plasminogen-1

Overview
Nameplasminogen-1 (AFJ24868.1)
Smed IDSMED30019873
Length (bp)1017
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of plasminogen-1 (SMED30019873) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for plasminogen-1 (SMED30019873) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019873

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019873SMESG000018453.1 SmedASXL_005106SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30019873SMESG000018453.1 dd_Smed_v4_23420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019873SMESG000018453.1 dd_Smed_v6_23420_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30019873SMESG000018453.1 OX_Smed_1.0.05477ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019873SMESG000018453.1 dd_Smed_v4_23420_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of plasminogen-1 vs. Ensembl Human
Match: PLG (plasminogen [Source:HGNC Symbol;Acc:HGNC:9071])

HSP 1 Score: 102.064 bits (253), Expect = 3.323e-23
Identity = 81/253 (32.02%), Postives = 114/253 (45.06%), Query Frame = 1
Query:  157 SISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKY-------CKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTM-SGVQ-EYCSVPQCNIS 879
            S +S   P F PA  P E   +  NYCRN DND  G WCY  + +   K+Y       C+ +C    G  YD       G ++ T +   C  W+ +      Y  S FP  ++    NYCRNP +    PWC+      R+  C IP C    P      +SG         G  Y GN+++T + +TC  W+  + +  +   P  F    + E  NYCRNP +    PWC+T  S V+ EYC +P C+ S
Sbjct:  128 SSTSPHRPRFSPATHPSEGLEE--NYCRNPDNDPQGPWCYTTDPE---KRYDYCDILECEEECMHCSGENYD-------GKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKK--NYCRNP-DRELRPWCFTTDPNKRWELCDIPRCTTPPP------SSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHT-HNRTPENFPCKNLDE--NYCRNP-DGKRAPWCHTTNSQVRWEYCKIPSCDSS 355          

HSP 2 Score: 70.4774 bits (171), Expect = 1.061e-12
Identity = 69/248 (27.82%), Postives = 99/248 (39.92%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-------------------QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPEN--SIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSP---------LAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVF-NYCRNPSNDTMGPWCYTM--SGVQEYCSVPQC 870
             NYCRN D      WC+  N  +  + YCK                    + + +    Y   G  Y+GT + T T + C +W+   + +     PEN  +     NYCRNP  ++G PWC+      R+ +C +  C  +           L P  +T     C     G  Y G  + T     C  W   +   P+ +      T+  A +  NYCRNP  D  GPWCYT     + +YC VPQC
Sbjct:  321 ENYCRNPDGKRA-PWCHTTNSQVRWE-YCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWS-SMTPHRHQKTPENYPNAGLTMNYCRNPDADKG-PWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDC-MFGNGKGYRGKRATTVTGTPCQDW---AAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQC 560          

HSP 3 Score: 70.0922 bits (170), Expect = 1.552e-12
Identity = 50/176 (28.41%), Postives = 77/176 (43.75%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWN---LKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            G  Y+GT++ T     C  W+        ++ +  P   +    NYCRNP N+  GPWC+      R+ +C I  C++               C   + G  Y G IS T +   C  W++ S +   Y  P  F    + +  NYCRNP  + + PWC+T    +  E C +P+C
Sbjct:  108 GKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEE--NYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEE--------------CMHCS-GENYDGKISKTMSGLECQAWDSQSPHAHGY-IPSKFPNKNLKK--NYCRNPDRE-LRPWCFTTDPNKRWELCDIPRC 262          

HSP 4 Score: 60.4622 bits (145), Expect = 2.267e-9
Identity = 34/86 (39.53%), Postives = 47/86 (54.65%), Query Frame = 1
Query:  622 ATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            + CK T  G  Y G +S T N  TC  W++TS + P ++ P    +  + E  NYCRNP ND  GPWCYT    +  +YC + +C 
Sbjct:  101 SECK-TGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFS-PATHPSEGLEE--NYCRNPDNDPQGPWCYTTDPEKRYDYCDILECE 182          

HSP 5 Score: 54.6842 bits (130), Expect = 1.654e-7
Identity = 41/146 (28.08%), Postives = 60/146 (41.10%), Query Frame = 1
Query:  229 NYCRNLDNDTVGAWCYVRNGDLYIKKYCK-TQCSGIWG---------------------CLYDRIGSYYQGTVNITDTNQACANWNL----KGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSS 588
            NYCRN D D  G WC+  +  +  + YC   +CSG                        C++   G  Y+G    T T   C +W      + S++T    P   +    NYCRNP  + GGPWC+  +    + +C +P C   S
Sbjct:  424 NYCRNPDADK-GPWCFTTDPSVRWE-YCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGN-GKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEK--NYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPS 564          
BLAST of plasminogen-1 vs. Ensembl Human
Match: MST1 (macrophage stimulating 1 [Source:HGNC Symbol;Acc:HGNC:7380])

HSP 1 Score: 83.1889 bits (204), Expect = 6.691e-17
Identity = 76/286 (26.57%), Postives = 112/286 (39.16%), Query Frame = 1
Query:  184 FHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCK----------TQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVF-NYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNISQTTGSLKKNTVIQIES-KILVLTCCAILAFISVTGGH 987
            F P    D+   D  NYCRN D      WCY  +  +  +++C            Q +    C   + G  Y+GT N T     C  W+ +      +T   +    +    N+CRNP  +   PWC+      R  FC +I  C         T       C   A G +Y G +S T     C  W+  + + P +     F +   A++  N+CRNP  D+ GPWCYTM      +YC++ +C   Q    L     +Q E     V       + + V GGH
Sbjct:  239 FEPGKFLDQGLDD--NYCRNPDGSER-PWCYTTDPQIE-REFCDLPRCGSEAQPRQEATTVSCFRGK-GEGYRGTANTTTAGVPCQRWDAQIPHQHRFTPEKYACKDLRE--NFCRNPDGSEA-PWCFTLRPGMRAAFCYQIRRC---------TDDVRPQDCYHGA-GEQYRGTVSKTRKGVQCQRWSAETPHKPQFT----FTSEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFEKCGKRVDRLDQRRSKLRVVGGH 502          

HSP 2 Score: 74.7146 bits (182), Expect = 4.878e-14
Identity = 54/206 (26.21%), Postives = 90/206 (43.69%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSL---YTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTM 834
             N+CRN D D  G WCY  +  +  +  C  +      C++   G  Y+G V+ T++ + C  W+L+      +    F +  + +  NYCRNP  +   PWC+         FC +P C   S   P  + +  +  +    G  Y G  + TT    C  W+    +   +  P  +    + E  N+CRNP + +  PWC+T+
Sbjct:  168 ENFCRNPDGDPGGPWCYTTDPAVRFQS-CGIKSCREAACVWCN-GEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDD--NYCRNPDGSE-RPWCYTTDPQIEREFCDLPRC--GSEAQPRQEATTVSCFRGKGEG--YRGTANTTTAGVPCQRWDAQIPHQHRFT-PEKYACKDLRE--NFCRNP-DGSEAPWCFTL 360          

HSP 3 Score: 68.1662 bits (165), Expect = 6.206e-12
Identity = 49/175 (28.00%), Postives = 73/175 (41.71%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWNLKGSLYTDSNF-PENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCSVPQCN 873
            G  Y+GT+  T     C  W+ K     D  + P        N+CRNP  + GGPWC+      RF  C I  C++++ +                 G EY G +  T +   C  W+    +   + +P  F    + +  NYCRNP      PWCYT      +E+C +P+C 
Sbjct:  129 GVGYRGTMATTVGGLPCQAWSHK--FPNDHKYTPTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREAACV--------------WCNGEEYRGAVDRTESGRECQRWDLQHPHQHPF-EPGKFLDQGLDD--NYCRNPDGSER-PWCYTTDPQIEREFCDLPRCG 283          
BLAST of plasminogen-1 vs. Ensembl Human
Match: HGF (hepatocyte growth factor [Source:HGNC Symbol;Acc:HGNC:4893])

HSP 1 Score: 82.4185 bits (202), Expect = 1.519e-16
Identity = 84/287 (29.27%), Postives = 122/287 (42.51%), Query Frame = 1
Query:  184 FHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIK-KYCKTQ-CSG-----------IWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN--ASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALW--NTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGV--QEYCSVPQCNISQTTGSLKKNTVIQIESKILVLTCCAILAFISVTGG 984
            F P   PD+ F D  NYCRN D      WCY    D + + +YC  + C+               C+  + G  Y+GTVN       C  W+ +     D   PEN        NYCRNP  +   PWC+      R G+C +IP C  S          G    +    G  Y GN+S T +  TC++W  N    +   + +P   + S + E  NYCRNP +D  GPWCYT + +   +YC + +C    T       T++ ++  ++    CA    + V  G
Sbjct:  245 FLPERYPDKGFDD--NYCRNPDGQPR-PWCYTL--DPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQ-GEGYRGTVNTIWNGIPCQRWDSQYPHEHDMT-PENFKCKDLRENYCRNPDGSES-PWCFTTDPNIRVGYCSQIPNCDMSH---------GQDCYRGN--GKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEP---DASKLNE--NYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTP------TIVNLDHPVIS---CAKTKQLRVVNG 498          

HSP 2 Score: 73.9442 bits (180), Expect = 7.847e-14
Identity = 63/239 (26.36%), Postives = 104/239 (43.51%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSS------PLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCS-VPQCNISQTTGSLKKN 906
             NYCRN   +  G WC+  N ++  +     QCS +  C+    G  Y+G ++ T++ + C  W+ +      +    +P+    +  NYCRNP + +  PWC+     TR+ +C I  C  ++      PL       G         G  Y G ++   N   C  W+ + + + +   P  F    + E  NYCRNP + +  PWC+T        YCS +P C++S      + N
Sbjct:  174 ENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV-ECMTCN-GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDD--NYCRNP-DGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQ--------GEGYRGTVNTIWNGIPCQRWD-SQYPHEHDMTPENFKCKDLRE--NYCRNP-DGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGN 395          

HSP 3 Score: 70.4774 bits (171), Expect = 1.197e-12
Identity = 50/176 (28.41%), Postives = 74/176 (42.05%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANA---SNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            G  Y+GTV+IT +   C  W+    +  + +F  +S        NYCRNP    GGPWC+  +   R+  C IP C +   +              T  G  Y G +  T +   C  W+  +   P+ ++ +           NYCRNP      PWCYT+      EYC++  C
Sbjct:  133 GRSYKGTVSITKSGIKCQPWS--SMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECM--------------TCNGESYRGLMDHTESGKICQRWDHQT---PHRHKFLPERYPDKGFDDNYCRNPDGQPR-PWCYTLDPHTRWEYCAIKTC 288          
BLAST of plasminogen-1 vs. Ensembl Human
Match: HGF (hepatocyte growth factor [Source:HGNC Symbol;Acc:HGNC:4893])

HSP 1 Score: 82.0333 bits (201), Expect = 1.645e-16
Identity = 84/287 (29.27%), Postives = 122/287 (42.51%), Query Frame = 1
Query:  184 FHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIK-KYCKTQ-CSG-----------IWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN--ASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALW--NTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGV--QEYCSVPQCNISQTTGSLKKNTVIQIESKILVLTCCAILAFISVTGG 984
            F P   PD+ F D  NYCRN D      WCY    D + + +YC  + C+               C+  + G  Y+GTVN       C  W+ +     D   PEN        NYCRNP  +   PWC+      R G+C +IP C  S          G    +    G  Y GN+S T +  TC++W  N    +   + +P   + S + E  NYCRNP +D  GPWCYT + +   +YC + +C    T       T++ ++  ++    CA    + V  G
Sbjct:  240 FLPERYPDKGFDD--NYCRNPDGQPR-PWCYTL--DPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQ-GEGYRGTVNTIWNGIPCQRWDSQYPHEHDMT-PENFKCKDLRENYCRNPDGSES-PWCFTTDPNIRVGYCSQIPNCDMSH---------GQDCYRGN--GKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEP---DASKLNE--NYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTP------TIVNLDHPVIS---CAKTKQLRVVNG 493          

HSP 2 Score: 73.9442 bits (180), Expect = 7.543e-14
Identity = 63/239 (26.36%), Postives = 104/239 (43.51%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSS------PLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCS-VPQCNISQTTGSLKKN 906
             NYCRN   +  G WC+  N ++  +     QCS +  C+    G  Y+G ++ T++ + C  W+ +      +    +P+    +  NYCRNP + +  PWC+     TR+ +C I  C  ++      PL       G         G  Y G ++   N   C  W+ + + + +   P  F    + E  NYCRNP + +  PWC+T        YCS +P C++S      + N
Sbjct:  169 ENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV-ECMTCN-GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDD--NYCRNP-DGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQ--------GEGYRGTVNTIWNGIPCQRWD-SQYPHEHDMTPENFKCKDLRE--NYCRNP-DGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGN 390          

HSP 3 Score: 70.0922 bits (170), Expect = 1.684e-12
Identity = 48/173 (27.75%), Postives = 73/173 (42.20%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            G  Y+GTV+IT +   C  W+    +  + ++    +    NYCRNP    GGPWC+  +   R+  C IP C +   +              T  G  Y G +  T +   C  W+  +   P+ ++ +           NYCRNP      PWCYT+      EYC++  C
Sbjct:  133 GRSYKGTVSITKSGIKCQPWS--SMIPHEHSYRGKDLQ--ENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECM--------------TCNGESYRGLMDHTESGKICQRWDHQT---PHRHKFLPERYPDKGFDDNYCRNPDGQPR-PWCYTLDPHTRWEYCAIKTC 283          
BLAST of plasminogen-1 vs. Ensembl Human
Match: F2 (coagulation factor II, thrombin [Source:HGNC Symbol;Acc:HGNC:3535])

