Regulator of G-protein signaling

Overview
NameRegulator of G-protein signaling
Smed IDSMED30019876
Length (bp)1841
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulator of G-protein signaling (SMED30019876) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulator of G-protein signaling (SMED30019876) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulator of G-protein signaling (SMED30019876) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulator of G-protein signaling (SMED30019876) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019876

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019876h1SMcG0014866 SmedASXL_009323SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019876h1SMcG0014866 dd_Smed_v4_8463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019876h1SMcG0014866 dd_Smed_v4_8463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30019876h1SMcG0014866 dd_Smed_v4_8463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30019876h1SMcG0014866 dd_Smed_v4_8463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019876h1SMcG0014866 dd_Smed_v4_8463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019876h1SMcG0014866 dd_Smed_v4_8463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019876h1SMcG0014866 dd_Smed_v6_8463_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019876h1SMcG0014866 OX_Smed_1.0.09430ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulator of G-protein signaling vs. Ensembl Human
Match: RGS3 (regulator of G protein signaling 3 [Source:HGNC Symbol;Acc:HGNC:9999])

HSP 1 Score: 140.584 bits (353), Expect = 5.101e-38
Identity = 72/188 (38.30%), Postives = 111/188 (59.04%), Query Frame = 1
Query: 1000 DMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNL 1563
            DM+ KL  FR++     + P      A ++  +  +F              P+ E+ L W +S E +L  ++G+ +F  FLR+EFS+ENLEFW  C+ ++ +K   K+  KA +IF +Y+A Q+ KE+NLDS TR  T  ++   T+  FD +QK+I  LMEKDSY RFLRS+++  L++Q  +SP L
Sbjct:   24 DMKNKLGIFRRRNESPGAPP------AGKADKMMKSFK-------------PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL 192          
BLAST of Regulator of G-protein signaling vs. Ensembl Human
Match: RGS3 (regulator of G protein signaling 3 [Source:HGNC Symbol;Acc:HGNC:9999])

HSP 1 Score: 139.043 bits (349), Expect = 1.105e-37
Identity = 63/137 (45.99%), Postives = 94/137 (68.61%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNL 1563
            P+ E+ L W +S E +L  ++G+ +F  FLR+EFS+ENLEFW  C+ ++ +K   K+  KA +IF +Y+A Q+ KE+NLDS TR  T  ++   T+  FD +QK+I  LMEKDSY RFLRS+++  L++Q  +SP L
Sbjct:   32 PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL 168          
BLAST of Regulator of G-protein signaling vs. Ensembl Human
Match: RGS3 (regulator of G protein signaling 3 [Source:HGNC Symbol;Acc:HGNC:9999])

HSP 1 Score: 147.517 bits (371), Expect = 2.156e-37
Identity = 73/197 (37.06%), Postives = 117/197 (59.39%), Query Frame = 1
Query:  973 RKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNL 1563
            ++K +++  DM+ KL  FR++     + P      A ++  +  +F              P+ E+ L W +S E +L  ++G+ +F  FLR+EFS+ENLEFW  C+ ++ +K   K+  KA +IF +Y+A Q+ KE+NLDS TR  T  ++   T+  FD +QK+I  LMEKDSY RFLRS+++  L++Q  +SP L
Sbjct:  342 KRKSKNLAKDMKNKLGIFRRRNESPGAPP------AGKADKMMKSFK-------------PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL 519          
BLAST of Regulator of G-protein signaling vs. Ensembl Human
Match: RGS3 (regulator of G protein signaling 3 [Source:HGNC Symbol;Acc:HGNC:9999])

HSP 1 Score: 147.517 bits (371), Expect = 2.156e-37
Identity = 73/197 (37.06%), Postives = 117/197 (59.39%), Query Frame = 1
Query:  973 RKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNL 1563
            ++K +++  DM+ KL  FR++     + P      A ++  +  +F              P+ E+ L W +S E +L  ++G+ +F  FLR+EFS+ENLEFW  C+ ++ +K   K+  KA +IF +Y+A Q+ KE+NLDS TR  T  ++   T+  FD +QK+I  LMEKDSY RFLRS+++  L++Q  +SP L
Sbjct:  342 KRKSKNLAKDMKNKLGIFRRRNESPGAPP------AGKADKMMKSFK-------------PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL 519          
BLAST of Regulator of G-protein signaling vs. Ensembl Human
Match: RGS3 (regulator of G protein signaling 3 [Source:HGNC Symbol;Acc:HGNC:9999])

HSP 1 Score: 142.51 bits (358), Expect = 2.781e-37
Identity = 71/188 (37.77%), Postives = 107/188 (56.91%), Query Frame = 1
Query: 1000 DMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNL 1563
            DM+ KL  FR++     + P        +S                     P+ E+ L W +S E +L  ++G+ +F  FLR+EFS+ENLEFW  C+ ++ +K   K+  KA +IF +Y+A Q+ KE+NLDS TR  T  ++   T+  FD +QK+I  LMEKDSY RFLRS+++  L++Q  +SP L
Sbjct:  143 DMKNKLGIFRRRNESPGAPPAGKADKMMKSFK-------------------PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL 311          
BLAST of Regulator of G-protein signaling vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 125.176 bits (313), Expect = 2.770e-33
Identity = 63/158 (39.87%), Postives = 97/158 (61.39%), Query Frame = 1
Query: 1078 ANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNI 1551
              RSS +  +  +  +N  +  +G P+ E V  WSQSFEN++  + G   F EFL+ E+SDEN+ FW  C+  +  K  +K++EKA  I+ED+++  SPKE++LDS  R    T++   +  TFD++Q +I  LM++DSY RFL S I+ T+M    I
Sbjct:    2 GGRSSTIIGSVSVEKKN--QENDGPPTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTVMGTFGI 157          
BLAST of Regulator of G-protein signaling vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 124.405 bits (311), Expect = 6.346e-33
Identity = 59/136 (43.38%), Postives = 88/136 (64.71%), Query Frame = 1
Query: 1144 NGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNI 1551
            +G P+ E V  WSQSFEN++  + G   F EFL+ E+SDEN+ FW  C+  +  K  +K++EKA  I+ED+++  SPKE++LDS  R    T++   +  TFD++Q +I  LM++DSY RFL S I+ T+M    I
Sbjct:   27 DGPPTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTVMGTFGI 162          
BLAST of Regulator of G-protein signaling vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 124.79 bits (312), Expect = 8.155e-33
Identity = 59/136 (43.38%), Postives = 88/136 (64.71%), Query Frame = 1
Query: 1144 NGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNI 1551
            +G P+ E V  WSQSFEN++  + G   F EFL+ E+SDEN+ FW  C+  +  K  +K++EKA  I+ED+++  SPKE++LDS  R    T++   +  TFD++Q +I  LM++DSY RFL S I+ T+M    I
Sbjct:   41 DGPPTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTVMGTFGI 176          
BLAST of Regulator of G-protein signaling vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 123.635 bits (309), Expect = 1.514e-32
Identity = 59/136 (43.38%), Postives = 88/136 (64.71%), Query Frame = 1
Query: 1144 NGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNI 1551
            +G P+ E V  WSQSFEN++  + G   F EFL+ E+SDEN+ FW  C+  +  K  +K++EKA  I+ED+++  SPKE++LDS  R    T++   +  TFD++Q +I  LM++DSY RFL S I+ T+M    I
Sbjct:   29 DGPPTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTVMGTFGI 164          
BLAST of Regulator of G-protein signaling vs. Ensembl Celegans
Match: rgs-7 (Regulator of G-protein signaling rgs-7 [Source:UniProtKB/Swiss-Prot;Acc:Q8WQC0])

HSP 1 Score: 110.538 bits (275), Expect = 3.893e-27
Identity = 54/117 (46.15%), Postives = 78/117 (66.67%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKK-LQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATK-QTFDQSQKKIQALMEKDSY 1497
            PSR+ V  W  SFE++L ++ G  LF +FL+ EFSDEN++FW EC+ ++ +K  KK   +KA +I+ ++VAE SPKE+NLDS TR  T   +    K  TF  +Q +++ LM KDSY
Sbjct:   92 PSRDDVRQWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLECEEFKKMKDGKKSTTQKAIEIYSEFVAEHSPKEVNLDSDTRAATKAAVEAGCKPDTFALAQSRVEQLMSKDSY 208          
BLAST of Regulator of G-protein signaling vs. Ensembl Fly
Match: Dhit (gene:FBgn0028743 transcript:FBtr0340279)

HSP 1 Score: 114.39 bits (285), Expect = 4.442e-28
Identity = 58/140 (41.43%), Postives = 88/140 (62.86%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNLTGK 1572
            P+ E++ SW +SF+ ++    G  +F  FLRSEFS+EN+ FW  C+  +    P+ ++EKA  I+EDY++  SP+E++LDS  R     ++I  T  TFD++Q +I  LM +DSY RFL S+ F TL +QL  + N   K
Sbjct:  128 PTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL-AQLQDNSNAGSK 266          
BLAST of Regulator of G-protein signaling vs. Ensembl Fly
Match: Dhit (gene:FBgn0028743 transcript:FBtr0301142)

HSP 1 Score: 114.39 bits (285), Expect = 4.884e-28
Identity = 58/140 (41.43%), Postives = 88/140 (62.86%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNLTGK 1572
            P+ E++ SW +SF+ ++    G  +F  FLRSEFS+EN+ FW  C+  +    P+ ++EKA  I+EDY++  SP+E++LDS  R     ++I  T  TFD++Q +I  LM +DSY RFL S+ F TL +QL  + N   K
Sbjct:  131 PTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL-AQLQDNSNAGSK 269          
BLAST of Regulator of G-protein signaling vs. Ensembl Fly
Match: loco (gene:FBgn0020278 transcript:FBtr0084276)

