAGTATCAATGGATTCCTCAACGCCTAC
TGAAATGTCGACTTCTGTTACTAAATCTTTAGCAACTACTCCTACGGGTA
AAAAATCCACAGATTTTCGAAATGGAACTGTATTTCCATCATGTCTCTAT
CGGCGGCGTGTTAGTGATGGGACATTAAGCAATTTAAAAAATTGTAACAA
TGACAACTTTATCGGAAGTCTTGATATCAGTGATCTGCCCGATATCGACT
CTTCCTGCATTGACGACTGTCAATCATCATCGGCTAAAAGCAGCAACGAC
TGCGAAGATTTTTTGGATACTCGATCATTTTTAACATCTGTTTTGGACAC
AGACAGTTTAGAACCACCAACCAATTCTCAAAGTGCCAAATATGTTCCAA
AATCGTTTCATGCGGATGTATACGATACATTATTTGCATTACAGAGTCTC
AATTCTTATGCAGCATCGACGGATGATTATTTGACTCGAGTTCGTTCAGT
CTATGAAAGACGAATCCTATCTAAACCATCTGACAAGGCACAGACACCTC
TCGTCAGACGTCAAACGATAAATACCTCCACGAACGAAGATCCAATGTCC
AAATCAGTAACGAATGATTCATCCATAAAGTATTTCGATGATCAGAATCT
CACATCAAAAACCTCCATTATCAGACGGCCTAAGCCAGTTATCAATATCA
AATTAAAAAATTATCGAGAGAGCTCTCCAGCCAACATTCAAACCTTGTCC
AGCGATAGTATTGATCAAATTGACAGCACAATAGCACATTTCAAACAAGT
TAAATGTGAGACCAAACCTTTCAACAAATTATCCCTAGAAGCAGATGATA
GCAGAGCAGCTGCCAGTTCTCTTATACGATATTCCATGCCAATATTGCCA
GCTAAAGGAATAAATAATTGATTGGTATCGAAATTATGTGGAAATTCGTT
CTTTATCATCTATATATTCCTTTGATAAGAAATTTTATTATTTATTGTTA
TTATTAAAAAATTCTGATGCATTTTAATATTTACCTAACAGATAATTTTT
GATTAAATATTAATTGTCAGATTGTGAGATATTTATTTGTTATTATTGTA
ATTTAGTATCAACCGATCCTTTCTATACCCTTGTAATAAATCTATTTATT
TCCAATTTTATTATTATATCAAATCGTCCGAAACTGCATTATCCATTCAT
GTGATTAGTGATGTAAGATTATGTTGAATGTCAATTGACGTGTGTGCGTG
TGTGTGCTTGCGTGTGTGTCTGAATTTTTGGAACTTTTCCTTTGATTTTT
TAGCCGATTCCATTACTGATCAATAGATGGATTTATTATTATTTTTCATC
ACTTATAGATTTGTGCAATTCCATGAGTCAATATATTGTCGTTATATTGA
TGAATAAATGACGGTAATGACATAATGTAAAAAA
back to top

protein sequence of SMED30019877-orf-1

>SMED30019877-orf-1 ID=SMED30019877-orf-1|Name=SMED30019877-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=963bp
MKHMLINKFLRNDKNIEAPSNWPDNIKKIEQEALEFKKISQDVTKRLLLC
PIFIGCCHNNSLVGSTGNVWNQNWSKTPIDSDKISKKLPEQNLAQSFLLS
ADRLSVLNPHVSKLFSMLGETNNKLAIERLNWAANVENNVLEKLRICYEE
LVPSLVKSRRHLWKQNSDLKVLQDRLKSLESNAYVLSPNSPILPHNSHLQ
NPSVQSASPMLSEPSISTSVLNSSLNCVSNSNTQNGQLSSSHENSKLNQL
KVTRDELESQIDHLKDLSLREHYRFESSVIDISKTFLNLLRNEANYHQQC
LRTIGQVLPELESSIANNPIPVFGRELSQHLLTSRRHIAYTLEVCVRHLD
NPETLCEEGLFRIAGGKNKVDTLSSAFNVFKVEKIIKQYDHFVIADCLKQ
YLRSLPEPLLTHHLFDDWMRAVNNPNEESRLSAMKMCLSKLPVAYFNNLS
YLIGFLAKVSTYSDKNKMTPANLGIVFGPNLLSADSSSSGLYNNCISSTN
TIRKKLRSVSNANQMMKKQSGNIIDSTKNGNSVDSNGLLSIGDSMRNGKL
NYRYEEDSMSKSMMASNNHCFVIELLISNFNYFFPNQTTQFSSNIPPKVF
PNNFRTKRQNSFNGHSSNDCAHIIHKINLTSSSVKNNPSTDNSTDSYVNN
SLQQSSLSTQYPRRVSMDSSTPTEMSTSVTKSLATTPTGKKSTDFRNGTV
FPSCLYRRRVSDGTLSNLKNCNNDNFIGSLDISDLPDIDSSCIDDCQSSS
AKSSNDCEDFLDTRSFLTSVLDTDSLEPPTNSQSAKYVPKSFHADVYDTL
FALQSLNSYAASTDDYLTRVRSVYERRILSKPSDKAQTPLVRRQTINTST
NEDPMSKSVTNDSSIKYFDDQNLTSKTSIIRRPKPVINIKLKNYRESSPA
NIQTLSSDSIDQIDSTIAHFKQVKCETKPFNKLSLEADDSRAAASSLIRY
SMPILPAKGINN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000198RhoGAP_dom
IPR027267AH/BAR_dom_sf
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 162..182
NoneNo IPR availableCOILSCoilCoilcoord: 247..267
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 632..691
NoneNo IPR availablePANTHERPTHR141303BP-1 RELATED RHOGAPcoord: 79..491
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 336..581
e-value: 2.0E-44
score: 163.6
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 342..487
e-value: 1.8E-40
score: 138.2
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 325..524
score: 35.393
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 317..521
e-value: 9.9E-48
score: 164.1
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 321..490
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 21..312