HSP 1 Score: 79.7221 bits (195), Expect = 3.313e-16
Identity = 59/206 (28.64%), Postives = 94/206 (45.63%), Query Frame = 1
Query:  355 IGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN-ASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLT-KTSGNATCKSTAI-------GGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMS--GVQEYCSVPQCN--ISQTTGS-LKKNTVIQIESK 930
            +G+ Y+G VNIT +   C  W  +     + N   +  A+   N+CRNP ++  GPWC+      R   C IP C Q      +T ++ G++   S  +       G +Y G +++TT+   C  W +        +Q   FN++    V N+CRNP  D  G WCY     G   YC +  C   + + TG  L +++   IE +
Sbjct:  102 LGTNYRGHVNITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQECSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASAQAKALSKHQD--FNSAVQL-VENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGR 304          
BLAST of plasminogen-1 vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 58.151 bits (139), Expect = 4.984e-9
Identity = 36/99 (36.36%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  580 QSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALW-NTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMS-GVQEYCSVPQC 870
            QSSP+A + +      C   + G +Y G ++ T++   CA W ++TS     +  P L N+       NYCRNP      PWCY+   G +EYC VPQC
Sbjct:  312 QSSPVAEVNRGHLTHWCYVNS-GTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPELMNSK------NYCRNPGGKKSRPWCYSKPMGQEEYCDVPQC 403          

HSP 2 Score: 48.9062 bits (115), Expect = 3.632e-6
Identity = 25/74 (33.78%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANW-NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFC 576
            G+ Y+GTV  T + + CA W +     +    FPE  + N+ NYCRNP   +  PWC+ +  + +  +C +P C
Sbjct:  333 GTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPE--LMNSKNYCRNPGGKKSRPWCYSKP-MGQEEYCDVPQC 403          
BLAST of plasminogen-1 vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 57.7658 bits (138), Expect = 5.012e-9
Identity = 36/99 (36.36%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  580 QSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALW-NTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMS-GVQEYCSVPQC 870
            QSSP+A + +      C   + G +Y G ++ T++   CA W ++TS     +  P L N+       NYCRNP      PWCY+   G +EYC VPQC
Sbjct:  179 QSSPVAEVNRGHLTHWCYVNS-GTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPELMNSK------NYCRNPGGKKSRPWCYSKPMGQEEYCDVPQC 270          

HSP 2 Score: 48.9062 bits (115), Expect = 3.714e-6
Identity = 25/74 (33.78%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANW-NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFC 576
            G+ Y+GTV  T + + CA W +     +    FPE  + N+ NYCRNP   +  PWC+ +  + +  +C +P C
Sbjct:  200 GTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPE--LMNSKNYCRNPGGKKSRPWCYSKP-MGQEEYCDVPQC 270          
BLAST of plasminogen-1 vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 57.7658 bits (138), Expect = 5.440e-9
Identity = 36/99 (36.36%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  580 QSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALW-NTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMS-GVQEYCSVPQC 870
            QSSP+A + +      C   + G +Y G ++ T++   CA W ++TS     +  P L N+       NYCRNP      PWCY+   G +EYC VPQC
Sbjct:  338 QSSPVAEVNRGHLTHWCYVNS-GTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPELMNSK------NYCRNPGGKKSRPWCYSKPMGQEEYCDVPQC 429          

HSP 2 Score: 48.9062 bits (115), Expect = 3.560e-6
Identity = 25/74 (33.78%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANW-NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFC 576
            G+ Y+GTV  T + + CA W +     +    FPE  + N+ NYCRNP   +  PWC+ +  + +  +C +P C
Sbjct:  359 GTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPE--LMNSKNYCRNPGGKKSRPWCYSKP-MGQEEYCDVPQC 429          
BLAST of plasminogen-1 vs. Ensembl Fly
Match: Nrk (gene:FBgn0020391 transcript:FBtr0087728)

HSP 1 Score: 51.9878 bits (123), Expect = 5.469e-7
Identity = 31/117 (26.50%), Postives = 58/117 (49.57%), Query Frame = 1
Query:  646 GGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTM--SGVQEYCSVPQCNISQTTGSLKKNTVIQIE-----SKILVLTCCAILAFISV 975
            G  Y G ++++ +   C  W+T  + + ++  P++F+     E  NYCRN   +   PWCYT+  S   ++C +P C       ++  NT I++E     S I +L     +A +++
Sbjct:  224 GRFYMGTMNVSKSGIPCQRWDT-QYPHKHFQPPLVFHQLLEGE--NYCRNAGGEEPHPWCYTVDESVRWQHCDIPMCPDYVDPNAVDLNTPIKMEKFFTPSMIFLLAGIGFVAIVTL 337          

HSP 2 Score: 47.7506 bits (112), Expect = 9.881e-6
Identity = 22/77 (28.57%), Postives = 34/77 (44.16%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWNLKGSLYTDSNFPE----NSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFC 576
            G +Y GT+N++ +   C  W+ +   Y   +F      + +    NYCRN       PWC+      R+  C IP C
Sbjct:  224 GRFYMGTMNVSKSGIPCQRWDTQ---YPHKHFQPPLVFHQLLEGENYCRNAGGEEPHPWCYTVDESVRWQHCDIPMC 297          
BLAST of plasminogen-1 vs. Ensembl Fly
Match: Ror (gene:FBgn0010407 transcript:FBtr0079978)

HSP 1 Score: 47.7506 bits (112), Expect = 9.720e-6
Identity = 26/74 (35.14%), Postives = 38/74 (51.35%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITR-FGFCRIPFC 576
            GS Y+G  N++ + + C  W+    +   S+FPE       NYCRNP +    PWC++ S+  R    C IP C
Sbjct:  242 GSTYRGVANVSASGKPCLRWSW--LMKEISDFPE---LIGQNYCRNPGSVENSPWCFVDSSRERIIELCDIPKC 310          
BLAST of plasminogen-1 vs. Ensembl Zebrafish
Match: plg (plasminogen [Source:ZFIN;Acc:ZDB-GENE-030131-1411])

HSP 1 Score: 93.9745 bits (232), Expect = 1.204e-20
Identity = 87/292 (29.79%), Postives = 121/292 (41.44%), Query Frame = 1
Query:   28 NCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSISSNVNPIFHPAILPDESFAD-ASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRI---GSYYQGTVNITDTNQACANWNLKGSL---YTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSP--LAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
             CVNG+    ++   S  +  ++C  W           + P +    N+ P  +P        AD  SN+CRN D D  G WCY  + +    ++C  Q      C  + +   G  Y+G ++ T +   C  W+ +      Y  S  P+  +    NYCRNP +    PWC+  S   R+  C IP C    P  +  LT  SG         G  Y G IS+T    TC  W + S   P+ +     N        NYCRNP N+   PWCYT       EYCSVP C
Sbjct:  109 ECVNGI-GMDYRGTKSKTKSGKTCQRWE---------GTFPHVP---NITPRAYPK-------ADLESNFCRNPDGDKGGPWCYTTDPEKRW-EHCNIQ-----DCTEECMQCSGENYRGKISTTVSGFTCQRWDSQQPQNHGYLPSALPDKYLEE--NYCRNP-DGEPRPWCFTTSPSKRWEACAIPRCTTEPPTIVPELTCASGE--------GSSYRGTISVTITGKTCQQWTSQS---PHKHSRSPENYPCKGLDGNYCRNPDNE-RSPWCYTTDPETRWEYCSVPSC 359          

HSP 2 Score: 83.5741 bits (205), Expect = 3.438e-17
Identity = 72/251 (28.69%), Postives = 103/251 (41.04%), Query Frame = 1
Query:  229 NYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIW-----------GCLYDRIGSYYQGTVNITDTNQACANW-NLKGSLY--TDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQ-----QSSPLAPLTKTSGNAT---------------CKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTM--SGVQEYCSVPQCN 873
            NYCRN DN+    WCY  + +   + YC     G                Y+  GS Y+G ++ T + + C  W +++   +  T  NFP+  +    N CRNP  +R  PWC+      R+ +C I  C      Q  P  P   T   +T               CK+   G EY G+ S+T    TC  W + + +      P       +    N CRNP +D  GPWCYT   S   +YC +P C 
Sbjct:  329 NYCRNPDNER-SPWCYTTDPETRWE-YCSVPSCGDQPRPEEPVIPQGEECYEGDGSSYRGVMSETISGKKCQFWTSMEPHRHSKTPQNFPKADLRR--NLCRNPDGDRA-PWCYTTDPTVRWEYCNIERCDNRPNIQEPPAKPAATTPTQSTPAQSTPDQSAPSEKDCKN-GNGAEYRGSTSMTVMGVTCQAWRSMTPHQHASFTPETHPDKGLES--NQCRNPDSDVNGPWCYTTDPSKKWDYCQIPDCE 571          

HSP 3 Score: 75.8702 bits (185), Expect = 1.143e-14
Identity = 56/183 (30.60%), Postives = 80/183 (43.72%), Query Frame = 1
Query:  355 IGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANA---SNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNISQTT 888
            IG  Y+GT + T + + C  W  +G+     N    +   A   SN+CRNP  ++GGPWC+      R+  C I  C +               C   + G  Y G IS T +  TC  W++    N  Y  P       + E  NYCRNP  +   PWC+T S  +  E C++P+C     T
Sbjct:  114 IGMDYRGTKSKTKSGKTCQRW--EGTFPHVPNITPRAYPKADLESNFCRNPDGDKGGPWCYTTDPEKRWEHCNIQDCTEE--------------CMQCS-GENYRGKISTTVSGFTCQRWDSQQPQNHGY-LPSALPDKYLEE--NYCRNPDGEPR-PWCFTTSPSKRWEACAIPRCTTEPPT 275          
BLAST of plasminogen-1 vs. Ensembl Zebrafish
Match: hgfb (hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GENE-041014-3])

HSP 1 Score: 85.5001 bits (210), Expect = 7.600e-18
Identity = 78/241 (32.37%), Postives = 97/241 (40.25%), Query Frame = 1
Query:  181 IFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIK----KYCKTQCSG----IWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSV 861
            IFHP   PD+   D  NYCRN D      WC+  +     +    K C +  SG       C   R G  Y+GT+ IT     C  W+ +      YT  N+    +    NYCRNP + R  PWC+         FC  IP C    P            C    IG  Y G+ S T +   CA W   S  N         N  T  +  N+CRNP  D  GPWCYT S     +YCS+
Sbjct:  223 IFHPKRYPDKGLKD--NYCRNPDGRQR-PWCFTTDPSTPWEYCNIKQCDSDNSGDVENTTTCFRGR-GEGYRGTIGITPDGVTCQRWDAQFPHRHSYTPQNYHCKDLR--ENYCRNP-DGRHLPWCFTTDPTVPIAFCTNIPRCGVKPPEP--------GEC-YKGIGDMYNGHRSKTRSGIPCAPWKDHSESNERD-----VNLLTTEQAGNFCRNPDKDKHGPWCYTNSSSIPWDYCSL 442          

HSP 2 Score: 69.707 bits (169), Expect = 1.177e-12
Identity = 68/241 (28.22%), Postives = 99/241 (41.08%), Query Frame = 1
Query:  211 SFADASNYCRNLDNDTVGAWCYVRNG---DLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNF-PENSIAN--ASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTM--SGVQEYCSVPQCNISQTTGSLKKNT 909
            SF   S  C  L  D++     + N    DLY KK    +C  I G      G  Y+G  ++T +   C  WN K  +  + NF P+         N CRNP N   GPWC+      R   C IP C +   +              T  G  Y G +  T +   C  W+    +   ++ P  +    + +  NYCRNP +    PWC+T   S   EYC++ QC+ S  +G ++  T
Sbjct:   67 SFDQKSTKCHLLSYDSLTFGVRMENDFNFDLYEKKDFMREC--IIG-----NGLNYKGKRSVTKSGVQCQLWNSK--MPHEHNFLPQRHKHRDLRDNLCRNPDNTTTGPWCFTTDPKLRHQDCSIPQCSEVECM--------------TCNGESYRGPLDHTESGRECQRWDLEEPHKHIFH-PKRYPDKGLKD--NYCRNP-DGRQRPWCFTTDPSTPWEYCNIKQCD-SDNSGDVENTT 279          
BLAST of plasminogen-1 vs. Ensembl Zebrafish
Match: f2 (coagulation factor II (thrombin) [Source:ZFIN;Acc:ZDB-GENE-030131-4606])

HSP 1 Score: 82.8037 bits (203), Expect = 6.285e-17
Identity = 56/220 (25.45%), Postives = 86/220 (39.09%), Query Frame = 1
Query:  322 CSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPEN-------SIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQS----SPLAPLTKTSGNATCKSTAIGGE-YAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ---------EYCSVPQCNISQTTGSLKKNTVIQ 918
            C+   G  +  IG+ Y G V++T + +AC  W         SNFP          +    N+CRNP  ++ GPWC+ +    R   C +P C ++               +   K     GE Y G + +T   +TC  W++         + +L        V N+CRNP  D  GPWCY  +            E C  P     +  G  ++ T+ Q
Sbjct:  121 CATTEGDCFINIGAKYAGKVSVTKSGKACQYWK--------SNFPHKIDEFNVTQLKLPENFCRNPDKHKDGPWCFTRDPTVRRETCNVPKCGEAVVPPPKAPTAKPEQRHVISKCLPGNGETYTGELFVTLGLHTCLQWSSAEVQALIKKKELLPQVQL---VKNHCRNPDGDMEGPWCYIKAASGNITIDYCDLELCDAPLDKFVEEGGGRERTTLDQ 329          
BLAST of plasminogen-1 vs. Ensembl Zebrafish
Match: hgfa (hepatocyte growth factor a [Source:ZFIN;Acc:ZDB-GENE-041014-2])

HSP 1 Score: 80.4925 bits (197), Expect = 3.242e-16
Identity = 74/256 (28.91%), Postives = 108/256 (42.19%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYC---------KTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN--ASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT--MSGVQEYCSVPQC-----NISQTTGSLKKNTVIQIESKIL 936
             N+CRN +ND V  WCY  + +   + YC           +      C   + G  Y+GTVN+T     C  W+   S +  S  P N        NYCRNP  +   PWC+      R  FC  IP C+        +++S +  C     G  Y GN+S T +   C LW+  +F      +      ++     N CRNP  D  GPWCYT   S   +YC + +C     +  Q +G  K +  I   ++I+
Sbjct:  242 DNFCRNPNND-VRPWCYTMDKNTPWE-YCNISVCDSDSDVEVEVTSSCFRGQ-GEGYRGTVNVTPAGVTCQRWDAL-SPHIHSYTPHNYKCKDLRENYCRNPDGSEI-PWCFTTDAKVRKAFCTNIPRCE--------SESSDSTECYEDN-GESYRGNLSKTRSGIPCGLWSDHTF-----RRDTRSAKASAGLELNLCRNPDRDKHGPWCYTSNSSIPWDYCGLERCKSMSSDDHQMSGGPKPSCFIHKTTRIV 478          