HSP 1 Score: 105.916 bits (263), Expect = 2.248e-23
Identity = 51/131 (38.93%), Postives = 78/131 (59.54%), Query Frame = 1
Query: 1144 NGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            +GCPS     SW+ SFE +L D  G+  F EFL+ EFS EN+ FW+ C+ YR ++       +A +IF  ++A  S   +N+DS  R  T   +  A    F  +QK+I +LM+ DSYQRF+RS+++ + +
Sbjct:  106 HGCPS-----SWAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRVAQAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDSYQRFIRSDLYKSCV 231          
BLAST of Regulator of G-protein signaling vs. Ensembl Fly
Match: loco (gene:FBgn0020278 transcript:FBtr0304669)

HSP 1 Score: 105.531 bits (262), Expect = 2.482e-23
Identity = 51/131 (38.93%), Postives = 78/131 (59.54%), Query Frame = 1
Query: 1144 NGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            +GCPS     SW+ SFE +L D  G+  F EFL+ EFS EN+ FW+ C+ YR ++       +A +IF  ++A  S   +N+DS  R  T   +  A    F  +QK+I +LM+ DSYQRF+RS+++ + +
Sbjct:   59 HGCPS-----SWAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRVAQAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDSYQRFIRSDLYKSCV 184          
BLAST of Regulator of G-protein signaling vs. Ensembl Fly
Match: loco (gene:FBgn0020278 transcript:FBtr0084275)

HSP 1 Score: 105.916 bits (263), Expect = 2.572e-23
Identity = 51/131 (38.93%), Postives = 78/131 (59.54%), Query Frame = 1
Query: 1144 NGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            +GCPS     SW+ SFE +L D  G+  F EFL+ EFS EN+ FW+ C+ YR ++       +A +IF  ++A  S   +N+DS  R  T   +  A    F  +QK+I +LM+ DSYQRF+RS+++ + +
Sbjct:  452 HGCPS-----SWAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRVAQAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDSYQRFIRSDLYKSCV 577          
BLAST of Regulator of G-protein signaling vs. Ensembl Zebrafish
Match: RGS13 (si:ch211-117l17.5 [Source:ZFIN;Acc:ZDB-GENE-110914-230])

HSP 1 Score: 130.568 bits (327), Expect = 1.167e-34
Identity = 66/156 (42.31%), Postives = 97/156 (62.18%), Query Frame = 1
Query: 1078 ANRSSLVSPNFMINLENVWKATNGCPSR---EQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
              R+  +  N M  L++++ A +  P R   E    WSQS E +L  ++G+  F  FL+SEFSDEN+EFW  C+ Y++I    K+  KA +IFE +V  +SPKEIN+D  TR +    +   T Q FD++QK +  LME+DSY RFLRSE++ +L+
Sbjct:   19 CRRNKTLGKNLMCRLKSMF-AGSSVPERLSLEDTQQWSQSLERLLGSKYGLATFRTFLKSEFSDENIEFWLTCEDYKTITSSHKMSSKARKIFEQFVEAESPKEINIDYQTREEIKRKMKSPTAQCFDEAQKIVYGLMERDSYPRFLRSEMYKSLL 173          
BLAST of Regulator of G-protein signaling vs. Ensembl Zebrafish
Match: BX936311.1 (si:ch211-117l17.5 [Source:NCBI gene;Acc:792554])

HSP 1 Score: 129.028 bits (323), Expect = 2.473e-34
Identity = 64/147 (43.54%), Postives = 94/147 (63.95%), Query Frame = 1
Query: 1105 NFMINLENVWKATNGCPSR---EQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            N M  L++++  ++  P R   E    WSQS E +L  ++G+  F  FL+SEFSDEN+EFW  C+ Y++I    K+  KA +IFE +V  +SPKEIN+D  TR +    +   T Q FD++QK +  LME+DSY RFLRSE++ +L+
Sbjct:   14 NLMCRLKSMFAGSSA-PERLSLEDTQQWSQSLERLLGSKYGLATFRTFLKSEFSDENIEFWLTCEDYKTITSSHKMSSKARKIFEQFVEAESPKEINIDYQTREEIKRKMKSPTAQCFDEAQKIVYGLMERDSYPRFLRSEMYKSLL 159          
BLAST of Regulator of G-protein signaling vs. Ensembl Zebrafish
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 128.642 bits (322), Expect = 4.054e-34
Identity = 66/180 (36.67%), Postives = 104/180 (57.78%), Query Frame = 1
Query: 1003 MREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQ 1542
            M+ +L F R++     S P S                  L+   K+    P+ E+ + W +S + +L  ++G+  F  FLR+EFS+ENL+FW  C+ Y+ IK   K+  KA +IF +++A QS KE+NLDS TR  T  ++ +  +  F+ +Q++I  LMEKDSY RFLRSE++  L++Q
Sbjct:    1 MKNRLAFLRRRNESPGSTPASK-----------------LDKTMKSVK--PTPEEAMKWGESLDKLLVHKYGLAAFRAFLRTEFSEENLDFWLACEDYKKIKSQSKMTSKAKKIFAEFIAIQSCKEVNLDSYTREHTKENLQNINRSCFELAQRRIYGLMEKDSYPRFLRSELYMDLVNQ 161          
BLAST of Regulator of G-protein signaling vs. Ensembl Zebrafish
Match: RGS13 (si:ch211-117l17.5 [Source:ZFIN;Acc:ZDB-GENE-110914-230])

HSP 1 Score: 126.716 bits (317), Expect = 1.328e-33
Identity = 64/145 (44.14%), Postives = 93/145 (64.14%), Query Frame = 1
Query: 1111 MINLENVWKATNGCPSR---EQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            M  L++++ A +  P R   E    WSQS E +L  ++G+  F  FL+SEFSDEN+EFW  C+ Y++I    K+  KA +IFE +V  +SPKEIN+D  TR +    +   T Q FD++QK +  LME+DSY RFLRSE++ +L+
Sbjct:    1 MCRLKSMF-AGSSVPERLSLEDTQQWSQSLERLLGSKYGLATFRTFLKSEFSDENIEFWLTCEDYKTITSSHKMSSKARKIFEQFVEAESPKEINIDYQTREEIKRKMKSPTAQCFDEAQKIVYGLMERDSYPRFLRSEMYKSLL 144          
BLAST of Regulator of G-protein signaling vs. Ensembl Zebrafish
Match: rgs13 (regulator of G protein signaling 13 [Source:ZFIN;Acc:ZDB-GENE-070410-138])

HSP 1 Score: 124.02 bits (310), Expect = 1.643e-32
Identity = 57/138 (41.30%), Postives = 90/138 (65.22%), Query Frame = 1
Query: 1150 CPSREQV-----LSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLN 1548
            CP  E++       WSQS EN+L  ++G+  F  FL+SEFSDEN+EFW  C+ ++  +   +L  +A +IFE Y+  ++PKEIN+D VTR     ++   TK  FD++Q+ +  LME+DSY RFLRS+++ +L+  ++
Sbjct:   31 CPLTEKINPGETSQWSQSLENLLRSKYGMATFHTFLKSEFSDENIEFWLVCEDFKKTRSLSRLSSRAKKIFERYIKAEAPKEINIDHVTRELIKQNVHAPTKVCFDEAQRIVFGLMERDSYPRFLRSDMYRSLLESVS 168          
BLAST of Regulator of G-protein signaling vs. Ensembl Xenopus
Match: nhlrc3 (NHL repeat containing 3 [Source:Xenbase;Acc:XB-GENE-988782])

HSP 1 Score: 132.109 bits (331), Expect = 2.495e-34
Identity = 56/126 (44.44%), Postives = 95/126 (75.40%), Query Frame = 1
Query: 1159 REQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            +++V  W++S EN++ ++ G+  F  FL+SE+S+EN++FW  C+ Y+ +K P+KL EKA +I+ED+++ ++ +E+NLDS TR +T+ +II  T  TFD++Q +I  LMEKDSY+RFL+S+ +  L+
Sbjct:   92 QDEVKKWAESLENLINNECGLAAFRAFLQSEYSEENIDFWLACENYKKVKTPEKLLEKAQKIYEDFISVEATREVNLDSATREETSNNIIQPTHSTFDEAQHRIFILMEKDSYRRFLKSKFYLDLV 217          
BLAST of Regulator of G-protein signaling vs. Ensembl Xenopus
Match: sppl2b (signal peptide peptidase like 2B [Source:Xenbase;Acc:XB-GENE-958186])

HSP 1 Score: 131.339 bits (329), Expect = 3.393e-33
Identity = 60/128 (46.88%), Postives = 89/128 (69.53%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            PS + V SW +S EN+L   +G  LF  FL+SEFSDENL+FW  C+ Y+       L  +A +I++ Y+A QSPKE+NLD+ TR  T  +++  T+ TFD++Q++I  LME+DSY RFLRS+++ +L+
Sbjct:  196 PSIDDVTSWGKSLENLLSHTYGRALFRVFLQSEFSDENLDFWLACEEYKDTHPNFILHSRARKIYQLYIALQSPKEVNLDASTREMTEHNLLIPTRTTFDEAQRRIYGLMERDSYPRFLRSDLYQSLL 323          
BLAST of Regulator of G-protein signaling vs. Ensembl Xenopus
Match: cipc (CLOCK-interacting pacemaker [Source:Xenbase;Acc:XB-GENE-5806252])