HSP 2 Score: 79.337 bits (194), Expect = 9.135e-16
Identity = 72/278 (25.90%), Postives = 120/278 (43.17%), Query Frame = 1
Query:   58 FKSQTSTEQFLESCVPW-MSVPLQYNNLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANA--SNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCS-VPQCN 873
            +K + S  +   +C  W MSVP ++N     P+    S++                  N+CRN DND  G WC+    +   +     QCS +  C+    G  Y+G ++ T++ + C  W+ +   +  +  P   +      N+CRNP NN   PWC+     T + +C I  C   S +    +    ++C     G  Y G +++T    TC  W+  S +   Y  P  +    + E  NYCRNP    + PWC+T      + +C+ +P+C 
Sbjct:  121 YKGRRSFTKTGITCQSWNMSVPHEHN---FKPTRHKKSDLR----------------QNFCRNPDNDPNGPWCFTELTETRHQDCGLPQCSDV-ECMKCN-GETYRGPMDHTESGKECQRWDSQKP-HKHTYQPHRHVGKGLDDNFCRNP-NNDVRPWCYTMDKNTPWEYCNISVCDSDSDV----EVEVTSSC-FRGQGEGYRGTVNVTPAGVTCQRWDALSPHIHSYT-PHNYKCKDLRE--NYCRNPDGSEI-PWCFTTDAKVRKAFCTNIPRCE 366          

HSP 3 Score: 74.3294 bits (181), Expect = 3.727e-14
Identity = 60/200 (30.00%), Postives = 86/200 (43.00%), Query Frame = 1
Query:  289 DLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANAS---NYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            DLY KK    +C  I G      G  Y+G  + T T   C +WN+  S+  + NF       +    N+CRNP N+  GPWC+ +   TR   C +P C     +                 G  Y G +  T +   C  W++   +   Y QP       + +  N+CRNP+ND   PWCYTM      EYC++  C+
Sbjct:  102 DLYEKKDYVREC--IIGS-----GVNYKGRRSFTKTGITCQSWNM--SVPHEHNFKPTRHKKSDLRQNFCRNPDNDPNGPWCFTELTETRHQDCGLPQCSDVECMK--------------CNGETYRGPMDHTESGKECQRWDSQKPHKHTY-QPHRHVGKGLDD--NFCRNPNNDVR-PWCYTMDKNTPWEYCNISVCD 274          
BLAST of plasminogen-1 vs. Ensembl Zebrafish
Match: hgfa (hepatocyte growth factor a [Source:ZFIN;Acc:ZDB-GENE-041014-2])

HSP 1 Score: 80.1073 bits (196), Expect = 4.270e-16
Identity = 72/244 (29.51%), Postives = 103/244 (42.21%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYC---------KTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN--ASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT--MSGVQEYCSVPQCNISQTTGSLKKNTVI 915
             N+CRN +ND V  WCY  + +   + YC           +      C   + G  Y+GTVN+T     C  W+   S +  S  P N        NYCRNP  +   PWC+      R  FC  IP C+        +++S +  C     G  Y GN+S T +   C LW+  +F      +      ++     N CRNP  D  GPWCYT   S   +YC + +C   + +  + K T I
Sbjct:  242 DNFCRNPNND-VRPWCYTMDKNTPWE-YCNISVCDSDSDVEVEVTSSCFRGQ-GEGYRGTVNVTPAGVTCQRWDAL-SPHIHSYTPHNYKCKDLRENYCRNPDGSEI-PWCFTTDAKVRKAFCTNIPRCE--------SESSDSTECYEDN-GESYRGNLSKTRSGIPCGLWSDHTF-----RRDTRSAKASAGLELNLCRNPDRDKHGPWCYTSNSSIPWDYCGLERCGGPKPSCFIHKTTRI 466          

HSP 2 Score: 79.337 bits (194), Expect = 9.054e-16
Identity = 72/278 (25.90%), Postives = 120/278 (43.17%), Query Frame = 1
Query:   58 FKSQTSTEQFLESCVPW-MSVPLQYNNLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANA--SNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCS-VPQCN 873
            +K + S  +   +C  W MSVP ++N     P+    S++                  N+CRN DND  G WC+    +   +     QCS +  C+    G  Y+G ++ T++ + C  W+ +   +  +  P   +      N+CRNP NN   PWC+     T + +C I  C   S +    +    ++C     G  Y G +++T    TC  W+  S +   Y  P  +    + E  NYCRNP    + PWC+T      + +C+ +P+C 
Sbjct:  121 YKGRRSFTKTGITCQSWNMSVPHEHN---FKPTRHKKSDLR----------------QNFCRNPDNDPNGPWCFTELTETRHQDCGLPQCSDV-ECMKCN-GETYRGPMDHTESGKECQRWDSQ-KPHKHTYQPHRHVGKGLDDNFCRNP-NNDVRPWCYTMDKNTPWEYCNISVCDSDSDV----EVEVTSSC-FRGQGEGYRGTVNVTPAGVTCQRWDALSPHIHSYT-PHNYKCKDLRE--NYCRNPDGSEI-PWCFTTDAKVRKAFCTNIPRCE 366          

HSP 3 Score: 73.9442 bits (180), Expect = 4.474e-14
Identity = 60/200 (30.00%), Postives = 86/200 (43.00%), Query Frame = 1
Query:  289 DLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANAS---NYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            DLY KK    +C  I G      G  Y+G  + T T   C +WN+  S+  + NF       +    N+CRNP N+  GPWC+ +   TR   C +P C     +                 G  Y G +  T +   C  W++   +   Y QP       + +  N+CRNP+ND   PWCYTM      EYC++  C+
Sbjct:  102 DLYEKKDYVREC--IIGS-----GVNYKGRRSFTKTGITCQSWNM--SVPHEHNFKPTRHKKSDLRQNFCRNPDNDPNGPWCFTELTETRHQDCGLPQCSDVECMK--------------CNGETYRGPMDHTESGKECQRWDSQKPHKHTY-QPHRHVGKGLDD--NFCRNPNNDVR-PWCYTMDKNTPWEYCNISVCD 274          
BLAST of plasminogen-1 vs. Ensembl Xenopus
Match: ENSXETT00000025429.1 (plasminogen [Source:NCBI gene;Acc:100496227])

HSP 1 Score: 103.605 bits (257), Expect = 1.041e-23
Identity = 89/281 (31.67%), Postives = 128/281 (45.55%), Query Frame = 1
Query:  178 PIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNISQT------TGSLKKNTVI-QIESKILVLTCCAILAFISVTG 981
            P F P   P+       N+CRN DND  G WCY  +  +   +YC   QC     C++   G  Y+G ++ T +   C NW+ +      Y+ SN P+ ++    NYCRNP +    PWC+  +   R+  C IP C  + P      TS       +  G  Y+GNI++T +  TC  W   S   P+ +     N        NYCRNP  ++M PWCYT       EYC++P C+          TG+ K  TV+ Q E  I         A+I+V+G
Sbjct:  110 PNFTPEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRF-EYCNIPQCEE--DCMHCS-GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER--NYCRNP-DGEPRPWCFTTNPNKRWEHCNIPRCTTNPP------TSAPGVQCLSGKGENYSGNIAVTASGKTCQEW---SLQVPHKHIRTPDNYPCKNLEKNYCRNPDGESM-PWCYTTDSETRWEYCNIPSCDAPTVNEQLSPTGTPKGITVLRQREGAIYKY---RGTAYITVSG 368          

HSP 2 Score: 87.8113 bits (216), Expect = 1.945e-18
Identity = 75/248 (30.24%), Postives = 117/248 (47.18%), Query Frame = 1
Query:  184 FHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCS--------GIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSS---PLAPLTKTSGNATCKSTAIGG--EYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT--MSGVQEYCSVPQCN 873
            + P+ +PD++     NYCRN D +    WC+  N +   +     +C+        G+  CL  + G  Y G + +T + + C  W+L+     + T  N+P  ++    NYCRNP +    PWC+   + TR+ +C IP C   +    L+P T T    T      G   +Y G   IT +   C  WN+ + +  +   P  F  + + +  NYCRNP  D  GPWCYT   S   EYCS+ +C+
Sbjct:  194 YSPSNIPDKNLE--RNYCRNPDGEPR-PWCFTTNPNKRWEHCNIPRCTTNPPTSAPGV-QCLSGK-GENYSGNIAVTASGKTCQEWSLQVPHKHIRTPDNYPCKNLEK--NYCRNP-DGESMPWCYTTDSETRWEYCNIPSCDAPTVNEQLSP-TGTPKGITVLRQREGAIYKYRGTAYITVSGKKCQPWNSQTPHK-HTKMPDNFPNAGLEQ--NYCRNPDED-KGPWCYTTDASVRWEYCSLKKCS 428          

HSP 3 Score: 84.3445 bits (207), Expect = 3.207e-17
Identity = 72/244 (29.51%), Postives = 107/244 (43.85%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQC----------------SGIWGCLYDRIGSYYQ--GTVNITDTNQACANWNLKGSLYTDSNFPEN--SIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQ--SSPLAPLTKTSGNATCKS----TAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCY-TMSGVQ--EYCSVPQC 870
             NYCRN D +++  WCY  + +   + YC                     GI   L  R G+ Y+  GT  IT + + C  WN + + +  +  P+N  +     NYCRNP  ++G PWC+      R+ +C +  C +  S+   P+  T       S     + G +Y G  S T N + C  W++ S        P+    S +    NYCRNP  D  GPWC+ T  G    EYC +P+C
Sbjct:  296 KNYCRNPDGESM-PWCYTTDSETRWE-YCNIPSCDAPTVNEQLSPTGTPKGI-TVLRQREGAIYKYRGTAYITVSGKKCQPWNSQ-TPHKHTKMPDNFPNAGLEQNYCRNPDEDKG-PWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTSPDCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLES--NYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRC 532          

HSP 4 Score: 78.5666 bits (192), Expect = 2.287e-15
Identity = 55/184 (29.89%), Postives = 86/184 (46.74%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANAS---NYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNISQTTGS 894
            G  Y+GT + T + + C NW   GS     NF      NA    N+CRNP N+  GPWC+      RF +C IP C++               C   + G  Y G IS T +   C  W++ + ++  Y+   + + +      NYCRNP  +   PWC+T +  +  E+C++P+C  +  T +
Sbjct:   83 GKDYRGTESKTHSGKTCQNWT--GSFPHVPNFTPEKFPNAGLEGNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQCEED--------------CMHCS-GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER---NYCRNPDGEPR-PWCFTTNPNKRWEHCNIPRCTTNPPTSA 245          

HSP 5 Score: 53.9138 bits (128), Expect = 2.640e-7
Identity = 31/81 (38.27%), Postives = 39/81 (48.15%), Query Frame = 1
Query:  637 TAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT--MSGVQEYCSVPQCN 873
            T  G +Y G  S T +  TC  W  +  + P +      N        N+CRNP ND  GPWCYT   S   EYC++PQC 
Sbjct:   80 TGKGKDYRGTESKTHSGKTCQNWTGSFPHVPNFTPEKFPNAGLEG---NFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQCE 157          
BLAST of plasminogen-1 vs. Ensembl Xenopus
Match: ENSXETT00000037813.1 (plasminogen [Source:NCBI gene;Acc:100496227])

HSP 1 Score: 103.605 bits (257), Expect = 1.075e-23
Identity = 77/238 (32.35%), Postives = 109/238 (45.80%), Query Frame = 1
Query:  178 PIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            P F P   P+       N+CRN DND  G WCY  +  +   +YC   QC     C     G  Y+G ++ T +   C NW+ +      Y+ SN P+ ++    NYCRNP +    PWC+  +   R+  C IP C  + P      TS       +  G  Y+GNI++T +  TC  W   S   P+ +     N        NYCRNP  ++M PWCYT       EYC++P C+
Sbjct:  110 PNFTPEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRF-EYCNIPQCEDCMHC----SGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER--NYCRNP-DGEPRPWCFTTNPNKRWEHCNIPRCTTNPP------TSAPGVQCLSGKGENYSGNIAVTASGKTCQEW---SLQVPHKHIRTPDNYPCKNLEKNYCRNPDGESM-PWCYTTDSETRWEYCNIPSCD 327          

HSP 2 Score: 90.5077 bits (223), Expect = 2.485e-19
Identity = 79/252 (31.35%), Postives = 111/252 (44.05%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYC-------------KTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPEN--SIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFC-------QQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCY-TMSGVQ--EYCSVPQCNISQTTGSLKKN 906
             NYCRN D +++  WCY  + +   + YC              T  S I  C YD  GS Y+GT  IT + + C  WN + + +  +  P+N  +     NYCRNP  ++G PWC+      R+ +C +  C       Q+  P A    TS N      + G +Y G  S T N + C  W++ S        P+    S +    NYCRNP  D  GPWC+ T  G    EYC +P+       G  KK 
Sbjct:  295 KNYCRNPDGESM-PWCYTTDSETRWE-YCNIPSCDAPTVNAAPTNPSTILEC-YDGNGSKYRGTAYITVSGKKCQPWNSQ-TPHKHTKMPDNFPNAGLEQNYCRNPDEDKG-PWCYTTDASVRWEYCSLKKCSELPSTEQRPRPKARPPPTSSNCI---VSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLES--NYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRSTTGIECGKPKKK 536          

HSP 3 Score: 77.0258 bits (188), Expect = 6.453e-15
Identity = 63/213 (29.58%), Postives = 96/213 (45.07%), Query Frame = 1
Query:  274 YVRNG-DLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANAS---NYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNISQTTGS 894
            + RNG  LY K+    +C  I G      G  Y+GT + T + + C NW   GS     NF      NA    N+CRNP N+  GPWC+      RF +C IP C+     +                G  Y G IS T +   C  W++ + ++  Y+   + + +      NYCRNP  +   PWC+T +  +  E+C++P+C  +  T +
Sbjct:   61 HRRNGVALYEKRIYLKEC--ITG-----KGKDYRGTESKTHSGKTCQNWT--GSFPHVPNFTPEKFPNAGLEGNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQCEDCMHCS----------------GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER---NYCRNPDGEPR-PWCFTTNPNKRWEHCNIPRCTTNPPTSA 244          
BLAST of plasminogen-1 vs. Ensembl Xenopus
Match: ENSXETT00000037804.1 (plasminogen [Source:NCBI gene;Acc:100496227])

HSP 1 Score: 101.679 bits (252), Expect = 4.649e-23
Identity = 77/238 (32.35%), Postives = 111/238 (46.64%), Query Frame = 1
Query:  178 PIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            P F P   P+       N+CRN DND  G WCY  +  +  + YC   QC     C++   G  Y+G ++ T +   C NW+ +      Y+ SN P+ ++    NYCRNP +    PWC+  +   R+  C IP C  + P      TS       +  G  Y+GNI++T +  TC  W   S   P+ +     N        NYCRNP  ++M PWCYT       EYC++P C+
Sbjct:  114 PNFTPEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRFE-YCNIPQCEE--DCMHCS-GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER--NYCRNP-DGEPRPWCFTTNPNKRWEHCNIPRCTTNPP------TSAPGVQCLSGKGENYSGNIAVTASGKTCQEW---SLQVPHKHIRTPDNYPCKNLEKNYCRNPDGESM-PWCYTTDSETRWEYCNIPSCD 332          

HSP 2 Score: 95.5153 bits (236), Expect = 5.182e-21
Identity = 75/233 (32.19%), Postives = 108/233 (46.35%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYC-------------KTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPEN--SIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCY-TMSGVQ--EYCSVPQC 870
             NYCRN D +++  WCY  + +   + YC              T  S I  C YD  GS Y+GT  IT + + C  WN + + +  +  P+N  +     NYCRNP  ++G PWC+      R+ +C +  C +     P T+     T +S   G +Y G  S T N + C  W++ S        P+    S +    NYCRNP  D  GPWC+ T  G    EYC +P+C
Sbjct:  300 KNYCRNPDGESM-PWCYTTDSETRWE-YCNIPSCDAPTVNAAPTNPSTILEC-YDGNGSKYRGTAYITVSGKKCQPWNSQ-TPHKHTKMPDNFPNAGLEQNYCRNPDEDKG-PWCYTTDASVRWEYCSLKKCSE----LPSTEQRPPQTTESPK-GEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLES--NYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRC 520          

HSP 3 Score: 80.4925 bits (197), Expect = 5.059e-16
Identity = 69/248 (27.82%), Postives = 104/248 (41.94%), Query Frame = 1
Query:  181 IFHPAILPDESF--ADASNYCRNLDND---TVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANAS---NYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNISQTTGS 894
             +H   + D  F   D  N   NL +D   T GAW       LY               L     S+ +GT + T + + C NW   GS     NF      NA    N+CRNP N+  GPWC+      RF +C IP C++               C   + G  Y G IS T +   C  W++ + ++  Y+   + + +      NYCRNP  +   PWC+T +  +  E+C++P+C  +  T +
Sbjct:   23 FYHGRFIADLLFIWKDTQNLLGNLLDDYMKTEGAWMVSEKRSLYTSTSELECAEKSLKSLKISNFSFIEGTESKTHSGKTCQNWT--GSFPHVPNFTPEKFPNAGLEGNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQCEED--------------CMHCS-GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER---NYCRNPDGEPR-PWCFTTNPNKRWEHCNIPRCTTNPPTSA 249          
BLAST of plasminogen-1 vs. Ensembl Xenopus
Match: ENSXETT00000037863.1 (plasminogen [Source:NCBI gene;Acc:100496227])

HSP 1 Score: 101.679 bits (252), Expect = 4.769e-23
Identity = 77/238 (32.35%), Postives = 111/238 (46.64%), Query Frame = 1
Query:  178 PIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            P F P   P+       N+CRN DND  G WCY  +  +   +YC   QC     C++   G  Y+G ++ T +   C NW+ +      Y+ SN P+ ++    NYCRNP +    PWC+  +   R+  C IP C  + P      TS       +  G  Y+GNI++T +  TC  W   S   P+ +     N        NYCRNP  ++M PWCYT       EYC++P C+
Sbjct:  110 PNFTPEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRF-EYCNIPQCEE--DCMHCS-GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER--NYCRNP-DGEPRPWCFTTNPNKRWEHCNIPRCTTNPP------TSAPGVQCLSGKGENYSGNIAVTASGKTCQEW---SLQVPHKHIRTPDNYPCKNLEKNYCRNPDGESM-PWCYTTDSETRWEYCNIPSCD 328          

HSP 2 Score: 92.8189 bits (229), Expect = 4.138e-20
Identity = 75/239 (31.38%), Postives = 109/239 (45.61%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYC-------------KTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPEN--SIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQ--SSPLAPLTKTSGNATCKS----TAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCY-TMSGVQ--EYCSVPQC 870
             NYCRN D +++  WCY  + +   + YC              T  S I  C YD  GS Y+GT  IT + + C  WN + + +  +  P+N  +     NYCRNP  ++G PWC+      R+ +C +  C +  S+   P+  T       S     + G +Y G  S T N + C  W++ S        P+    S +    NYCRNP  D  GPWC+ T  G    EYC +P+C
Sbjct:  296 KNYCRNPDGESM-PWCYTTDSETRWE-YCNIPSCDAPTVNAAPTNPSTILEC-YDGNGSKYRGTAYITVSGKKCQPWNSQ-TPHKHTKMPDNFPNAGLEQNYCRNPDEDKG-PWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTSPDCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLES--NYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRC 527          

HSP 3 Score: 78.5666 bits (192), Expect = 2.395e-15
Identity = 64/213 (30.05%), Postives = 98/213 (46.01%), Query Frame = 1
Query:  274 YVRNG-DLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANAS---NYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNISQTTGS 894
            + RNG  LY K+    +C  I G      G  Y+GT + T + + C NW   GS     NF      NA    N+CRNP N+  GPWC+      RF +C IP C++               C   + G  Y G IS T +   C  W++ + ++  Y+   + + +      NYCRNP  +   PWC+T +  +  E+C++P+C  +  T +
Sbjct:   61 HRRNGVALYEKRIYLKEC--ITG-----KGKDYRGTESKTHSGKTCQNWT--GSFPHVPNFTPEKFPNAGLEGNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQCEED--------------CMHCS-GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER---NYCRNPDGEPR-PWCFTTNPNKRWEHCNIPRCTTNPPTSA 245          
BLAST of plasminogen-1 vs. Ensembl Xenopus
Match: ENSXETT00000025361.1 (plasminogen [Source:NCBI gene;Acc:100496227])

HSP 1 Score: 101.293 bits (251), Expect = 6.279e-23
Identity = 77/238 (32.35%), Postives = 111/238 (46.64%), Query Frame = 1
Query:  178 PIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            P F P   P+       N+CRN DND  G WCY  +  +   +YC   QC     C++   G  Y+G ++ T +   C NW+ +      Y+ SN P+ ++    NYCRNP +    PWC+  +   R+  C IP C  + P      TS       +  G  Y+GNI++T +  TC  W   S   P+ +     N        NYCRNP  ++M PWCYT       EYC++P C+
Sbjct:   43 PNFTPEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRF-EYCNIPQCEE--DCMHCS-GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER--NYCRNP-DGEPRPWCFTTNPNKRWEHCNIPRCTTNPP------TSAPGVQCLSGKGENYSGNIAVTASGKTCQEW---SLQVPHKHIRTPDNYPCKNLEKNYCRNPDGESM-PWCYTTDSETRWEYCNIPSCD 261          

HSP 2 Score: 85.1149 bits (209), Expect = 1.636e-17
Identity = 68/235 (28.94%), Postives = 104/235 (44.26%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYC-----------KTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPEN--SIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQ--SSPLAPLTKTSGNATCKSTAI--GGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCY-TMSGVQ--EYCSVPQC 870
             NYCRN D +++  WCY  + +   + YC             +     G    R    Y+GT  IT + + C  WN + + +  +  P+N  +     NYCRNP  ++G PWC+      R+ +C +  C +  S+   P+  T       +  +  G +Y G  S T N + C  W++ S        P+    S +    NYCRNP  D  GPWC+ T  G    EYC +P+C
Sbjct:  229 KNYCRNPDGESM-PWCYTTDSETRWE-YCNIPSCDAPTVNDRKLPQQRGTYQARGQLKYRGTAYITVSGKKCQPWNSQ-TPHKHTKMPDNFPNAGLEQNYCRNPDEDKG-PWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTNCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLES--NYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRC 457          

HSP 3 Score: 78.1814 bits (191), Expect = 2.698e-15
Identity = 55/184 (29.89%), Postives = 86/184 (46.74%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANAS---NYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNISQTTGS 894
            G  Y+GT + T + + C NW   GS     NF      NA    N+CRNP N+  GPWC+      RF +C IP C++               C   + G  Y G IS T +   C  W++ + ++  Y+   + + +      NYCRNP  +   PWC+T +  +  E+C++P+C  +  T +
Sbjct:   16 GKDYRGTESKTHSGKTCQNWT--GSFPHVPNFTPEKFPNAGLEGNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQCEED--------------CMHCS-GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER---NYCRNPDGEPR-PWCFTTNPNKRWEHCNIPRCTTNPPTSA 178          

HSP 4 Score: 53.5286 bits (127), Expect = 2.745e-7
Identity = 31/81 (38.27%), Postives = 39/81 (48.15%), Query Frame = 1
Query:  637 TAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT--MSGVQEYCSVPQCN 873
            T  G +Y G  S T +  TC  W  +  + P +      N        N+CRNP ND  GPWCYT   S   EYC++PQC 
Sbjct:   13 TGKGKDYRGTESKTHSGKTCQNWTGSFPHVPNFTPEKFPNAGLEG---NFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQCE 90          
BLAST of plasminogen-1 vs. Ensembl Mouse
Match: Plg (plasminogen [Source:MGI Symbol;Acc:MGI:97620])

HSP 1 Score: 98.2117 bits (243), Expect = 5.646e-22
Identity = 76/240 (31.67%), Postives = 106/240 (44.17%), Query Frame = 1
Query:  178 PIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNIS 879
            P + P+  P+E   +  NYCRN DND  G WCY  + D     YC   +C     C+Y   G  Y+G ++ T +   C  W+ +      Y  + FP  ++    NYCRNP +    PWC+      R+ +C IP C            S    C     G  Y G +S+T +  TC  W+  + +  +   P  F    + E  NYCRNP  +T  PWCYT       EYC +P C  S
Sbjct:  135 PNYSPSTHPNEGLEE--NYCRNPDNDEQGPWCYTTDPDKRY-DYCNIPECEE--ECMYCS-GEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPAKFPSKNL--KMNYCRNP-DGEPRPWCFTTDPTKRWEYCDIPRCTTPP-----PPPSPTYQCLK-GRGENYRGTVSVTVSGKTCQRWSEQTPHR-HNRTPENFPCKNLEE--NYCRNPDGET-APWCYTTDSQLRWEYCEIPSCESS 355          

HSP 2 Score: 85.1149 bits (209), Expect = 1.087e-17
Identity = 56/177 (31.64%), Postives = 82/177 (46.33%), Query Frame = 1
Query:  355 IGSYYQGTVNITDTNQACANWNLKGSL---YTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            IG+ Y+GT++ T +  AC  W         Y+ S  P   +    NYCRNP N+  GPWC+      R+ +C IP C++               C   + G +Y G IS T +   C  W++ S +   Y  P  F +  +    NYCRNP  +   PWC+T    +  EYC +P+C
Sbjct:  107 IGNGYRGTMSRTKSGVACQKWGATFPHVPNYSPSTHPNEGLEE--NYCRNPDNDEQGPWCYTTDPDKRYDYCNIPECEEE--------------CMYCS-GEKYEGKISKTMSGLDCQAWDSQSPHAHGY-IPAKFPSKNLK--MNYCRNPDGEPR-PWCFTTDPTKRWEYCDIPRC 262          

HSP 3 Score: 83.5741 bits (205), Expect = 4.285e-17
Identity = 70/249 (28.11%), Postives = 103/249 (41.37%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCK--------------------TQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNL---KGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSS-PLAPLTKTSGNATCKSTAI-------GGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVF-NYCRNPSNDTMGPWCYTM--SGVQEYCSVPQC 870
             NYCRN D +T   WCY  +  L  + YC+                     Q   +  C Y   G  Y+GT + T T + C +W          T  NFP+  +    NYCRNP  ++G PWC+      R+ +C +  C ++   +  L   S   +  S +        G +Y G  ++T     C  W   +   P+ +      T+  A +  NYCRNP  D  GPWCYT     + +YC +P C
Sbjct:  321 ENYCRNPDGETA-PWCYTTDSQLRWE-YCEIPSCESSASPDQSDSSVPPEEQTPVVQEC-YQSDGQSYRGTSSTTITGKKCQSWAAMFPHRHSKTPENFPDAGLE--MNYCRNPDGDKG-PWCYTTDPSVRWEYCNLKRCSETGGSVVELPTVSQEPSGPSDSETDCMYGNGKDYRGKTAVTAAGTPCQGW---AAQEPHRHSIFTPQTNPRAGLEKNYCRNPDGDVNGPWCYTTNPRKLYDYCDIPLC 560          

HSP 4 Score: 60.4622 bits (145), Expect = 1.279e-9
Identity = 49/177 (27.68%), Postives = 68/177 (38.42%), Query Frame = 1
Query:  208 ESFADAS---NYCRNLDNDTVGAWCYVRNGDLYIKKYCK-TQCSGIWG---------------------CLYDRIGSYYQGTVNITDTNQACANWNL----KGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGG 651
            E+F DA    NYCRN D D  G WCY  +  +  + YC   +CS   G                     C+Y   G  Y+G   +T     C  W      + S++T    P   +    NYCRNP  +  GPWC+  +    + +C IP C  +S             C    +GG
Sbjct:  414 ENFPDAGLEMNYCRNPDGDK-GPWCYTTDPSVRWE-YCNLKRCSETGGSVVELPTVSQEPSGPSDSETDCMYGN-GKDYRGKTAVTAAGTPCQGWAAQEPHRHSIFTPQTNPRAGLEK--NYCRNPDGDVNGPWCYTTNPRKLYDYCDIPLCASASSFECGKPQVEPKKCPGRVVGG 585          