HSP 1 Score: 127.102 bits (318), Expect = 6.885e-33
Identity = 57/132 (43.18%), Postives = 90/132 (68.18%), Query Frame = 1
Query: 1162 EQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISP 1557
            ++   W++SF+ +L  ++G T+F  FL++EFS+ENLEFW  C+ YR  +   KL  KA  IF++++  Q+P+E+NLD  TR  T  +++H T   FD +Q +I +LME+DSY RFLRS++++ L+S    SP
Sbjct:   84 DEARRWARSFDLLLSHKYGRTMFRAFLQTEFSEENLEFWVACEEYRKTRSLNKLPAKAHHIFQEFIDVQAPREVNLDYPTRELTKRNLLHPTLSCFDLAQLRIHSLMERDSYPRFLRSKMYNDLLSHTQKSP 215          
BLAST of Regulator of G-protein signaling vs. Ensembl Xenopus
Match: cipc (CLOCK-interacting pacemaker [Source:Xenbase;Acc:XB-GENE-5806252])

HSP 1 Score: 125.561 bits (314), Expect = 8.749e-33
Identity = 57/127 (44.88%), Postives = 88/127 (69.29%), Query Frame = 1
Query: 1177 WSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISP 1557
            W++SF+ +L  ++G T+F  FL++EFS+ENLEFW  C+ YR  +   KL  KA  IF++++  Q+P+E+NLD  TR  T  +++H T   FD +Q +I +LME+DSY RFLRS++++ L+S    SP
Sbjct:   49 WARSFDLLLSHKYGRTMFRAFLQTEFSEENLEFWVACEEYRKTRSLNKLPAKAHHIFQEFIDVQAPREVNLDYPTRELTKRNLLHPTLSCFDLAQLRIHSLMERDSYPRFLRSKMYNDLLSHTQKSP 175          
BLAST of Regulator of G-protein signaling vs. Ensembl Xenopus
Match: rgs18 (regulator of G-protein signaling 18 [Source:NCBI gene;Acc:493454])

HSP 1 Score: 116.701 bits (291), Expect = 6.091e-29
Identity = 54/126 (42.86%), Postives = 81/126 (64.29%), Query Frame = 1
Query: 1162 EQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMS 1539
            E+ + W +SF+ +L  + GI  F +FL+ EFSDENLEFW EC+ Y+  +  K++ +KA  ++E Y+   SP+E+NLD  T+  T   I      +FD +Q KI +LMEKDSY RFL+S ++   +S
Sbjct:   76 EEAMKWGESFDKLLSHKDGIEAFKKFLKMEFSDENLEFWLECEEYKKCQTNKQMDDKAKSLYEKYIQMDSPREVNLDFATKEMTKKSIEQPELTSFDLAQTKIYSLMEKDSYPRFLKSSVYSNSLS 201          
BLAST of Regulator of G-protein signaling vs. Ensembl Mouse
Match: Rgs3 (regulator of G-protein signaling 3 [Source:MGI Symbol;Acc:MGI:1354734])

HSP 1 Score: 143.665 bits (361), Expect = 2.631e-39
Identity = 74/188 (39.36%), Postives = 111/188 (59.04%), Query Frame = 1
Query: 1000 DMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNL 1563
            DM+ KL  FR++     +QP S T    +S                     P+ E+ L WS+S E +L  ++G+ +F  FLR+EFS+ENLEFW  C+ ++ +K   K+  KA +IF +++A Q+ KE+NLDS TR  T  ++   T+  FD +QK+I  LMEKDSY RFLRS+++  L++Q  +SP L
Sbjct:   24 DMKNKLAIFRRRNESPGAQPASKTDKTTKSFK-------------------PTSEEALKWSESLEKLLLHKYGLEVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIAIQACKEVNLDSYTREHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL 192          
BLAST of Regulator of G-protein signaling vs. Ensembl Mouse
Match: Rgs3 (regulator of G-protein signaling 3 [Source:MGI Symbol;Acc:MGI:1354734])

HSP 1 Score: 151.754 bits (382), Expect = 8.226e-39
Identity = 77/197 (39.09%), Postives = 119/197 (60.41%), Query Frame = 1
Query:  973 RKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNL 1563
            ++K ++I  DM+ KL  FR++     +QP S T    +S              +K     P+ E+ L WS+S E +L  ++G+ +F  FLR+EFS+ENLEFW  C+ ++ +K   K+  KA +IF +++A Q+ KE+NLDS TR  T  ++   T+  FD +QK+I  LMEKDSY RFLRS+++  L++Q  +SP L
Sbjct:  391 KRKSKNIAKDMKNKLAIFRRRNESPGAQPASKTDKTTKS--------------FK-----PTSEEALKWSESLEKLLLHKYGLEVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIAIQACKEVNLDSYTREHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL 568          
BLAST of Regulator of G-protein signaling vs. Ensembl Mouse
Match: Rgs3 (regulator of G-protein signaling 3 [Source:MGI Symbol;Acc:MGI:1354734])

HSP 1 Score: 151.369 bits (381), Expect = 7.280e-38
Identity = 77/197 (39.09%), Postives = 119/197 (60.41%), Query Frame = 1
Query:  973 RKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNL 1563
            ++K ++I  DM+ KL  FR++     +QP S T    +S              +K     P+ E+ L WS+S E +L  ++G+ +F  FLR+EFS+ENLEFW  C+ ++ +K   K+  KA +IF +++A Q+ KE+NLDS TR  T  ++   T+  FD +QK+I  LMEKDSY RFLRS+++  L++Q  +SP L
Sbjct:  789 KRKSKNIAKDMKNKLAIFRRRNESPGAQPASKTDKTTKS--------------FK-----PTSEEALKWSESLEKLLLHKYGLEVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIAIQACKEVNLDSYTREHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL 966          
BLAST of Regulator of G-protein signaling vs. Ensembl Mouse
Match: Rgs5 (regulator of G-protein signaling 5 [Source:MGI Symbol;Acc:MGI:1098434])

HSP 1 Score: 134.42 bits (337), Expect = 5.178e-36
Identity = 60/128 (46.88%), Postives = 90/128 (70.31%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            PS E+VL W QS + +L + +G   F  FL+SEFS+ENLEFW  C+ Y+ IK P K+ EKA QI+E+++  ++PKE+N+D  T+  T  +++  + ++FD +QK+I ALMEKDS  RF+RSE +  L+
Sbjct:   53 PSLEEVLQWRQSLDKLLQNSYGFASFKSFLKSEFSEENLEFWVACENYKKIKSPIKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSPRSFDLAQKRIYALMEKDSLPRFVRSEFYKELI 180          
BLAST of Regulator of G-protein signaling vs. Ensembl Mouse
Match: Rgs4 (regulator of G-protein signaling 4 [Source:MGI Symbol;Acc:MGI:108409])

HSP 1 Score: 129.413 bits (324), Expect = 5.280e-34
Identity = 65/178 (36.52%), Postives = 111/178 (62.36%), Query Frame = 1
Query: 1000 DMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTL 1533
            DM+ +L F    Q  +S + +S+ +  ++        ++  + V        S+E+V  W++S EN+++ + G+  F  FL+SE+S+EN++FW  C+ Y+ IK P KL  KA +I+ ++++ Q+ KE+NLDS TR +T+ +++  T   FD++QKKI  LMEKDSY+RFL+S  +  L
Sbjct:   18 DMKHRLGFLL--QKSDSCEHSSSHSKKDK--------VVTCQRV--------SQEEVKKWAESLENLIHHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLQPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDL 177          
BLAST of Regulator of G-protein signaling vs. UniProt/SwissProt
Match: sp|Q9DC04|RGS3_MOUSE (Regulator of G-protein signaling 3 OS=Mus musculus OX=10090 GN=Rgs3 PE=1 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 5.092e-37
Identity = 77/197 (39.09%), Postives = 119/197 (60.41%), Query Frame = 1
Query:  973 RKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNL 1563
            ++K ++I  DM+ KL  FR++     +QP S T    +S              +K     P+ E+ L WS+S E +L  ++G+ +F  FLR+EFS+ENLEFW  C+ ++ +K   K+  KA +IF +++A Q+ KE+NLDS TR  T  ++   T+  FD +QK+I  LMEKDSY RFLRS+++  L++Q  +SP L
Sbjct:  789 KRKSKNIAKDMKNKLAIFRRRNESPGAQPASKTDKTTKS--------------FK-----PTSEEALKWSESLEKLLLHKYGLEVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIAIQACKEVNLDSYTREHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL 966          
BLAST of Regulator of G-protein signaling vs. UniProt/SwissProt
Match: sp|P49797|RGS3_RAT (Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2)

HSP 1 Score: 149.443 bits (376), Expect = 2.200e-36
Identity = 75/203 (36.95%), Postives = 122/203 (60.10%), Query Frame = 1
Query:  955 NIKLEMRKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNL 1563
            +++   ++K ++I  DM+ KL  FR++     +QP      A ++   + +F              P+ E+ L WS+S E +L  ++G+ +F  FLR+EFS+ENLEFW  C+ ++ +K   K+  KA +IF +++A Q+ KE+NLDS TR  T  ++   T+  FD +QK+I  LMEKDSY RFLRS+++  L++Q  +SP L
Sbjct:  784 DVEASRKRKSKNIAKDMKNKLAIFRRRNESPGAQP------AGKADKTTKSFK-------------PTSEEALKWSESLEKLLLHKYGLEVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIAIQACKEVNLDSYTREHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL 967          
BLAST of Regulator of G-protein signaling vs. UniProt/SwissProt
Match: sp|P49796|RGS3_HUMAN (Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 2.037e-35
Identity = 73/197 (37.06%), Postives = 117/197 (59.39%), Query Frame = 1
Query:  973 RKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNL 1563
            ++K +++  DM+ KL  FR++     + P      A ++  +  +F              P+ E+ L W +S E +L  ++G+ +F  FLR+EFS+ENLEFW  C+ ++ +K   K+  KA +IF +Y+A Q+ KE+NLDS TR  T  ++   T+  FD +QK+I  LMEKDSY RFLRS+++  L++Q  +SP L
Sbjct: 1021 KRKSKNLAKDMKNKLGIFRRRNESPGAPP------AGKADKMMKSFK-------------PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL 1198          
BLAST of Regulator of G-protein signaling vs. UniProt/SwissProt
Match: sp|O08850|RGS5_MOUSE (Regulator of G-protein signaling 5 OS=Mus musculus OX=10090 GN=Rgs5 PE=2 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 3.622e-35
Identity = 60/128 (46.88%), Postives = 90/128 (70.31%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            PS E+VL W QS + +L + +G   F  FL+SEFS+ENLEFW  C+ Y+ IK P K+ EKA QI+E+++  ++PKE+N+D  T+  T  +++  + ++FD +QK+I ALMEKDS  RF+RSE +  L+
Sbjct:   53 PSLEEVLQWRQSLDKLLQNSYGFASFKSFLKSEFSEENLEFWVACENYKKIKSPIKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSPRSFDLAQKRIYALMEKDSLPRFVRSEFYKELI 180          
BLAST of Regulator of G-protein signaling vs. UniProt/SwissProt
Match: sp|P49800|RGS5_RAT (Regulator of G-protein signaling 5 OS=Rattus norvegicus OX=10116 GN=Rgs5 PE=2 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 5.853e-35
Identity = 60/128 (46.88%), Postives = 88/128 (68.75%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            PS E+VL W QS + +L   +G   F  FL+SEFS+ENLEFW  C+ Y+ IK P K+ EKA QI+E+++  ++PKE+N+D  T+  T  +++  +  +FD +QK+I ALMEKDS  RF+RSE +  L+
Sbjct:   53 PSLEEVLQWRQSLDKLLQSNYGFASFKSFLKSEFSEENLEFWVACENYKKIKSPIKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSPHSFDLAQKRIYALMEKDSLPRFVRSEFYKELI 180          
BLAST of Regulator of G-protein signaling vs. TrEMBL
Match: A0A419PEA9 (Regulator of G-protein signaling 3 (Fragment) OS=Clonorchis sinensis OX=79923 GN=Rgs3 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.945e-42
Identity = 100/242 (41.32%), Postives = 138/242 (57.02%), Query Frame = 1
Query: 1105 NFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM------SQLNISPNLTG-KLSHTNSVP------TESLS-TRVSYIPGLLPKVTTVSKLNQTRTNTNPNLXXXXXXXXXXXXGDYGHRSAPSSPKNMTA 1788
            N+ + L  ++++    P+  +V  WSQSF ++L+D+ GI +F EFLR+EFSDEN+EFW  C+ +R+    KKLQ +A +IF ++VA Q+ +E+NLDS TR+Q   D+   TK TFDQSQK+IQALMEKDSY RFLRSE++   +        L   PN  G  L      P      TES   ++ S +PGLLP+V    K+  + T                   + G  SAPSSPK   A
Sbjct:   26 NYRVILNKIFRS--HWPTPREVELWSQSFSHVLHDKSGILVFREFLRTEFSDENIEFWLICEDFRNSVGSKKLQTRAQKIFNEFVAAQAKREVNLDSSTRLQLEKDMDSVTKNTFDQSQKRIQALMEKDSYSRFLRSELYSATLELSREQEALRNQPNRLGLDLRALRLGPVSFRKTTESTEYSKDSAVPGLLPQVKPPRKMAGSSTQ-----------------HETGSHSAPSSPKQQRA 248          
BLAST of Regulator of G-protein signaling vs. TrEMBL
Match: G4V7M9 (Putative regulator of G protein signaling OS=Schistosoma mansoni OX=6183 GN=Smp_069400 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 4.689e-42
Identity = 86/198 (43.43%), Postives = 131/198 (66.16%), Query Frame = 1
Query:  985 RSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNI-SPNLTGKL 1575
            R+IGV  R+K+      +  +S+ P S  T      +V  N  + LE ++++  G P+RE V  W++SFE++L D++G+ +F EFLR+EFSDEN+ FW  C+ YR+    K +Q KA +IF +YVA Q+ +E+NLDS TR+QT  ++  A K TFDQ Q+++Q+LMEKDSY+RFLRS+++ T +    I   N++ KL
Sbjct:    4 RAIGV--RDKITTL--CRSASSALPQSCAT-----DIVISNHRVFLEKLFRS--GGPTREDVEDWARSFESVLRDKYGVLVFREFLRTEFSDENIRFWLICEDYRNKSGTKNMQRKAFKIFNEYVAVQAAREVNLDSNTRLQTERELASANKNTFDQCQRRVQSLMEKDSYRRFLRSDLYLTAVELSRIRECNMSNKL 190          
BLAST of Regulator of G-protein signaling vs. TrEMBL
Match: A0A183R1Q5 (RGS domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 7.262e-42
Identity = 77/162 (47.53%), Postives = 115/162 (70.99%), Query Frame = 1
Query: 1093 LVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISP-NLTGKL 1575
            +V  N  + LE ++++  G P+RE V  W++SFE++L D++G+ +F EFLR+EFSDEN+ FW  C+ YR+    K +Q KA +IF +YVA Q+ +E+NLDS TR+QT  ++  A K TFDQ Q++IQ+LMEKDSY+RFLRS+++ T +    I   N++ KL
Sbjct:   27 IVISNHRVFLEKLFRS--GGPTREDVEDWARSFESVLRDKYGVLVFREFLRTEFSDENIRFWLICEDYRNKSGTKNMQRKAFKIFNEYVAVQAAREVNLDSNTRLQTERELASANKNTFDQCQRRIQSLMEKDSYRRFLRSDLYLTAVELSRIRECNMSNKL 186          
BLAST of Regulator of G-protein signaling vs. TrEMBL
Match: A0A074ZJC6 (RGS domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_05540 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.004e-41
Identity = 74/132 (56.06%), Postives = 98/132 (74.24%), Query Frame = 1
Query: 1147 GCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQ 1542
            G PS EQ+ SW  SFE +L D+ G+ LF +FL +EFSDEN+EFW  CQ Y+ I  PKKL  +A QIF+ +VA Q+ +E+NLDS TR++T  +I + T  T D +QK+IQALMEKDSY+RFLRSE++ TL S+
Sbjct:   11 GKPSYEQIHSWRNSFETLLNDRFGLALFKDFLSTEFSDENIEFWIACQEYKKITNPKKLAARAQQIFDQFVAVQAVREVNLDSKTRLETEAEIANPTVHTLDNAQKRIQALMEKDSYRRFLRSEVYLTLYSE 142          
BLAST of Regulator of G-protein signaling vs. TrEMBL
Match: A0A4Z2D301 (Regulator of G-protein signaling 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_004999 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.102e-41
Identity = 91/208 (43.75%), Postives = 135/208 (64.90%), Query Frame = 1
Query:  961 KLEMRKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTL--MSQLNISPNLTGKLS 1578
            +LE +  K +IGV  R+K+    +     + QP S       + L+S N  I LE ++++  G P+RE V  W+ SFE++L D++G+ +F EFLR EFSDEN+ FW  C+ YR+    K +Q KA +IF +YVA Q+ +E+NLDS TR+QT  ++  A K TFDQ Q++IQ+LMEKDSY+RFLRS+++ T   MS++    N+  K+S
Sbjct:  298 RLERKFSKLAIGV--RDKITTLCRASSSVTPQPYS-------TDLLSTNHRIFLEKLFRS--GGPTRENVEDWAHSFESVLRDKYGVLVFREFLRKEFSDENIRFWLICEDYRNKSSTKNIQRKALKIFNEYVAVQAAREVNLDSKTRLQTEKELESANKNTFDQCQRRIQSLMEKDSYRRFLRSDLYLTTLEMSKVKEECNMANKIS 494          
BLAST of Regulator of G-protein signaling vs. Ensembl Cavefish
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 140.584 bits (353), Expect = 1.753e-38
Identity = 71/184 (38.59%), Postives = 106/184 (57.61%), Query Frame = 1
Query:  991 IGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQ 1542
            +  DM+ +L F R++     S P        +SS+                   P+ E+ L W +S + +L  ++G+  F  FLR+EFS+ENLEFW  C+ Y+ IK   K+  KA +IF +Y+A QS KE+NLDS TR  T  ++ + T+  FD +Q++I  LMEKDSY RFLRSE++  L++Q
Sbjct:    1 MAKDMKNRLAFLRRRNESPGSTPAGKLDKTMKSSVK------------------PTPEEALKWGESLDKLLVHKYGLAAFRAFLRTEFSEENLEFWLACEDYKKIKSQSKMASKAKKIFAEYIAIQSCKEVNLDSYTREHTKENLQNITRSCFDLAQRRIYGLMEKDSYPRFLRSELYMDLVNQ 166          
BLAST of Regulator of G-protein signaling vs. Ensembl Cavefish
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 139.813 bits (351), Expect = 6.023e-38
Identity = 71/181 (39.23%), Postives = 105/181 (58.01%), Query Frame = 1
Query: 1000 DMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQ 1542
            DM+ +L F R++     S P        +SS+                   P+ E+ L W +S + +L  ++G+  F  FLR+EFS+ENLEFW  C+ Y+ IK   K+  KA +IF +Y+A QS KE+NLDS TR  T  ++ + T+  FD +Q++I  LMEKDSY RFLRSE++  L++Q
Sbjct:   18 DMKNRLAFLRRRNESPGSTPAGKLDKTMKSSVK------------------PTPEEALKWGESLDKLLVHKYGLAAFRAFLRTEFSEENLEFWLACEDYKKIKSQSKMASKAKKIFAEYIAIQSCKEVNLDSYTREHTKENLQNITRSCFDLAQRRIYGLMEKDSYPRFLRSELYMDLVNQ 180          
BLAST of Regulator of G-protein signaling vs. Ensembl Cavefish
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 143.665 bits (361), Expect = 1.889e-36
Identity = 71/184 (38.59%), Postives = 106/184 (57.61%), Query Frame = 1
Query:  991 IGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQ 1542
            +  DM+ +L F R++     S P        +SS+                   P+ E+ L W +S + +L  ++G+  F  FLR+EFS+ENLEFW  C+ Y+ IK   K+  KA +IF +Y+A QS KE+NLDS TR  T  ++ + T+  FD +Q++I  LMEKDSY RFLRSE++  L++Q
Sbjct:  334 LAKDMKNRLAFLRRRNESPGSTPAGKLDKTMKSSVK------------------PTPEEALKWGESLDKLLVHKYGLAAFRAFLRTEFSEENLEFWLACEDYKKIKSQSKMASKAKKIFAEYIAIQSCKEVNLDSYTREHTKENLQNITRSCFDLAQRRIYGLMEKDSYPRFLRSELYMDLVNQ 499          
BLAST of Regulator of G-protein signaling vs. Ensembl Cavefish
Match: si:ch211-117l17.5 (regulator of G-protein signaling 21 [Source:NCBI gene;Acc:103043037])