HSP 5 Score: 58.5362 bits (140), Expect = 5.386e-9
Identity = 34/86 (39.53%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  622 ATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            + CK T IG  Y G +S T +   C  W  T  + P Y+ P       + E  NYCRNP ND  GPWCYT    +  +YC++P+C 
Sbjct:  101 SECK-TGIGNGYRGTMSRTKSGVACQKWGATFPHVPNYS-PSTHPNEGLEE--NYCRNPDNDEQGPWCYTTDPDKRYDYCNIPECE 182          
BLAST of plasminogen-1 vs. Ensembl Mouse
Match: Mst1 (macrophage stimulating 1 (hepatocyte growth factor-like) [Source:MGI Symbol;Acc:MGI:96080])

HSP 1 Score: 88.1965 bits (217), Expect = 1.074e-18
Identity = 75/285 (26.32%), Postives = 120/285 (42.11%), Query Frame = 1
Query:  184 FHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYC-------KTQCSGIWGCL--YDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN--ASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCSVPQCNISQTTGSLKKNTVIQIESKILVLTCCAILA---FISVTGGH 987
            F P    D+   D  NYCRN D  +   WCY  + ++  +++C       K+Q       L  +   G  Y+GT N T     C  W+ + S +     PE         N+CRNP  +   PWC+      R  FC +IP C +   L P     G+        G +Y G++S T     C  W++ + + P +           A   N+CRNP  D+ GPWCYT+    + +YC++ +C+  Q        +++    +++   C   +     + V GGH
Sbjct:  225 FQPEKFLDKDLKD--NYCRNPDG-SERPWCYTTDPNVE-REFCDLPSCGSKSQRRNKGKALNCFRGKGEDYRGTTNTTSAGVPCQRWDAQ-SPHQHRFVPEKYACKDLRENFCRNPDGSEA-PWCFTSRPGLRMAFCHQIPRCTEE--LVPEGCYHGS--------GEQYRGSVSKTRKGVQCQHWSSETPHKPQFTPTSAPQAGLEA---NFCRNPDGDSHGPWCYTLDPDILFDYCALQRCDDDQPP------SILDPPDQVVFEKCGKRVDKSNKLRVVGGH 484          

HSP 2 Score: 80.8777 bits (198), Expect = 3.095e-16
Identity = 57/204 (27.94%), Postives = 88/204 (43.14%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN--ASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT 831
             N+CRN D D  G WCY  N  +  +      C      L +  G  Y+G V++T++ + C  W+L+   ++    PE  +      NYCRNP  +   PWC+         FC +P C   S      +  G A       G +Y G  + T+    C  W+  S +   +  P  +    + E  N+CRNP + +  PWC+T
Sbjct:  154 ENFCRNPDGDPRGPWCYTTNRSVRFQSCGIKTCREAVCVLCN--GEDYRGEVDVTESGRECQRWDLQHP-HSHPFQPEKFLDKDLKDNYCRNPDGSE-RPWCYTTDPNVEREFCDLPSCGSKS----QRRNKGKALNCFRGKGEDYRGTTNTTSAGVPCQRWDAQSPHQHRF-VPEKYACKDLRE--NFCRNP-DGSEAPWCFT 345          

HSP 3 Score: 72.0182 bits (175), Expect = 2.732e-13
Identity = 54/182 (29.67%), Postives = 82/182 (45.05%), Query Frame = 1
Query:  340 CLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCSVPQC 870
            C+ D  G  Y+GTV  T     C  W+ +      YT +  P+N +    N+CRNP  +  GPWC+  +   RF  C I  C++             A C     G +Y G + +T +   C  W+    ++  + QP  F    + +  NYCRNP + +  PWCYT      +E+C +P C
Sbjct:  110 CIMDN-GVSYRGTVARTAGGLPCQAWSRRFPNDHKYTPT--PKNGLE--ENFCRNPDGDPRGPWCYTTNRSVRFQSCGIKTCRE-------------AVC-VLCNGEDYRGEVDVTESGRECQRWDLQHPHSHPF-QPEKFLDKDLKD--NYCRNP-DGSERPWCYTTDPNVEREFCDLPSC 268          
BLAST of plasminogen-1 vs. Ensembl Mouse
Match: Mst1 (macrophage stimulating 1 (hepatocyte growth factor-like) [Source:MGI Symbol;Acc:MGI:96080])

HSP 1 Score: 85.5001 bits (210), Expect = 8.390e-18
Identity = 75/294 (25.51%), Postives = 119/294 (40.48%), Query Frame = 1
Query:  184 FHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSG------IWGCLYDR------------IGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN--ASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCSVPQCNISQTTGSLKKNTVIQIESKILVLTCCAILA---FISVTGGH 987
            F P    D+   D  NYCRN D  +   WCY  + ++  +++C     G      + G    R             G  Y+GT N T     C  W+ + S +     PE         N+CRNP  +   PWC+      R  FC +IP C +   L P     G+        G +Y G++S T     C  W++ + + P +           A   N+CRNP  D+ GPWCYT+    + +YC++ +C+  Q        +++    +++   C   +     + V GGH
Sbjct:  225 FQPEKFLDKDLKD--NYCRNPDG-SERPWCYTTDPNVE-REFCDLPSCGPNLPPTVKGSKSQRRNKGKALNCFRGKGEDYRGTTNTTSAGVPCQRWDAQ-SPHQHRFVPEKYACKDLRENFCRNPDGSEA-PWCFTSRPGLRMAFCHQIPRCTEE--LVPEGCYHGS--------GEQYRGSVSKTRKGVQCQHWSSETPHKPQFTPTSAPQAGLEA---NFCRNPDGDSHGPWCYTLDPDILFDYCALQRCDDDQPP------SILDPPDQVVFEKCGKRVDKSNKLRVVGGH 493          

HSP 2 Score: 79.337 bits (194), Expect = 8.775e-16
Identity = 60/211 (28.44%), Postives = 91/211 (43.13%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN--ASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTS-------GNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT 831
             N+CRN D D  G WCY  N  +  +      C      L +  G  Y+G V++T++ + C  W+L+   ++    PE  +      NYCRNP  +   PWC+         FC +P C  + P  P  K S       G A       G +Y G  + T+    C  W+  S +   +  P  +    + E  N+CRNP + +  PWC+T
Sbjct:  154 ENFCRNPDGDPRGPWCYTTNRSVRFQSCGIKTCREAVCVLCN--GEDYRGEVDVTESGRECQRWDLQHP-HSHPFQPEKFLDKDLKDNYCRNPDGSE-RPWCYTTDPNVEREFCDLPSCGPNLP--PTVKGSKSQRRNKGKALNCFRGKGEDYRGTTNTTSAGVPCQRWDAQSPHQHRF-VPEKYACKDLRE--NFCRNP-DGSEAPWCFT 354          

HSP 3 Score: 71.633 bits (174), Expect = 2.798e-13
Identity = 54/182 (29.67%), Postives = 82/182 (45.05%), Query Frame = 1
Query:  340 CLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCSVPQC 870
            C+ D  G  Y+GTV  T     C  W+ +      YT +  P+N +    N+CRNP  +  GPWC+  +   RF  C I  C++             A C     G +Y G + +T +   C  W+    ++  + QP  F    + +  NYCRNP + +  PWCYT      +E+C +P C
Sbjct:  110 CIMDN-GVSYRGTVARTAGGLPCQAWSRRFPNDHKYTPT--PKNGLE--ENFCRNPDGDPRGPWCYTTNRSVRFQSCGIKTCRE-------------AVC-VLCNGEDYRGEVDVTESGRECQRWDLQHPHSHPF-QPEKFLDKDLKD--NYCRNP-DGSERPWCYTTDPNVEREFCDLPSC 268          
BLAST of plasminogen-1 vs. Ensembl Mouse
Match: F2 (coagulation factor II [Source:MGI Symbol;Acc:MGI:88380])

HSP 1 Score: 81.6481 bits (200), Expect = 1.539e-16
Identity = 62/198 (31.31%), Postives = 85/198 (42.93%), Query Frame = 1
Query:  340 CLYDR----IGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN-ASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCK--------STAIGGEYAGNISITTNNNTCALWN-----TTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMS--GVQEYCSVPQCN 873
            CL  R    +G  Y GTVN+T T   C  W  +     + N   +  A+   N+CRNP ++  GPWC+      R   C +P CQ+      +T  SG +            T  G  Y GN+++TT  + C  WN     T S Y  +  +  L        V N+CRNP  D  G WCY     G  EYC++  C 
Sbjct:  104 CLEGRCAMDLGVNYLGTVNVTHTGIQCQLWRSRYPHKPEINSTTHPGADLKENFCRNPDSSTTGPWCYTTDPTVRREECSVPVCQEGRTTVVMTPRSGGSKDNLSPPLGQCLTERGRLYQGNLAVTTLGSPCLPWNSLPAKTLSKYQDFDPEVKL--------VENFCRNPDWDEEGAWCYVAGQPGDFEYCNLNYCE 293          

HSP 2 Score: 53.9138 bits (128), Expect = 1.808e-7
Identity = 31/85 (36.47%), Postives = 43/85 (50.59%), Query Frame = 1
Query:  643 IGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEV-FNYCRNPSNDTMGPWCYTMSGV--QEYCSVPQCNISQTT 888
            +G  Y G +++T     C LW +   + P  N      T   A++  N+CRNP + T GPWCYT      +E CSVP C   +TT
Sbjct:  113 LGVNYLGTVNVTHTGIQCQLWRSRYPHKPEINS----TTHPGADLKENFCRNPDSSTTGPWCYTTDPTVRREECSVPVCQEGRTT 193          

HSP 3 Score: 53.5286 bits (127), Expect = 2.065e-7
Identity = 38/142 (26.76%), Postives = 59/142 (41.55%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCY-----VRNGDLYI-------KKYCKTQCSG---------IWGCLYDRIGSYYQGTVNITDTNQACANWN-LKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQS 585
             N+CRN D+ T G WCY     VR  +  +            T  SG         +  CL +R G  YQG + +T     C  WN L     +     +  +    N+CRNP  +  G WC++      F +C + +C+++
Sbjct:  155 ENFCRNPDSSTTGPWCYTTDPTVRREECSVPVCQEGRTTVVMTPRSGGSKDNLSPPLGQCLTER-GRLYQGNLAVTTLGSPCLPWNSLPAKTLSKYQDFDPEVKLVENFCRNPDWDEEGAWCYVAGQPGDFEYCNLNYCEEA 295          
BLAST of plasminogen-1 vs. Ensembl Mouse
Match: Hgf (hepatocyte growth factor [Source:MGI Symbol;Acc:MGI:96079])

HSP 1 Score: 81.2629 bits (199), Expect = 1.984e-16
Identity = 83/290 (28.62%), Postives = 119/290 (41.03%), Query Frame = 1
Query:  184 FHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRI----------------GSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN--ASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALW--NTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGV--QEYCSVPQCNISQTTGSLKKNTVIQIESKILVLTCCAILAFISVTGG 984
            F P   PD+ F D  NYCRN D      WCY  + D   + YC      I  C +  +                G  Y+GT N       C  W+ +     D   PEN        NYCRNP +    PWC+      R G+C +IP C  SS         G    +    G  Y GN+S T +  TC++W  N    +   + +P   + S + +  NYCRNP +D  GPWCYT + +   +YC + +C    T       T++ ++  ++    CA    + V  G
Sbjct:  246 FLPERYPDKGFDD--NYCRNPDGKPR-PWCYTLDPDTPWE-YC-----AIKTCAHSAVNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDIT-PENFKCKDLRENYCRNP-DGAESPWCFTTDPNIRVGYCSQIPKCDVSS---------GQDCYRGN--GKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEP---DASKLNK--NYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTP------TIVNLDHPVIS---CAKTKQLRVVNG 499          

HSP 2 Score: 75.0998 bits (183), Expect = 2.373e-14
Identity = 55/185 (29.73%), Postives = 80/185 (43.24%), Query Frame = 1
Query:  331 IWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANA---SNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            I  C+  + GSY +GTV+IT +   C  WN    +  + +F  +S        NYCRNP    GGPWC+  +   R+  C IP C +   +              T  G  Y G +  T +  TC  W+  +   P+ ++ +           NYCRNP      PWCYT+      EYC++  C
Sbjct:  126 IRNCIIGKGGSY-KGTVSITKSGIKCQPWN--SMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECM--------------TCNGESYRGPMDHTESGKTCQRWDQQT---PHRHKFLPERYPDKGFDDNYCRNPDGKPR-PWCYTLDPDTPWEYCAIKTC 289          

HSP 3 Score: 72.0182 bits (175), Expect = 2.350e-13
Identity = 61/224 (27.23%), Postives = 99/224 (44.20%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCS-VPQCNIS 879
             NYCRN   +  G WC+  N ++  +     QCS +  C+    G  Y+G ++ T++ + C  W+ +      +    +P+    +  NYCRNP + +  PWC+     T + +C I  C  S+     T      T      G  Y G  +   N   C  W+ + + + +   P  F    + E  NYCRNP +    PWC+T        YCS +P+C++S
Sbjct:  175 ENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV-ECMTCN-GESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDD--NYCRNP-DGKPRPWCYTLDPDTPWEYCAIKTCAHSA--VNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWD-SQYPHKHDITPENFKCKDLRE--NYCRNP-DGAESPWCFTTDPNIRVGYCSQIPKCDVS 387          
BLAST of plasminogen-1 vs. UniProt/SwissProt
Match: sp|O18783|PLMN_MACEU (Plasminogen OS=Macropus eugenii OX=9315 GN=PLG PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 4.174e-25
Identity = 82/254 (32.28%), Postives = 119/254 (46.85%), Query Frame = 1
Query:  178 PIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCSVPQCNISQ-TTGSLKKNTVIQ 918
            P + P+  PD       NYCRN D+D  G WCY  N D+   +YC   +C     C++   G  Y+GT++ T++   C  W+ +      Y  S FP   +    NYCRNP +    PWC+  +   R+ FC IP C                 C     G  Y G I++T + +TC  WN  + +  +   P  F    + E  NYCRNP  + + PWCYT +    QEYC++P C  S   T  ++++ VIQ
Sbjct:  135 PNYAPSKYPDAGLE--KNYCRNPDDDVKGPWCYTTNPDIRY-EYCDVPECED--ECMHCS-GENYRGTISKTESGIECQPWDSQEPHSHEYIPSKFPSKDL--KENYCRNP-DGEPRPWCFTSNPEKRWEFCNIPRCSSPP-----PPPGPMLQCLK-GRGENYRGKIAVTKSGHTCQRWNKQTPHK-HNRTPENFPCRGLDE--NYCRNPDGE-LEPWCYTTNPDVRQEYCAIPSCGTSSPHTDRVEQSPVIQ 369          