HSP 1 Score: 134.806 bits (338), Expect = 2.796e-36
Identity = 66/159 (41.51%), Postives = 100/159 (62.89%), Query Frame = 1
Query: 1084 RSSLVSPNFMINLENVWKATNGCPSR---EQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNI 1551
            RS  +  NFM  L+ ++  ++   SR   E    W+QS E +L  ++G+  F  FL+SEFSDEN+EFW  C+ Y+ I+   ++  +A +I+E +V  +SPKEIN+D  TR Q   ++   T Q FD++QK +  LME+DSY RFLRSE++ TL+  L +
Sbjct:   22 RSKNLGKNFMCRLQCMFSRSSAPESRLSLEDTQQWAQSLERLLESKYGLATFRTFLKSEFSDENIEFWLTCEDYKKIRSSFRMTSRAKKIYEQFVKAESPKEINIDYHTREQIKRNVKSPTAQCFDEAQKIVYGLMERDSYPRFLRSEMYRTLLDSLAV 180          
BLAST of Regulator of G-protein signaling vs. Ensembl Cavefish
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 143.28 bits (360), Expect = 4.917e-36
Identity = 71/184 (38.59%), Postives = 106/184 (57.61%), Query Frame = 1
Query:  991 IGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQ 1542
            +  DM+ +L F R++     S P        +SS+                   P+ E+ L W +S + +L  ++G+  F  FLR+EFS+ENLEFW  C+ Y+ IK   K+  KA +IF +Y+A QS KE+NLDS TR  T  ++ + T+  FD +Q++I  LMEKDSY RFLRSE++  L++Q
Sbjct:  381 LAKDMKNRLAFLRRRNESPGSTPAGKLDKTMKSSVK------------------PTPEEALKWGESLDKLLVHKYGLAAFRAFLRTEFSEENLEFWLACEDYKKIKSQSKMASKAKKIFAEYIAIQSCKEVNLDSYTREHTKENLQNITRSCFDLAQRRIYGLMEKDSYPRFLRSELYMDLVNQ 546          
BLAST of Regulator of G-protein signaling vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006812.1 (pep scaffold:Pmarinus_7.0:GL476397:246833:248901:1 gene:ENSPMAG00000006145.1 transcript:ENSPMAT00000006812.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.954 bits (328), Expect = 7.119e-36
Identity = 59/127 (46.46%), Postives = 86/127 (67.72%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTL 1533
            PS+++  +W++S + +L  ++G+  F  FLR+EFS+EN+ FW  C+ Y+  K   KL  KA +IF +Y+A QSP E+NLDS TR  TA ++   T   FD +QK+I  LMEKDSY RFLRS+++  L
Sbjct:   27 PSQDEAHAWAESLDKLLVHKYGLAAFQAFLRTEFSEENINFWLACEDYKKTKSAAKLTSKARKIFSEYIAIQSPNEVNLDSCTRELTAANLAKPTADAFDVAQKRIFGLMEKDSYPRFLRSQLYLDL 153          
BLAST of Regulator of G-protein signaling vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008960.1 (pep scaffold:Pmarinus_7.0:GL487232:48:5367:1 gene:ENSPMAG00000008102.1 transcript:ENSPMAT00000008960.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.716 bits (317), Expect = 4.933e-34
Identity = 67/178 (37.64%), Postives = 105/178 (58.99%), Query Frame = 1
Query: 1003 MREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAY-RSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTL 1533
            M+ +L F R++  + S  P +++ A  + S                    PS E  + WS+SFE +L  ++G+  F  FL++EFS+EN++FW  C+ + RS +   KL  K+ +I E+++A QSPKE+NLDS TR  T  ++   T  + D +QK+I  LME+DSY RFLRS+++H L
Sbjct:   19 MKSRLGFLRRKP-DPSDIPAASSPALGKHSR-------------------PSCEDAMKWSESFEKLLAHKYGLAAFRAFLKTEFSEENIDFWLACEDFKRSARSTSKLVSKSKKISEEFIAIQSPKEVNLDSSTREVTMANLQKPTVTSLDLAQKRIYGLMERDSYPRFLRSDLYHDL 176          
BLAST of Regulator of G-protein signaling vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008468.1 (pep scaffold:Pmarinus_7.0:GL476656:335513:340095:-1 gene:ENSPMAG00000007670.1 transcript:ENSPMAT00000008468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.316 bits (290), Expect = 3.957e-30
Identity = 57/137 (41.61%), Postives = 85/137 (62.04%), Query Frame = 1
Query: 1135 KATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQL 1545
            K ++G PS E+V  W QSF+ ++    G   F EFLR+EFS+EN+ FW  C+  +     + ++EKA  I+EDY++  SPKE++LDS  R     +++  T  TFD +Q +I  LM +DSY RFL S+I+ +L   L
Sbjct:   63 KDSSGKPSMEEVQVWGQSFDKLIRSTGGRNTFREFLRTEFSEENMLFWLACEDLKREANKRAVEEKARVIYEDYISILSPKEVSLDSRVREVINRNMLEPTSHTFDDAQLQIYTLMHRDSYPRFLNSQIYKSLQDSL 199          
BLAST of Regulator of G-protein signaling vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005413.1 (pep scaffold:Pmarinus_7.0:GL501287:7893:12072:-1 gene:ENSPMAG00000004924.1 transcript:ENSPMAT00000005413.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 7.333e-29
Identity = 51/126 (40.48%), Postives = 80/126 (63.49%), Query Frame = 1
Query: 1156 SREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTL 1533
            S ++  +WS+S + +L  ++G   FL FLR+EFS+ENLEFW  C+ ++ +K   K   +A +I+  ++A  +PKE+NLD +TR  T   +  A    F+ +QK+I  LME+DSY RFL S ++  L
Sbjct:    6 SVKEARAWSESLDRLLSHKYGRVAFLAFLRTEFSEENLEFWLACEEFKRMKAESKRLAQARKIYSQFIANHAPKEVNLDCLTRDATEAGLPGAAPGAFEPAQKRIYGLMERDSYPRFLLSPLYARL 131          
BLAST of Regulator of G-protein signaling vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003940.1 (pep scaffold:Pmarinus_7.0:GL476449:561747:569035:-1 gene:ENSPMAG00000003600.1 transcript:ENSPMAT00000003940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 5.507e-28
Identity = 53/127 (41.73%), Postives = 80/127 (62.99%), Query Frame = 1
Query: 1144 NGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIF 1524
            +G  S E+V SWS  FE +++   G  +F EFLR+EFS+ENL FW  C+  +  +    ++EKA  I+EDY++  SPKE++LDS  R     +++  +  TFD +Q +I  LM +DSY RFL S ++
Sbjct:   76 SGKLSLEEVTSWSHCFERLMHSAAGRAVFREFLRTEFSEENLLFWLACEDLKKEENKNIVEEKARTIYEDYISILSPKEVSLDSRVREVINRNMVEPSAHTFDDAQLQIYTLMHRDSYPRFLGSSVY 202          
BLAST of Regulator of G-protein signaling vs. Ensembl Nematostella
Match: EDO37370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFZ6])

HSP 1 Score: 100.908 bits (250), Expect = 6.161e-25
Identity = 51/127 (40.16%), Postives = 79/127 (62.20%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTL 1533
            PS E++  W +SFE +L  ++GI +F EFL+SE+S+ENL FW   +  +    P  ++  A  I+ DYV+ +SPKE+++D  TR     +I   TK+TF ++Q+ +  +M +D Y RFL S  F TL
Sbjct:   25 PSSEEINEWGRSFERLLSSKNGIRVFHEFLKSEYSEENLLFWLAVERLKKETEPASVKNLAQTIYNDYVSTESPKEVSIDHKTRQVIDDEISQPTKETFSKAQQHVYYVMYQDCYPRFLSSSTFKTL 151          
BLAST of Regulator of G-protein signaling vs. Ensembl Nematostella
Match: EDO32804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU35])

HSP 1 Score: 89.7373 bits (221), Expect = 6.199e-21
Identity = 43/128 (33.59%), Postives = 74/128 (57.81%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            P+ +++ +W   F  +L  ++G+  F EFLRS++ +ENL FW   + YR ++  +  ++ A  I+EDYV+  SP EI+LD+  R      +    + TFD +Q  I  LM  D + RF++S+ +  L+
Sbjct:   34 PTIDEMKNWKHDFHALLSSKYGVNQFQEFLRSQYGEENLCFWLAVEDYRRLEDRESRRDMARMIYEDYVSTLSPTEISLDAKIRATVDKSMSDPDQNTFDPAQDHIYTLMYHDCFPRFIKSKHYKNLI 161          
BLAST of Regulator of G-protein signaling vs. Ensembl Nematostella
Match: EDO43126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZM8])

HSP 1 Score: 96.2857 bits (238), Expect = 1.328e-20
Identity = 45/127 (35.43%), Postives = 77/127 (60.63%), Query Frame = 1
Query: 1165 QVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIF-HTLMSQ 1542
            +V  W+  F+ ++ DQ G+  F EFL+ EFS+EN+ FW  C+ +RSI  PKKL+  A+ IFE +++  +   +N+DS         +++ T   +   Q+++  LM+ DSY RFL+S+++   LM +
Sbjct:  650 RVSRWALGFDKLMDDQAGLHCFEEFLKKEFSEENIVFWIACEEFRSISDPKKLKSAASTIFETHLSPNALMPVNIDSSAVKVAEEHLLNPTNHMYRVPQQQVYTLMKFDSYPRFLKSDLYRQCLMCE 776          
BLAST of Regulator of G-protein signaling vs. Ensembl Nematostella
Match: EDO34351 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN2])

HSP 1 Score: 84.3445 bits (207), Expect = 2.025e-17
Identity = 46/124 (37.10%), Postives = 69/124 (55.65%), Query Frame = 1
Query: 1165 QVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            +V  W+ S   +L D  G   F  FL  EFS ENL FW  C+  ++    K++ EKA +I+ +Y++E S   IN+D  T  +   ++    +  FD +Q  I  LM+ DSY RFLRSE++  L+
Sbjct:  269 RVKRWAFSLSELLKDPLGRKYFTRFLEKEFSAENLAFWLACERLKATPI-KQVPEKAQEIYTEYLSEHSTSPINVDCKTHEEVEMNLEKPGRYMFDAAQDHIFQLMKSDSYSRFLRSELYKELL 391          
BLAST of Regulator of G-protein signaling vs. Ensembl Nematostella
Match: EDO44861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUI9])

HSP 1 Score: 53.9138 bits (128), Expect = 1.679e-7
Identity = 41/154 (26.62%), Postives = 73/154 (47.40%), Query Frame = 1
Query: 1177 WSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRS-IKCPKKLQEKATQIFEDYV-AEQSPKEINLDSVTRIQTATDIIH--ATKQTFDQSQKKIQALMEKDSYQRFLRSEIF------HTLMSQLNI---SPNLTGKLSHTNSVPT 1599
            W+ SF ++L D  G  LF ++LR E +   L+F  EC+AYR  +    +++  A  +F+ +V   Q  + + +   TR Q A  +    A    FD +  ++ + M+K  Y  F+ S ++      H     L +   +P   G+  H+  +PT
Sbjct:   90 WANSFTDLLNDSDGSNLFYKYLRREGASILLDFSRECEAYRRMVPTSTQMRTTAKTLFQKFVYPRQFCELLGVKDTTRTQIAHHVNDQPADPALFDGAYAEVVSYMKKCHYVGFVNSNLYKDFTQAHRDTETLTLGERTPQYPGRY-HSGYLPT 242          
BLAST of Regulator of G-protein signaling vs. Ensembl Medaka
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 145.206 bits (365), Expect = 7.199e-37
Identity = 74/190 (38.95%), Postives = 113/190 (59.47%), Query Frame = 1
Query:  973 RKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQ 1542
            +KK +++  DM+ +L F R++     S P      AN+           L+   K+    P+ E+ L W  S + +L  ++G+  F  FLR+EFS+ENLEFW  C+ Y+ IK   K+  KA +IF +Y+A QS KE+NLDS TR  T  ++ + T+  F+ +Q++I  LMEKDSY RFLRSE++  L++Q
Sbjct:  341 KKKSKNLAKDMKNRLAFLRRRNESPGSTP------ANK-----------LDKSMKSVK--PTPEEALKWGDSLDKLLAHKYGLAAFRAFLRTEFSEENLEFWLACEEYKKIKSQSKMASKAKKIFAEYIAIQSCKEVNLDSYTRDHTKDNLQNVTRSCFELAQRRIYGLMEKDSYPRFLRSELYSDLINQ 511          
BLAST of Regulator of G-protein signaling vs. Ensembl Medaka
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 145.206 bits (365), Expect = 7.237e-37
Identity = 74/190 (38.95%), Postives = 113/190 (59.47%), Query Frame = 1
Query:  973 RKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQ 1542
            +KK +++  DM+ +L F R++     S P      AN+           L+   K+    P+ E+ L W  S + +L  ++G+  F  FLR+EFS+ENLEFW  C+ Y+ IK   K+  KA +IF +Y+A QS KE+NLDS TR  T  ++ + T+  F+ +Q++I  LMEKDSY RFLRSE++  L++Q
Sbjct:  346 KKKSKNLAKDMKNRLAFLRRRNESPGSTP------ANK-----------LDKSMKSVK--PTPEEALKWGDSLDKLLAHKYGLAAFRAFLRTEFSEENLEFWLACEEYKKIKSQSKMASKAKKIFAEYIAIQSCKEVNLDSYTRDHTKDNLQNVTRSCFELAQRRIYGLMEKDSYPRFLRSELYSDLINQ 516          
BLAST of Regulator of G-protein signaling vs. Ensembl Medaka
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 144.436 bits (363), Expect = 2.759e-36
Identity = 74/190 (38.95%), Postives = 113/190 (59.47%), Query Frame = 1
Query:  973 RKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQ 1542
            +KK +++  DM+ +L F R++     S P      AN+           L+   K+    P+ E+ L W  S + +L  ++G+  F  FLR+EFS+ENLEFW  C+ Y+ IK   K+  KA +IF +Y+A QS KE+NLDS TR  T  ++ + T+  F+ +Q++I  LMEKDSY RFLRSE++  L++Q
Sbjct:  417 KKKSKNLAKDMKNRLAFLRRRNESPGSTP------ANK-----------LDKSMKSVK--PTPEEALKWGDSLDKLLAHKYGLAAFRAFLRTEFSEENLEFWLACEEYKKIKSQSKMASKAKKIFAEYIAIQSCKEVNLDSYTRDHTKDNLQNVTRSCFELAQRRIYGLMEKDSYPRFLRSELYSDLINQ 587          
BLAST of Regulator of G-protein signaling vs. Ensembl Medaka
Match: si:ch211-117l17.5 (regulator of G-protein signaling 21-like [Source:NCBI gene;Acc:111947375])

HSP 1 Score: 125.946 bits (315), Expect = 4.639e-33
Identity = 61/156 (39.10%), Postives = 96/156 (61.54%), Query Frame = 1
Query: 1078 ANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQL 1545
            + R+  +  NF+  L+ ++  T+   S +    WSQS E +L  ++G+  F  FL+SE SDEN+EFW  C+ Y+  +   ++  KA +I+E ++  +SPKEIN+D  TR Q   ++   T Q FD++QK +  LME+DSY RFLRS+I+  L+  L
Sbjct:   21 STRNRNMGKNFICRLQCMFSQTSSRLSLDDTQQWSQSLERLLESKYGLATFHNFLKSEHSDENIEFWLTCEDYKKSRSSYRMSSKAKKIYEQFIKAESPKEINIDYHTREQIKRNVKTPTTQCFDEAQKIVYGLMERDSYPRFLRSDIYRGLLESL 176          
BLAST of Regulator of G-protein signaling vs. Ensembl Medaka
Match: rgs5a (regulator of G-protein signaling 5 [Source:NCBI gene;Acc:101158097])

HSP 1 Score: 125.561 bits (314), Expect = 6.307e-33
Identity = 54/128 (42.19%), Postives = 87/128 (67.97%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            P+ E+   W +S + +L + +G+T F  FL+SEFSDEN+EFW  C+ ++  K P K+  KA +I+ED++  + P+E+N+D  T+  T  +++  +  TF+ +QK+I ALMEKDS+ RFLRSE +  L+
Sbjct:   54 PTHEEAAQWRESLDRVLNNNYGLTAFRSFLQSEFSDENIEFWMACEDFKKTKNPVKMAAKAKKIYEDFIQSEGPREVNIDHFTKDVTLRNLVDLSPSTFELAQKRIFALMEKDSFARFLRSEQYQELL 181          
BLAST of Regulator of G-protein signaling vs. Planmine SMEST
Match: SMESG000012254.1 (SMESG000012254.1)