HSP 2 Score: 94.3597 bits (233), Expect = 7.786e-20
Identity = 70/242 (28.93%), Postives = 101/242 (41.74%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRI-------------GSYYQGTVNITDTNQACANWN---LKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQ---------QSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
             NYCRN D + +  WCY  N D+  ++YC     G      DR+             G  Y+GT + T + + C  W+         T  NFP   +    NYCRNP  ++  PWC+      R+ FC +  C          Q++ +  +  TS   +      G +Y G  S T     C  W     +      P  +  + + E  NYCRNP  D  GPWCYT +  +  +YC +PQC
Sbjct:  321 ENYCRNPDGE-LEPWCYTTNPDVR-QEYCAIPSCGTSSPHTDRVEQSPVIQECYEGKGENYRGTTSTTISGKKCQAWSSMTPHQHKKTPDNFPNADLIR--NYCRNPDGDKS-PWCYTMDPTVRWEFCNLEKCSGTGSTVLNAQTTRVPSVDTTSHPESDCMYGSGKDYRGKRSTTVTGTLCQAWTAQEPHRHTIFTPDTYPRAGLEE--NYCRNPDGDPNGPWCYTTNPKKLFDYCDIPQC 555          

HSP 3 Score: 77.411 bits (189), Expect = 3.262e-14
Identity = 52/177 (29.38%), Postives = 86/177 (48.59%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANW-NLKGSL--YTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            G  Y+GT++ T +   C  W +L   +  Y  S +P+  +    NYCRNP ++  GPWC+  +   R+ +C +P C+                C   + G  Y G IS T +   C  W++   ++  Y  P  F +  + E  NYCRNP  +   PWC+T +  +  E+C++P+C+
Sbjct:  108 GRNYRGTLSKTKSGITCQKWSDLSPHVPNYAPSKYPDAGLEK--NYCRNPDDDVKGPWCYTTNPDIRYEYCDVPECEDE--------------CMHCS-GENYRGTISKTESGIECQPWDSQEPHSHEY-IPSKFPSKDLKE--NYCRNPDGEPR-PWCFTSNPEKRWEFCNIPRCS 263          

HSP 4 Score: 55.4546 bits (132), Expect = 4.700e-7
Identity = 45/170 (26.47%), Postives = 63/170 (37.06%), Query Frame = 1
Query:  229 NYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWG----------------------CLYDRIGSYYQGTVNITDTNQACANWNL----KGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYA 660
            NYCRN D D    WCY  +  +  +     +CSG                         C+Y   G  Y+G  + T T   C  W      + +++T   +P   +    NYCRNP  +  GPWC+  +    F +C IP C   S             C    +GG YA
Sbjct:  418 NYCRNPDGDK-SPWCYTMDPTVRWEFCNLEKCSGTGSTVLNAQTTRVPSVDTTSHPESDCMYGS-GKDYRGKRSTTVTGTLCQAWTAQEPHRHTIFTPDTYPRAGLEE--NYCRNPDGDPNGPWCYTTNPKKLFDYCDIPQCVSPSSFDCGKPRVEPQKCPGRIVGGCYA 583          
BLAST of plasminogen-1 vs. UniProt/SwissProt
Match: sp|P06868|PLMN_BOVIN (Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 5.770e-23
Identity = 81/247 (32.79%), Postives = 112/247 (45.34%), Query Frame = 1
Query:  157 SISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTM-SGVQ-EYCSVPQCNIS 879
            S +S   P F P   P     +  NYCRN DND  G WCY  + D     YC   +C     C++   G  Y+G +  T + + C  W+ +      Y  S FP  ++    NYCRNP +    PWC+      R+ FC IP C    P      +SG         G  Y G +++T + +TC  W+  + +  +   P  F    + E  NYCRNP N    PWCYT  S V+ EYC++P C  S
Sbjct:  135 SATSPHVPKFSPEKFPLAGLEE--NYCRNPDNDENGPWCYTTDPDKRY-DYCDIPECED--KCMHCS-GENYEGKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPNKNL--KMNYCRNP-DGEPRPWCFTTDPQKRWEFCDIPRCTTPPP------SSGPKYQCLKGTGKNYGGTVAVTESGHTCQRWSEQTPHK-HNRTPENFPCKNLEE--NYCRNP-NGEKAPWCYTTNSEVRWEYCTIPSCESS 362          

HSP 2 Score: 89.3521 bits (220), Expect = 3.209e-18
Identity = 74/255 (29.02%), Postives = 102/255 (40.00%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYC-------------------KTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWN---LKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQ------SSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNISQTTGSLK 900
             NYCRN  N     WCY  N ++  + YC                     + + +    Y   G  Y+GT + T T + C +W+       L T  N+P   +    NYCRNP  ++  PWC+      R+ FC +  C +      ++P AP  +    A C     G  Y G  + T     C  W     +      P     S +    NYCRNP  D  GPWCYTM+  +  +YC VPQC  S   G  K
Sbjct:  328 ENYCRN-PNGEKAPWCYTTNSEVRWE-YCTIPSCESSPLSTERMDVPVPPEQTPVPQDCYHGNGQSYRGTSSTTITGRKCQSWSSMTPHRHLKTPENYPNAGLT--MNYCRNPDADKS-PWCYTTDPRVRWEFCNLKKCSETPEQVPAAPQAPGVENPPEADC-MIGTGKSYRGKKATTVAGVPCQEWAAQEPHQHSIFTPETNPQSGLER--NYCRNPDGDVNGPWCYTMNPRKPFDYCDVPQCESSFDCGKPK 574          

HSP 3 Score: 77.7962 bits (190), Expect = 1.961e-14
Identity = 52/177 (29.38%), Postives = 75/177 (42.37%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWNLKGS---LYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGE-YAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            G  Y+GT   T +   C  W+        ++   FP   +    NYCRNP N+  GPWC+      R+ +C IP C+                 K     GE Y G I+ T +   C  W++ S +   Y  P  F    +    NYCRNP  +   PWC+T    +  E+C +P+C
Sbjct:  115 GQTYRGTTAETKSGVTCQKWSATSPHVPKFSPEKFPLAGLEE--NYCRNPDNDENGPWCYTTDPDKRYDYCDIPECED----------------KCMHCSGENYEGKIAKTMSGRDCQAWDSQSPHAHGY-IPSKFPNKNLK--MNYCRNPDGEPR-PWCFTTDPQKRWEFCDIPRC 269          

HSP 4 Score: 58.9214 bits (141), Expect = 3.415e-8
Identity = 32/82 (39.02%), Postives = 44/82 (53.66%), Query Frame = 1
Query:  634 STAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
             T  G  Y G  + T +  TC  W+ TS + P ++ P  F  + + E  NYCRNP ND  GPWCYT    +  +YC +P+C 
Sbjct:  111 KTGNGQTYRGTTAETKSGVTCQKWSATSPHVPKFS-PEKFPLAGLEE--NYCRNPDNDENGPWCYTTDPDKRYDYCDIPECE 189          
BLAST of plasminogen-1 vs. UniProt/SwissProt
Match: sp|Q5R8X6|PLMN_PONAB (Plasminogen OS=Pongo abelii OX=9601 GN=PLG PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 8.776e-23
Identity = 81/247 (32.79%), Postives = 112/247 (45.34%), Query Frame = 1
Query:  157 SISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTM-SGVQ-EYCSVPQCNIS 879
            S +S   P F PA  P E   +  NYCRN DND  G WCY  + + +   YC   +C     C++   G  Y G ++ T +   C  W+ +      Y  S FP  ++    NYCRNP +    PWC+      R+  C IP C    P      +SG         G  Y GN+++T + +TC  W+  +    +   P  F    + E  NYCRNP  +   PWCYT  S V+ EYC +P C  S
Sbjct:  128 SSTSPHRPRFSPATHPSEGLEE--NYCRNPDNDAQGPWCYTTDPE-HRYDYCDIPECEE--ACMHCS-GENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKK--NYCRNP-DGEPRPWCFTTDPNKRWELCDIPRCTTPPP------SSGPTYQCLKGTGENYRGNVAVTVSGHTCQRWSAQTPQT-HNRTPENFPCKNLDE--NYCRNPDGE-KAPWCYTTNSQVRWEYCKIPSCGSS 355          

HSP 2 Score: 73.559 bits (179), Expect = 5.413e-13
Identity = 73/250 (29.20%), Postives = 104/250 (41.60%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSG--------------------IWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLY---TDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQ--QSSPLAPL-------TKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVF-NYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
             NYCRN D +    WCY  N  +  + YCK    G                    +  C Y   G  Y+GT + T T + C +W+     +   T  N+P+  +    NYCRNP  ++G PWC+      R+ +C +  C   + S +AP         +T     C     G  Y G  + T     C  W   +   P+ +      T+  A +  NYCRNP  D  GPWCYT +  +  +YC VPQC
Sbjct:  321 ENYCRNPDGEKA-PWCYTTNSQVRWE-YCKIPSCGSSPVSTEQLDPTAPPELTPVVQDC-YHGDGQSYRGTSSTTTTGKKCQSWSSMTPHWHQKTPENYPDAGLT--MNYCRNPDADKG-PWCFTTDPSVRWEYCNLKKCSGTEGSVVAPPPVVQLPNVETPSEEDCM-FGNGKGYRGKRATTVTGTPCQEW---AAQEPHRHSIFTPQTNPRAGLEKNYCRNPDGDEGGPWCYTTNPRKHYDYCDVPQC 560          

HSP 3 Score: 72.7886 bits (177), Expect = 9.862e-13
Identity = 51/176 (28.98%), Postives = 78/176 (44.32%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWN---LKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            G  Y+GT++ T     C  W+        ++ +  P   +    NYCRNP N+  GPWC+      R+ +C IP C+++              C   + G  Y G IS T +   C  W++ S +   Y  P  F    + +  NYCRNP  +   PWC+T    +  E C +P+C
Sbjct:  108 GKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEE--NYCRNPDNDAQGPWCYTTDPEHRYDYCDIPECEEA--------------CMHCS-GENYDGKISKTMSGLECQAWDSQSPHAHGY-IPSKFPNKNLKK--NYCRNPDGEPR-PWCFTTDPNKRWELCDIPRC 262          

HSP 4 Score: 64.3142 bits (155), Expect = 6.080e-10
Identity = 35/86 (40.70%), Postives = 47/86 (54.65%), Query Frame = 1
Query:  622 ATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            + CK T  G  Y G +S T N  TC  W++TS + P ++ P    +  + E  NYCRNP ND  GPWCYT       +YC +P+C 
Sbjct:  101 SECK-TGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFS-PATHPSEGLEE--NYCRNPDNDAQGPWCYTTDPEHRYDYCDIPECE 182          

HSP 5 Score: 61.2326 bits (147), Expect = 5.136e-9
Identity = 49/170 (28.82%), Postives = 72/170 (42.35%), Query Frame = 1
Query:  166 SNVNPIFHPAILPDESFADAS---NYCRNLDNDTVGAWCYVRNGDLYIKKYCK-TQCSGIWG---------------------CLYDRIGSYYQGTVNITDTNQACANWNL----KGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSS 588
            S++ P +H      E++ DA    NYCRN D D  G WC+  +  +  + YC   +CSG  G                     C++   G  Y+G    T T   C  W      + S++T    P   +    NYCRNP  + GGPWC+  +    + +C +P C  SS
Sbjct:  402 SSMTPHWHQKT--PENYPDAGLTMNYCRNPDADK-GPWCFTTDPSVRWE-YCNLKKCSGTEGSVVAPPPVVQLPNVETPSEEDCMFGN-GKGYRGKRATTVTGTPCQEWAAQEPHRHSIFTPQTNPRAGLEK--NYCRNPDGDEGGPWCYTTNPRKHYDYCDVPQCASSS 564          
BLAST of plasminogen-1 vs. UniProt/SwissProt
Match: sp|P12545|PLMN_MACMU (Plasminogen OS=Macaca mulatta OX=9544 GN=PLG PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.566e-22
Identity = 80/247 (32.39%), Postives = 112/247 (45.34%), Query Frame = 1
Query:  157 SISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTM-SGVQ-EYCSVPQCNIS 879
            S +S   P F PA  P E   +  NYCRN DND  G WCY  + +     YC   +C     C++   G  Y G ++ T +   C  W+ +      Y  S FP  ++    NYCRNP +    PWC+      R+  C IP C    P      +SG         G  Y G++++T + +TC  W+  + +  +   P  F    + E  NYCRNP  +   PWCYT  S V+ EYC +P C  S
Sbjct:  128 SSTSPHRPTFSPATHPSEGLEE--NYCRNPDNDGQGPWCYTTDPEERF-DYCDIPECED--ECMHCS-GENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKK--NYCRNP-DGEPRPWCFTTDPNKRWELCDIPRCTTPPP------SSGPTYQCLKGTGENYRGDVAVTVSGHTCHGWSAQTPHT-HNRTPENFPCKNLDE--NYCRNPDGE-KAPWCYTTNSQVRWEYCKIPSCESS 355          