HSP 1 Score: 993.416 bits (2567), Expect = 0.000e+0
Identity = 522/522 (100.00%), Postives = 522/522 (100.00%), Query Frame = 1
Query:  235 MDNDQIVASNVPVEYEETGPRYSESYLARVGRYNQIINRNSSFSANKSIDLNDASSDNDRIVIVAPIREFVEEDDKEAENTLIPGRFCQPESPTVSNSEFGDPSTTSDILSVTFDDIVIENHEIEVELKPPPTSQIITLQRQNSEEIEKNFGGLGPIKNTQIVKENVFNPTRPRTSGWAKLFASTLQRSKSTVTSEMTQNNQKTVKLRPGRKSEQPTXXXXXXXXXXXXXXXXXXXXXXANIKLEMRKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNLTGKLSHTNSVPTESLSTRVSYIPGLLPKVTTVSKLNQTRTNTNPNLXXXXXXXXXXXXGDYGHRSAPSSPKNMTASDSA 1800
            MDNDQIVASNVPVEYEETGPRYSESYLARVGRYNQIINRNSSFSANKSIDLNDASSDNDRIVIVAPIREFVEEDDKEAENTLIPGRFCQPESPTVSNSEFGDPSTTSDILSVTFDDIVIENHEIEVELKPPPTSQIITLQRQNSEEIEKNFGGLGPIKNTQIVKENVFNPTRPRTSGWAKLFASTLQRSKSTVTSEMTQNNQKTVKLRPGRKSEQPTTSVNSSISSSSTIQDSESSDSQANIKLEMRKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNLTGKLSHTNSVPTESLSTRVSYIPGLLPKVTTVSKLNQTRTNTNPNLISSIDISKSESSGDYGHRSAPSSPKNMTASDSA
Sbjct:    1 MDNDQIVASNVPVEYEETGPRYSESYLARVGRYNQIINRNSSFSANKSIDLNDASSDNDRIVIVAPIREFVEEDDKEAENTLIPGRFCQPESPTVSNSEFGDPSTTSDILSVTFDDIVIENHEIEVELKPPPTSQIITLQRQNSEEIEKNFGGLGPIKNTQIVKENVFNPTRPRTSGWAKLFASTLQRSKSTVTSEMTQNNQKTVKLRPGRKSEQPTTSVNSSISSSSTIQDSESSDSQANIKLEMRKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNLTGKLSHTNSVPTESLSTRVSYIPGLLPKVTTVSKLNQTRTNTNPNLISSIDISKSESSGDYGHRSAPSSPKNMTASDSA 522          
BLAST of Regulator of G-protein signaling vs. Planmine SMEST
Match: SMESG000011723.1 (SMESG000011723.1)

HSP 1 Score: 174.481 bits (441), Expect = 2.552e-47
Identity = 94/197 (47.72%), Postives = 128/197 (64.97%), Query Frame = 1
Query:  976 KKKRSIGVDMREKLNFFRKQQGENSSQPTSNTT---AANRSSLVSPNFMINLENVWKATN-------GCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            K+K  IG +++EK+  F KQ    S QP S+ +   + N SS   P    N+   ++  +       G  S EQ+  WS SFE +L+D++G+ LF EFLRSEFSDEN+EFW  C+ YR+I   KKLQ +A +I+ D+V  Q+ +E+NLDS TR QT  DI +    TFDQ+QK+IQALMEKDSYQRFLRSE++  L+
Sbjct:  227 KRKIGIGSEVKEKIASFWKQ----SDQPLSSASPSVSTNYSSCTMPTHSSNIPGGFQLKDMERLLRVGKSSIEQIKKWSNSFECLLHDKYGLALFHEFLRSEFSDENIEFWIACEEYRTITTNKKLQSRAEKIYNDFVGVQAAREVNLDSKTRQQTEIDIRNPNPHTFDQAQKRIQALMEKDSYQRFLRSELYGKLV 419          
BLAST of Regulator of G-protein signaling vs. Planmine SMEST
Match: SMESG000048981.1 (SMESG000048981.1)

HSP 1 Score: 159.458 bits (402), Expect = 1.026e-41
Identity = 81/187 (43.32%), Postives = 120/187 (64.17%), Query Frame = 1
Query:  991 IGVD-MREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVWKATN-GCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQL 1545
            IG+D M+EK NF RK  G+ +  P S+ T+A           I L+ + K    G    EQ+  W++SFE +L D++G+ LF ++L+SE+S+EN+EFW  C+ +++I  PKK+  +A +I +D+V  Q+PKE+N+DS TR  T   I H     FD +QK+IQ+LME DSYQRFLRSE++  LM  +
Sbjct:  293 IGIDEMKEKFNFLRKP-GDPAVPPLSDNTSAKS---------IRLKEIEKLVRMGKLLNEQIQRWNESFEQLLNDKYGLALFHDYLKSEYSEENIEFWIACEEFKTITNPKKMASRAQKIIKDFVTTQAPKEVNIDSKTRQITLESIQHPNANMFDMAQKRIQSLMEIDSYQRFLRSEMYQALMQDI 469          
BLAST of Regulator of G-protein signaling vs. Planmine SMEST
Match: SMESG000027589.1 (SMESG000027589.1)

HSP 1 Score: 146.362 bits (368), Expect = 1.045e-38
Identity = 92/284 (32.39%), Postives = 152/284 (53.52%), Query Frame = 1
Query:  754 RTSGWAKLFASTLQRSKSTVTSEMTQNNQKTVKLRPGRKSEQPTXXXXXXXXXXXXXXXXXXXXXXANIKLEMRKKKRSIGVDMREKLNFFRKQQGEN-SSQPTSNTTAANRSSLVSPNF-----MINLENVWKATN---------------------GCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIF 1524
            R+ GW K+F+  LQRSKS  +    + N   +     RK  Q T       S                 +L+  ++K+ +  D++E L+FF K+   + ++   +++ A +RS     +      + N+  V+   N                       P+ +Q+  W  S E++L D++G+ LF  FL++E+SDENLEFW  C++Y+S+   KKL ++A +I+  +++ Q+P+E+NLDS TR+QT + +   +K TFD +QK+I ALMEKDSY RFLRS+I+
Sbjct:   53 RSHGWEKIFSKPLQRSKSAGSRADVKAN--GIYNISARKVVQKTQLSADDASCEDIADFD---------RLKKNREKKGL-FDVKEVLSFFHKKSAHDLAAIAVTSSLAESRSDGFGGSHGNLSTLGNISPVFNKQNKKQSLYPHDNKSSTSSSSKHGSHPATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 324          
BLAST of Regulator of G-protein signaling vs. Planmine SMEST
Match: SMESG000053355.1 (SMESG000053355.1)