HSP 2 Score: 75.485 bits (184), Expect = 1.162e-13
Identity = 73/252 (28.97%), Postives = 105/252 (41.67%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-------------------QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLY---TDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSS-------PLA--PLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVF-NYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNIS 879
             NYCRN D +    WCY  N  +  + YCK                    + + +    Y   G  Y+GT + T T + C +W+     +   T  NFP   +    NYCRNP  ++G PWC+      R+ +C +  C  +        P+A  P  +T     C     G  Y G  + T     C  W   +   P+ ++     T+  A +  NYCRNP  D  GPWCYT +  +  +YC VPQC  S
Sbjct:  321 ENYCRNPDGEKA-PWCYTTNSQVRWE-YCKIPSCESSPVSTEPLDPTAPPELTPVVQECYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHWHEKTPENFPNAGLT--MNYCRNPDADKG-PWCFTTDPSVRWEYCNLKKCSGTEGSVAAPPPVAQLPDAETPSEEDCM-FGNGKGYRGKKATTVTGTPCQEW---AAQEPHSHRIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLFDYCDVPQCAAS 563          

HSP 3 Score: 74.7146 bits (182), Expect = 2.044e-13
Identity = 53/176 (30.11%), Postives = 77/176 (43.75%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWN---LKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            G  Y+GT++ T T   C  W+        ++ +  P   +    NYCRNP N+  GPWC+      RF +C IP C+                C   + G  Y G IS T +   C  W++ S +   Y  P  F    + +  NYCRNP  +   PWC+T    +  E C +P+C
Sbjct:  108 GKNYRGTMSKTRTGITCQKWSSTSPHRPTFSPATHPSEGLEE--NYCRNPDNDGQGPWCYTTDPEERFDYCDIPECEDE--------------CMHCS-GENYDGKISKTMSGLECQAWDSQSPHAHGY-IPSKFPNKNLKK--NYCRNPDGEPR-PWCFTTDPNKRWELCDIPRC 262          

HSP 4 Score: 61.6178 bits (148), Expect = 4.034e-9
Identity = 34/86 (39.53%), Postives = 47/86 (54.65%), Query Frame = 1
Query:  622 ATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            + CK T  G  Y G +S T    TC  W++TS + P ++ P    +  + E  NYCRNP ND  GPWCYT    +  +YC +P+C 
Sbjct:  101 SECK-TGNGKNYRGTMSKTRTGITCQKWSSTSPHRPTFS-PATHPSEGLEE--NYCRNPDNDGQGPWCYTTDPEERFDYCDIPECE 182          

HSP 5 Score: 58.5362 bits (140), Expect = 4.621e-8
Identity = 49/170 (28.82%), Postives = 71/170 (41.76%), Query Frame = 1
Query:  166 SNVNPIFHPAILPDESFADAS---NYCRNLDNDTVGAWCYVRNGDLYIKKYCK-TQCSGIWG---------------------CLYDRIGSYYQGTVNITDTNQACANWNLK----GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSS 588
            S++ P +H      E+F +A    NYCRN D D  G WC+  +  +  + YC   +CSG  G                     C++   G  Y+G    T T   C  W  +      ++T    P   +    NYCRNP  + GGPWC+  +    F +C +P C  SS
Sbjct:  402 SSMTPHWHEKT--PENFPNAGLTMNYCRNPDADK-GPWCFTTDPSVRWE-YCNLKKCSGTEGSVAAPPPVAQLPDAETPSEEDCMFGN-GKGYRGKKATTVTGTPCQEWAAQEPHSHRIFTPETNPRAGLEK--NYCRNPDGDVGGPWCYTTNPRKLFDYCDVPQCAASS 564          
BLAST of plasminogen-1 vs. UniProt/SwissProt
Match: sp|P00747|PLMN_HUMAN (Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 1.596e-22
Identity = 81/253 (32.02%), Postives = 114/253 (45.06%), Query Frame = 1
Query:  157 SISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKY-------CKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTM-SGVQ-EYCSVPQCNIS 879
            S +S   P F PA  P E   +  NYCRN DND  G WCY  + +   K+Y       C+ +C    G  YD       G ++ T +   C  W+ +      Y  S FP  ++    NYCRNP +    PWC+      R+  C IP C    P      +SG         G  Y GN+++T + +TC  W+  + +  +   P  F    + E  NYCRNP +    PWC+T  S V+ EYC +P C+ S
Sbjct:  128 SSTSPHRPRFSPATHPSEGLEE--NYCRNPDNDPQGPWCYTTDPE---KRYDYCDILECEEECMHCSGENYD-------GKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKK--NYCRNP-DRELRPWCFTTDPNKRWELCDIPRCTTPPP------SSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHT-HNRTPENFPCKNLDE--NYCRNP-DGKRAPWCHTTNSQVRWEYCKIPSCDSS 355          

HSP 2 Score: 70.4774 bits (171), Expect = 5.095e-12
Identity = 69/248 (27.82%), Postives = 99/248 (39.92%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-------------------QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPEN--SIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSP---------LAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVF-NYCRNPSNDTMGPWCYTM--SGVQEYCSVPQC 870
             NYCRN D      WC+  N  +  + YCK                    + + +    Y   G  Y+GT + T T + C +W+   + +     PEN  +     NYCRNP  ++G PWC+      R+ +C +  C  +           L P  +T     C     G  Y G  + T     C  W   +   P+ +      T+  A +  NYCRNP  D  GPWCYT     + +YC VPQC
Sbjct:  321 ENYCRNPDGKRA-PWCHTTNSQVRWE-YCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWS-SMTPHRHQKTPENYPNAGLTMNYCRNPDADKG-PWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDC-MFGNGKGYRGKRATTVTGTPCQDW---AAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQC 560          

HSP 3 Score: 70.0922 bits (170), Expect = 7.454e-12
Identity = 50/176 (28.41%), Postives = 77/176 (43.75%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWN---LKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            G  Y+GT++ T     C  W+        ++ +  P   +    NYCRNP N+  GPWC+      R+ +C I  C++               C   + G  Y G IS T +   C  W++ S +   Y  P  F    + +  NYCRNP  + + PWC+T    +  E C +P+C
Sbjct:  108 GKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEE--NYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEE--------------CMHCS-GENYDGKISKTMSGLECQAWDSQSPHAHGY-IPSKFPNKNLKK--NYCRNPDRE-LRPWCFTTDPNKRWELCDIPRC 262          

HSP 4 Score: 60.4622 bits (145), Expect = 1.089e-8
Identity = 34/86 (39.53%), Postives = 47/86 (54.65%), Query Frame = 1
Query:  622 ATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            + CK T  G  Y G +S T N  TC  W++TS + P ++ P    +  + E  NYCRNP ND  GPWCYT    +  +YC + +C 
Sbjct:  101 SECK-TGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFS-PATHPSEGLEE--NYCRNPDNDPQGPWCYTTDPEKRYDYCDILECE 182          

HSP 5 Score: 54.6842 bits (130), Expect = 7.944e-7
Identity = 41/146 (28.08%), Postives = 60/146 (41.10%), Query Frame = 1
Query:  229 NYCRNLDNDTVGAWCYVRNGDLYIKKYCK-TQCSGIWG---------------------CLYDRIGSYYQGTVNITDTNQACANWNL----KGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSS 588
            NYCRN D D  G WC+  +  +  + YC   +CSG                        C++   G  Y+G    T T   C +W      + S++T    P   +    NYCRNP  + GGPWC+  +    + +C +P C   S
Sbjct:  424 NYCRNPDADK-GPWCFTTDPSVRWE-YCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGN-GKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEK--NYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPS 564          
BLAST of plasminogen-1 vs. TrEMBL
Match: I1ZIL4 (Plasminogen-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 278/285 (97.54%), Postives = 279/285 (97.89%), Query Frame = 1
Query:   16 KSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQC 870
            KSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLS  SNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIW CLYDRIGSYYQGTVNITD+NQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNN GGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEY GNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYC VPQC
Sbjct:    5 KSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSGGSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWACLYDRIGSYYQGTVNITDSNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNPGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYGGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCPVPQC 289          
BLAST of plasminogen-1 vs. TrEMBL
Match: A0A267H0U0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003980g1 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.278e-43
Identity = 108/292 (36.99%), Postives = 155/292 (53.08%), Query Frame = 1
Query:  133 NLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSL---YTDSN-FPENSIANASNYCRNPTNNRGGPWCWLQSNITRFG----FCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQCNISQTTGSLKKNTVIQIESKILVLTCCAILAFISVTGG 984
            N   +P  S +    P+FHP ++PD +   A++YCRN DND  G WC    G    K+YC   C  +  C+ D  G YY GTV++T  N  C +W  K  +   Y+ S  FP+ S   A NYCR P  NR GPWC+ +SN    G    +C +P+C   + +AP    S +   KST+ G EYAG +S + +  TC  W + +  + YY  P +FN +TM+   NYCRNP   T GPWCY  +  +E C++P C+ S T  +    T    +  +++LT   I+  I +T G
Sbjct:  330 NSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDITGPWCPTVAG---TKQYCANPCY-LTVCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQNRWGPWCY-KSNYNGTGSTWDYCNVPYCTGITTVAPTASASTDNCLKSTS-GTEYAGTMSTSASGKTCIPWTSNTALHTYY-LPQMFNAATMSAASNYCRNPDGSTTGPWCYVDATTRENCNIPMCS-SPTVVTAPGTT----DPVMVILT--GIIGMIGLTTG 607          

HSP 2 Score: 85.1149 bits (209), Expect = 2.373e-14
Identity = 76/292 (26.03%), Postives = 113/292 (38.70%), Query Frame = 1
Query:   28 NCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGI----WGCLYDRIGSYYQGTVNITDTNQACANWN-----LKGSLYT-DSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRF-GFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQC 870
            +C      + +K   ST     +C PW                     +N  +  +  PD S A A N CRN   DT   WCY+  G   +       C GI      C     G+ Y G ++ + +   C +W+     +   L+T D+  P +   N +    NP++    PWC      T     C IPFC Q +P            C++  +G  Y GN S +    TC  W++          PV  +  T++   NYCRNP++  +G WC   +   E C VP C
Sbjct:   29 DCRANRAGFFYKGNISTTTSGCTCRPWTDA------------------INTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVTGSCGVAANYDF-CDGIPVCSKTCRETVTGTEYNGAISQSTSGSPCLSWSSIYSAIYAPLFTADATIPGSVCRNIAVDVNNPSSINFVPWCLTDVGGTPTPSNCSIPFCSQVNP----------GGCRTDRLGSSYRGNQSTSVTGKTCIRWDSAPGVYTAATWPV--SGETISAANNYCRNPNSSPVGLWCLVSTTDWEPCVVPVC 289          

HSP 3 Score: 79.7221 bits (195), Expect = 1.680e-12
Identity = 56/189 (29.63%), Postives = 84/189 (44.44%), Query Frame = 1
Query:  340 CLYDRIGSYYQGTVNITDTNQACANW-NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSN----ITRFGFCR-IPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNT--TSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG---VQEYCSVPQCN 873
            C  +R G +Y+G ++ T +   C  W +   + Y DS FP+ S A A N CRNP  +   PWC++ +        + FC  IP C +              TC+ T  G EY G IS +T+ + C  W++  ++ Y P +        S    +     NPS+    PWC T  G       CS+P C+
Sbjct:   30 CRANRAGFFYKGNISTTTSGCTCRPWTDAINTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVTGSCGVAANYDFCDGIPVCSK--------------TCRETVTGTEYNGAISQSTSGSPCLSWSSIYSAIYAPLFTADATIPGSVCRNIAVDVNNPSSINFVPWCLTDVGGTPTPSNCSIPFCS 204          
BLAST of plasminogen-1 vs. TrEMBL
Match: A0A267EUC8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018513g1 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.834e-43
Identity = 107/292 (36.64%), Postives = 155/292 (53.08%), Query Frame = 1
Query:  133 NLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSL---YTDSN-FPENSIANASNYCRNPTNNRGGPWCWLQSNITRFG----FCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQCNISQTTGSLKKNTVIQIESKILVLTCCAILAFISVTGG 984
            N   +P  S +    P+FHP ++PD +   A++YCRN DND  G WC    G    K+YC   C  +  C+ D  G YY GTV++T  N  C +W  K  +   Y+ S  FP+ S   A NYCR P  N+ GPWC+ +SN    G    +C +P+C   + +AP    S +   KST+ G EYAG +S + +  TC  W + +  + YY  P +FN +TM+   NYCRNP   T GPWCY  +  +E C++P C+ S T  +    T    +  +++LT   I+  I +T G
Sbjct:  330 NSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDITGPWCPTVAG---TKQYCANPCY-LTVCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQNKWGPWCY-KSNYNGTGSTWDYCNVPYCTGVTTVAPTASASTDNCLKSTS-GTEYAGTMSTSASGKTCIPWTSNTALHTYY-LPQMFNAATMSAASNYCRNPDGSTTGPWCYVDATTRENCNIPMCS-SPTVVTAPGTT----DPVMVILT--GIIGMIGLTTG 607          

HSP 2 Score: 85.1149 bits (209), Expect = 2.455e-14
Identity = 77/297 (25.93%), Postives = 111/297 (37.37%), Query Frame = 1
Query:   28 NCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGI----WGCLYDRIGSYYQGTVNITDTNQACANW------NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGF------CRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQC 870
            +C      + +K   ST     +C PW                     +N  +  +  PD S A A N CRN   DT   WCY+  G   +       C GI      C     G+ Y G ++ + +   C +W      N       D+  P +   N +    NP++    PWC     +T  G       C IPFC Q +P            C++  +G  Y GN S +    TC  W++          PV  +  T++   NYCRNP+N  +G WC   +   E C VP C
Sbjct:   29 DCRTNRAGFFYKGNISTTTSGCTCRPWTDA------------------INTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVAGSCGVAANYDF-CDGIPVCSKTCRETVTGTEYNGAISQSTSGSPCLSWSSIYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWC-----VTNVGGTPTPSNCSIPFCSQVNP----------GGCRTDRLGTSYRGNQSTSVTGKTCIRWDSAPGVYTAATWPV--SGETISAANNYCRNPNNSPVGLWCLVSTTDWEPCVVPVC 289          