HSP 1 Score: 106.686 bits (265), Expect = 2.139e-26
Identity = 52/128 (40.62%), Postives = 78/128 (60.94%), Query Frame = 1
Query: 1153 PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLM 1536
            P+ E +LSW    E IL D +G+  F EFL+SE+S ENL FW  C+ +++I+  KKL E A  I+++Y+A  S  E+NLD+  R      +    K+ F+ +Q  I  LM KDSY RFL+S+ +  ++
Sbjct:   55 PTIENILSWKNGLEFILNDYYGLYYFNEFLKSEYSVENLNFWLACEKFKTIQSRKKLDEIANSIYQEYIAIGSENEVNLDAKLRRNIIEQMNSPNKKLFELAQSSIFILMAKDSYCRFLKSKCYLDMI 182          
The following BLAST results are available for this feature:
BLAST of Regulator of G-protein signaling vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGS35.101e-3838.30regulator of G protein signaling 3 [Source:HGNC Sy... [more]
RGS31.105e-3745.99regulator of G protein signaling 3 [Source:HGNC Sy... [more]
RGS32.156e-3737.06regulator of G protein signaling 3 [Source:HGNC Sy... [more]
RGS32.156e-3737.06regulator of G protein signaling 3 [Source:HGNC Sy... [more]
RGS32.781e-3737.77regulator of G protein signaling 3 [Source:HGNC Sy... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs-22.770e-3339.87Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-26.346e-3343.38Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-28.155e-3343.38Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-21.514e-3243.38Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-73.893e-2746.15Regulator of G-protein signaling rgs-7 [Source:Un... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhit4.442e-2841.43gene:FBgn0028743 transcript:FBtr0340279[more]
Dhit4.884e-2841.43gene:FBgn0028743 transcript:FBtr0301142[more]
loco2.248e-2338.93gene:FBgn0020278 transcript:FBtr0084276[more]
loco2.482e-2338.93gene:FBgn0020278 transcript:FBtr0304669[more]
loco2.572e-2338.93gene:FBgn0020278 transcript:FBtr0084275[more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGS131.167e-3442.31si:ch211-117l17.5 [Source:ZFIN;Acc:ZDB-GENE-110914... [more]
BX936311.12.473e-3443.54si:ch211-117l17.5 [Source:NCBI gene;Acc:792554][more]
rgs3a4.054e-3436.67regulator of G protein signaling 3a [Source:ZFIN;A... [more]
RGS131.328e-3344.14si:ch211-117l17.5 [Source:ZFIN;Acc:ZDB-GENE-110914... [more]
rgs131.643e-3241.30regulator of G protein signaling 13 [Source:ZFIN;A... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhlrc32.495e-3444.44NHL repeat containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
sppl2b3.393e-3346.88signal peptide peptidase like 2B [Source:Xenbase;A... [more]
cipc6.885e-3343.18CLOCK-interacting pacemaker [Source:Xenbase;Acc:XB... [more]
cipc8.749e-3344.88CLOCK-interacting pacemaker [Source:Xenbase;Acc:XB... [more]
rgs186.091e-2942.86regulator of G-protein signaling 18 [Source:NCBI g... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rgs32.631e-3939.36regulator of G-protein signaling 3 [Source:MGI Sym... [more]
Rgs38.226e-3939.09regulator of G-protein signaling 3 [Source:MGI Sym... [more]
Rgs37.280e-3839.09regulator of G-protein signaling 3 [Source:MGI Sym... [more]
Rgs55.178e-3646.88regulator of G-protein signaling 5 [Source:MGI Sym... [more]
Rgs45.280e-3436.52regulator of G-protein signaling 4 [Source:MGI Sym... [more]
back to top
BLAST of Regulator of G-protein signaling vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DC04|RGS3_MOUSE5.092e-3739.09Regulator of G-protein signaling 3 OS=Mus musculus... [more]
sp|P49797|RGS3_RAT2.200e-3636.95Regulator of G-protein signaling 3 OS=Rattus norve... [more]
sp|P49796|RGS3_HUMAN2.037e-3537.06Regulator of G-protein signaling 3 OS=Homo sapiens... [more]
sp|O08850|RGS5_MOUSE3.622e-3546.88Regulator of G-protein signaling 5 OS=Mus musculus... [more]
sp|P49800|RGS5_RAT5.853e-3546.88Regulator of G-protein signaling 5 OS=Rattus norve... [more]
back to top
BLAST of Regulator of G-protein signaling vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419PEA93.945e-4241.32Regulator of G-protein signaling 3 (Fragment) OS=C... [more]
G4V7M94.689e-4243.43Putative regulator of G protein signaling OS=Schis... [more]
A0A183R1Q57.262e-4247.53RGS domain-containing protein OS=Schistosoma rodha... [more]
A0A074ZJC61.004e-4156.06RGS domain-containing protein OS=Opisthorchis vive... [more]
A0A4Z2D3011.102e-4143.75Regulator of G-protein signaling 3 OS=Schistosoma ... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs3a1.753e-3838.59regulator of G protein signaling 3a [Source:ZFIN;A... [more]
rgs3a6.023e-3839.23regulator of G protein signaling 3a [Source:ZFIN;A... [more]
rgs3a1.889e-3638.59regulator of G protein signaling 3a [Source:ZFIN;A... [more]
si:ch211-117l17.52.796e-3641.51regulator of G-protein signaling 21 [Source:NCBI g... [more]
rgs3a4.917e-3638.59regulator of G protein signaling 3a [Source:ZFIN;A... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006812.17.119e-3646.46pep scaffold:Pmarinus_7.0:GL476397:246833:248901:1... [more]
ENSPMAT00000008960.14.933e-3437.64pep scaffold:Pmarinus_7.0:GL487232:48:5367:1 gene:... [more]
ENSPMAT00000008468.13.957e-3041.61pep scaffold:Pmarinus_7.0:GL476656:335513:340095:-... [more]
ENSPMAT00000005413.17.333e-2940.48pep scaffold:Pmarinus_7.0:GL501287:7893:12072:-1 g... [more]
ENSPMAT00000003940.15.507e-2841.73pep scaffold:Pmarinus_7.0:GL476449:561747:569035:-... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO373706.161e-2540.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328046.199e-2133.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431261.328e-2035.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343512.025e-1737.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448611.679e-726.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs3a7.199e-3738.95regulator of G protein signaling 3a [Source:ZFIN;A... [more]
rgs3a7.237e-3738.95regulator of G protein signaling 3a [Source:ZFIN;A... [more]
rgs3a2.759e-3638.95regulator of G protein signaling 3a [Source:ZFIN;A... [more]
si:ch211-117l17.54.639e-3339.10regulator of G-protein signaling 21-like [Source:N... [more]
rgs5a6.307e-3342.19regulator of G-protein signaling 5 [Source:NCBI ge... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012254.10.000e+0100.00SMESG000012254.1[more]
SMESG000011723.12.552e-4747.72SMESG000011723.1[more]
SMESG000048981.11.026e-4143.32SMESG000048981.1[more]
SMESG000027589.11.045e-3832.39SMESG000027589.1[more]
SMESG000053355.12.139e-2640.63SMESG000053355.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019876 ID=SMED30019876|Name=Regulator of G-protein signaling|organism=Schmidtea mediterranea sexual|type=transcript|length=1841bp
GCAAATCATTTCTTCTCTCACTCGATTCGTTAGGCGTGTTTCACGTGTGA
CTGCATGTATCGATTCTCTCTCTCCAATTGGCACTACCAGTATGTATGTA
TTGTTTGTATGCCTCCAATGAAATCTTCCCAATACAATACTAGTAGATTA
TACTCGTAATTAGCATTCCCCATCGTCCTGCATTGTTTTGTCAATCATGA
GCAGTTGATATTGATTTCATCATGGGATTATGCAATGGATAATGATCAAA
TAGTCGCATCGAATGTTCCAGTTGAATACGAAGAAACTGGACCACGCTAT
AGTGAATCTTATTTAGCCCGAGTGGGAAGATATAATCAGATTATTAATCG
AAACTCCTCCTTCAGTGCTAATAAATCCATTGATCTAAATGACGCTTCAT
CAGACAATGATAGAATTGTAATTGTTGCTCCTATCCGTGAATTTGTTGAA
GAGGATGATAAAGAAGCTGAAAATACATTAATTCCTGGTAGATTCTGTCA
ACCTGAATCACCAACTGTGAGCAATTCAGAATTCGGAGATCCTTCTACAA
CCTCGGATATACTCTCGGTGACTTTTGATGATATTGTTATTGAAAACCAC
GAAATCGAAGTGGAATTGAAGCCACCTCCAACTTCTCAGATAATTACTCT
ACAAAGACAAAATTCTGAAGAAATTGAAAAGAATTTCGGTGGCTTAGGTC
CGATTAAAAATACTCAAATCGTTAAAGAAAATGTCTTTAATCCTACCCGA
CCTCGCACAAGCGGATGGGCAAAGCTTTTCGCCAGTACGCTTCAAAGAAG
CAAGAGCACTGTTACGTCGGAAATGACGCAAAATAATCAGAAAACCGTAA
AACTGAGACCCGGGAGGAAGTCCGAACAACCTACAACATCAGTCAACAGC
TCAATCTCATCATCATCGACAATTCAAGATTCAGAATCATCGGACTCACA
GGCAAATATCAAGTTAGAAATGAGAAAAAAGAAAAGGAGTATTGGCGTAG
ATATGCGCGAAAAATTGAATTTCTTCCGAAAGCAACAAGGTGAAAATAGC
TCGCAACCTACATCAAATACTACAGCAGCTAATAGATCGAGTCTTGTCAG
TCCGAACTTTATGATAAATCTCGAAAATGTTTGGAAAGCGACAAATGGCT
GTCCATCAAGGGAACAAGTTCTCTCGTGGAGTCAGTCATTTGAGAATATT
CTTTATGATCAACATGGAATTACATTGTTTCTTGAATTCTTACGATCAGA
GTTCAGTGATGAAAATTTGGAGTTCTGGTCCGAGTGTCAGGCCTACCGGT
CCATAAAGTGTCCTAAAAAATTGCAAGAAAAAGCAACTCAAATATTTGAG
GATTATGTTGCTGAACAGTCTCCAAAAGAAATAAATCTTGATTCAGTAAC
TCGAATTCAAACTGCTACAGATATTATACATGCTACGAAACAAACGTTTG
ATCAATCTCAAAAAAAAATCCAAGCTCTAATGGAGAAGGATTCATATCAA
AGATTCCTCCGTTCCGAAATATTTCACACTTTAATGAGTCAATTGAATAT
TTCTCCGAATCTTACAGGTAAATTATCCCATACAAATTCAGTTCCTACCG
AGTCCCTTTCTACAAGGGTTTCATACATTCCTGGTCTGTTGCCAAAAGTC
ACAACAGTTTCAAAATTGAATCAGACTCGAACGAACACCAATCCAAATTT
AATATCATCCATTGATATCTCAAAATCTGAAAGTTCCGGAGATTATGGAC
ATCGTTCGGCACCATCTTCTCCCAAAAATATGACTGCCTCAGATTCTGCG
TAAAGTGTGATAGCTATGATATTTTGATCAATAAATATTCT
back to top

protein sequence of SMED30019876-orf-1

>SMED30019876-orf-1 ID=SMED30019876-orf-1|Name=SMED30019876-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=523bp
MDNDQIVASNVPVEYEETGPRYSESYLARVGRYNQIINRNSSFSANKSID
LNDASSDNDRIVIVAPIREFVEEDDKEAENTLIPGRFCQPESPTVSNSEF
GDPSTTSDILSVTFDDIVIENHEIEVELKPPPTSQIITLQRQNSEEIEKN
FGGLGPIKNTQIVKENVFNPTRPRTSGWAKLFASTLQRSKSTVTSEMTQN
NQKTVKLRPGRKSEQPTTSVNSSISSSSTIQDSESSDSQANIKLEMRKKK
RSIGVDMREKLNFFRKQQGENSSQPTSNTTAANRSSLVSPNFMINLENVW
KATNGCPSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSE
CQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHA
TKQTFDQSQKKIQALMEKDSYQRFLRSEIFHTLMSQLNISPNLTGKLSHT
NSVPTESLSTRVSYIPGLLPKVTTVSKLNQTRTNTNPNLISSIDISKSES
SGDYGHRSAPSSPKNMTASDSA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036305RGS_sf
IPR016137RGS
IPR024066RGS_subdom1/3
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0009968negative regulation of signal transduction
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 398..418
NoneNo IPR availableGENE3DG3DSA:1.10.167.10coord: 343..414
e-value: 9.9E-27
score: 95.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 488..522
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 190..240
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 265..285
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 190..251
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 266..285
NoneNo IPR availablePANTHERPTHR10845:SF242NOVEL PROTEIN SIMILAR TO VERTEBRATE REGULATOR OF G-PROTEIN SIGNALLING FAMILY-RELATEDcoord: 224..440
NoneNo IPR availablePANTHERPTHR10845REGULATOR OF G PROTEIN SIGNALINGcoord: 224..440
IPR016137RGS domainPRINTSPR01301RGSPROTEINcoord: 366..389
score: 37.95
coord: 315..336
score: 39.43
coord: 408..427
score: 56.74
coord: 337..355
score: 47.6
IPR016137RGS domainSMARTSM00315RGS_3coord: 318..434
e-value: 1.2E-38
score: 144.4
IPR016137RGS domainPFAMPF00615RGScoord: 318..432
e-value: 2.8E-31
score: 108.3
IPR016137RGS domainPROSITEPS50132RGScoord: 318..434
score: 33.337
IPR024066RGS, subdomain 1/3GENE3DG3DSA:1.10.196.10coord: 415..440
e-value: 3.1E-7
score: 32.1
IPR024066RGS, subdomain 1/3GENE3DG3DSA:1.10.196.10coord: 300..342
e-value: 2.9E-9
score: 38.3
IPR036305RGS domain superfamilySUPERFAMILYSSF48097Regulator of G-protein signaling, RGScoord: 305..437