HSP 3 Score: 77.7962 bits (190), Expect = 7.787e-12
Identity = 56/189 (29.63%), Postives = 83/189 (43.92%), Query Frame = 1
Query:  340 CLYDRIGSYYQGTVNITDTNQACANW-NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSN----ITRFGFCR-IPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTT--SFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG---VQEYCSVPQCN 873
            C  +R G +Y+G ++ T +   C  W +   + Y DS FP+ S A A N CRNP  +   PWC++ +        + FC  IP C +              TC+ T  G EY G IS +T+ + C  W++   + Y P +        S    +     NPS+    PWC T  G       CS+P C+
Sbjct:   30 CRTNRAGFFYKGNISTTTSGCTCRPWTDAINTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVAGSCGVAANYDFCDGIPVCSK--------------TCRETVTGTEYNGAISQSTSGSPCLSWSSIYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWCVTNVGGTPTPSNCSIPFCS 204          
BLAST of plasminogen-1 vs. TrEMBL
Match: A0A1I8HYP5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.860e-43
Identity = 99/256 (38.67%), Postives = 139/256 (54.30%), Query Frame = 1
Query:  133 NLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSL---YTDSN-FPENSIANASNYCRNPTNNRGGPWCWLQSNITRFG----FCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQCNI 876
            N   +P  S +    P+FHP ++PD +   A++YCRN DND  G WC    G    K+YC   C  +  C+ D  G YY GTV++T  N  C +W  K  +   Y+ S  FP+ S   A NYCR P  NR GPWC+ +SN    G    +C +P+C   + +AP    S +   KST+ G EYAG +S + +  TC  W + +  + YY  P +FN +TM+   NYCRNP   T GPWCY  +  +E C++P C +
Sbjct:  299 NSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDITGPWCPTVAG---TKQYCANPCY-LTVCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQNRWGPWCY-KSNYNGTGSTWDYCNVPYCTGITTVAPTASASTDNCLKSTS-GTEYAGTMSTSASGKTCIPWTSNTALHTYY-LPQMFNAATMSAASNYCRNPDGSTTGPWCYVDATTRENCNIPMCLV 547          

HSP 2 Score: 83.9593 bits (206), Expect = 6.238e-14
Identity = 69/244 (28.28%), Postives = 102/244 (41.80%), Query Frame = 1
Query:  172 VNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGI----WGCLYDRIGSYYQGTVNITDTNQACANWN-----LKGSLYT-DSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRF-GFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQC 870
            +N  +  +  PD S A A N CRN   DT   WCY+  G   +       C GI      C     G+ Y G ++ + +   C +W+     +   L+T D+  P +   N +    NP++    PWC      T     C IPFC Q +P            C++  +G  Y GN S +    TC  W++          PV  +  T++   NYCRNP++  +G WC   +   E C VP C
Sbjct:   28 INTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVTGSCGVAANYDF-CDGIPVCSKTCRETVTGTEYNGAISQSTSGSPCLSWSSIYSAIYAPLFTADATIPGSVCRNIAVDVNNPSSINFVPWCLTDVGGTPTPSNCSIPFCSQVNP----------GGCRTDRLGSSYRGNQSTSVTGKTCIRWDSAPGVYTAATWPV--SGETISAANNYCRNPNSSPVGLWCLVSTTDWEPCVVPVC 258          

HSP 3 Score: 77.7962 bits (190), Expect = 6.379e-12
Identity = 55/186 (29.57%), Postives = 83/186 (44.62%), Query Frame = 1
Query:  349 DRIGSYYQGTVNITDTNQACANW-NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSN----ITRFGFCR-IPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNT--TSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG---VQEYCSVPQCN 873
            +R G +Y+G ++ T +   C  W +   + Y DS FP+ S A A N CRNP  +   PWC++ +        + FC  IP C +              TC+ T  G EY G IS +T+ + C  W++  ++ Y P +        S    +     NPS+    PWC T  G       CS+P C+
Sbjct:    2 NRAGFFYKGNISTTTSGCTCRPWTDAINTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVTGSCGVAANYDFCDGIPVCSK--------------TCRETVTGTEYNGAISQSTSGSPCLSWSSIYSAIYAPLFTADATIPGSVCRNIAVDVNNPSSINFVPWCLTDVGGTPTPSNCSIPFCS 173          

HSP 4 Score: 60.077 bits (144), Expect = 4.126e-6
Identity = 28/75 (37.33%), Postives = 42/75 (56.00%), Query Frame = 1
Query:  340 CLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCR 564
            CL +R G  Y GT  +T + + C +W+L     +D+ FPE S+A A+NYCRNP  ++   WC+       F +C 
Sbjct: 1042 CLINRAGLNYIGTQVVTKSLKTCVSWSLTPFATSDALFPEKSVALANNYCRNPGYSKSAIWCYTNDTSLEFDYCE 1116          
BLAST of plasminogen-1 vs. TrEMBL
Match: A0A1I8H6I2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 6.544e-36
Identity = 96/306 (31.37%), Postives = 144/306 (47.06%), Query Frame = 1
Query:  133 NLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWC------------------------------YVRNGDLYIK------KYCKTQCSGIWG--------------CLYDRIGSYYQGTVNITDTNQACANWNLKGSL---YTDSN-FPENSIANASNYCRNPTNNRGGPWCWLQSNITRFG----FCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQCNI 876
            N   +P  S +    P+FHP ++PD +   A++YCRN DND  G WC                              ++R   +++K      ++ +     I+               C+ D  G YY GTV++T  N  C +W  K  +   Y+ S  FP+ S   A NYCR P  N+ GPWC+ +SN    G    +C +P+C   + +AP    S +   KST+ G EYAG +S + +  TC  W + +  + YY  P +FN +TM+   NYCRNP   T GPWCY  +  +E C++P C +
Sbjct:  701 NSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDITGPWCPTVAGTKQYCANPCYLTGKLCRKISNEFLKFLRREFVFLKFHTGPMEFIQINLIKIYSASNLTKPSLNRASVCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQNKWGPWCY-KSNYNGTGSTWDYCNVPYCTGVTTVAPTASASTDNCLKSTS-GTEYAGTMSTSASGKTCIPWTSNTALHTYY-LPQMFNAATMSAASNYCRNPDGSTTGPWCYVDATTRENCNIPMCLV 1003          

HSP 2 Score: 139.428 bits (350), Expect = 1.453e-32
Identity = 96/277 (34.66%), Postives = 134/277 (48.38%), Query Frame = 1
Query:  178 PIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK----GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFY-NPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCSVPQCNISQTTGS---LKKNTVIQIESKILV-LTCCAILAFISV 975
            P+FHPA LPD S+  A++YCRN D+D  G WC   +G    K YC   C+ +  C        Y G +++T     C  W  +     +  T  +FP+ S+A A N+CRNP  N  GPWC    N T   F    FC                 C  ++ G  YAG  S T N  TC  W++   + +PYY  P +FN+ T+++  NYCRNP+NDT GPWC+T       EYC++  C+   + G    L    V  I S  L  +    ILA +++
Sbjct: 1807 PLFHPAHLPDASWTAAASYCRNPDDDPTGPWCPSPSGG---KLYCSDPCNTV-TCKSTHKTQNYIGVISVTRRGTTCQKWLARFPWFHTFDTTGDFPDLSLAAAENFCRNPNGNPFGPWCIKAGNFTDGDF--WDFCD----------------CIDSSYGFTYAGRRSTTGNGRTCQRWDSQHPHPHPYY-LPQMFNSLTISQAENYCRNPNNDTNGPWCFTTDPNIRFEYCNISLCSPQYSAGVEGFLAFFGVFAIHSSSLASIAGIIILAQLAI 2060          

HSP 3 Score: 94.7449 bits (234), Expect = 2.074e-17
Identity = 83/265 (31.32%), Postives = 113/265 (42.64%), Query Frame = 1
Query:   88 LESCVPWMSVPLQYNNLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANW---NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQCN 873
            L++CV W   P   ++                   A+ P++S A A+NYCRN        WCY     L    YC+T       C     G  Y G  N      +C +W   NL GS Y      + S+++A+ YCRN   N          ++ R   C IPFC Q S        SG   C+S  +G  Y G +SI+ +  +C LWN+T  Y    N PV   T   AE  + CRNP+N T+G WC+  +   E C V  C 
Sbjct: 1534 LKTCVSWSLTPFATSD-------------------ALFPEKSVALANNYCRNPGYSKSAIWCYTNATSLEFD-YCETVPICQTTCRQTEAGQEYNGATNKDRNGTSCLSWASVNLIGSEYF---LYDRSLSDANAYCRNVPPN---------VSVMRSS-CSIPFCSQLS-------VSG---CRSDKLGLLYRGTVSISVSGRSCLLWNSTGVYTA-ANWPVSGETIEAAE--SSCRNPNNSTVGLWCFVSATQWEPCMVQVCE 1752          

HSP 4 Score: 84.7297 bits (208), Expect = 4.467e-14
Identity = 57/187 (30.48%), Postives = 89/187 (47.59%), Query Frame = 1
Query:  337 GCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCR-IPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRN-PSNDTMGPWCYTMSGVQEYCSVPQCNISQTTG 891
            GCL +R G  Y GT  +T + + C +W+L     +D+ FPE S+A A+NYCRNP  ++   WC+  +    F +C  +P CQ               TC+ T  G EY G  +   N  +C  W + +     Y    L++ S +++   YCRN P N         +S ++  CS+P C+    +G
Sbjct: 1514 GCLINRAGLNYVGTQVVTKSLKTCVSWSLTPFATSDALFPEKSVALANNYCRNPGYSKSAIWCYTNATSLEFDYCETVPICQ--------------TTCRQTEAGQEYNGATNKDRNGTSCLSWASVNLIGSEY---FLYDRS-LSDANAYCRNVPPN---------VSVMRSSCSIPFCSQLSVSG 1673          

HSP 5 Score: 83.5741 bits (205), Expect = 9.752e-14
Identity = 70/249 (28.11%), Postives = 100/249 (40.16%), Query Frame = 1
Query:  172 VNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGI----WGCLYDRIGSYYQGTVNITDTNQACANW------NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGF------CRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQC 870
            +N  +  +  PD S A A N CRN   DT   WCY+  G   +       C GI      C     G+ Y G ++ + +   C +W      N       D+  P +   N +    NP++    PWC     +T  G       C IPFC Q +P            C++  +G  Y GN S +    TC  W++          PV  +  T++   NYCRNP+N  +G WC   +   E C VP C
Sbjct:  430 INTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVAGSCGVAANYDF-CDGIPVCSKTCRETVTGTEYNGAISQSTSGSPCLSWSSIYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWC-----VTNVGGTPTPSNCSIPFCSQVNP----------GGCRTDRLGTSYRGNQSTSVTGKTCIRWDSAPGVYTAATWPV--SGETISAANNYCRNPNNSPVGLWCLVSTTDWEPCVVPVC 660          

HSP 6 Score: 79.7221 bits (195), Expect = 2.080e-12
Identity = 79/303 (26.07%), Postives = 122/303 (40.26%), Query Frame = 1
Query:    7 PVCKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSISSNVNPIF-HPAILPDESFADASNYCRNLDNDTVGA-------WCYVRNGDLYIKKYCKTQ-CSGI--WGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFP--ENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQ----SSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVP 864
            PVC  T  C   VT   +    S       C+ W S+                +N  P+F   A +P        + CRN+  D           WC    G       C    CS +   GC  DR+G+ Y+G  + + T + C  W+    +YT + +P    +I+ A+NYCRNP N+  G WC + +  T +  C +P C       SP +   +     T    A       + S    N+      +++  +     P +    T+    +YCRNP ND  GPWC T++G ++YC+ P
Sbjct:  483 PVCSKT--CRETVTGTEYNGAISQSTSGSPCLSWSSI--------------YPANYTPLFTADATIP-------GSVCRNIAVDVSNPSSINFVPWCVTNVGGTPTPSNCSIPFCSQVNPGGCRTDRLGTSYRGNQSTSVTGKTCIRWDSAPGVYTAATWPVSGETISAANNYCRNPNNSPVGLWCLVST--TDWEPCVVPVCVPINGCPSPQSDSYRYKDLITYSGCARWSSVYSSRSSDWYNSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDITGPWCPTVAGTKQYCANP 760          

HSP 7 Score: 76.2554 bits (186), Expect = 2.749e-11
Identity = 55/186 (29.57%), Postives = 82/186 (44.09%), Query Frame = 1
Query:  349 DRIGSYYQGTVNITDTNQACANW-NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSN----ITRFGFCR-IPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTT--SFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG---VQEYCSVPQCN 873
            +R G +Y+G ++ T +   C  W +   + Y DS FP+ S A A N CRNP  +   PWC++ +        + FC  IP C +              TC+ T  G EY G IS +T+ + C  W++   + Y P +        S    +     NPS+    PWC T  G       CS+P C+
Sbjct:  404 NRAGFFYKGNISTTTSGCTCRPWTDAINTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVAGSCGVAANYDFCDGIPVCSK--------------TCRETVTGTEYNGAISQSTSGSPCLSWSSIYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWCVTNVGGTPTPSNCSIPFCS 575          
BLAST of plasminogen-1 vs. Ensembl Cavefish
Match: ENSAMXT00000018419.2 (plasminogen [Source:NCBI gene;Acc:103036400])

HSP 1 Score: 91.6633 bits (226), Expect = 5.730e-20
Identity = 77/249 (30.92%), Postives = 106/249 (42.57%), Query Frame = 1
Query:  169 NVNPIFHPAILPDESFAD-ASNYCRNLDNDTVGAWCYV-------RNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSL---YTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSP--LAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            N+ P  HP        AD  SN+CRN D D  G WCY         N D+   + C  +C           G  Y+G ++ T++   C  W+ +      Y  S FPE  +    NYCRNP +    PWC+ +S   R+ FC +  C    P  +  L  T+G+        G  Y G +S+T +  TC  W +     P+ +     N        NYCRNP N+   PWCYT       EYC+V  C
Sbjct:  133 NITPRSHPK-------ADLESNFCRNPDGDKGGPWCYTTDPAKRWENCDI---QDCTEECMHC-------SGENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYLEE--NYCRNP-DGEPKPWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNCTTGD--------GNTYRGTVSVTESGKTCQSWASQL---PHKHSRTPDNYPCKGLDQNYCRNPDNERK-PWCYTTDPETRWEYCNVESC 349          

HSP 2 Score: 83.9593 bits (206), Expect = 2.233e-17
Identity = 74/247 (29.96%), Postives = 106/247 (42.91%), Query Frame = 1
Query:  229 NYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIW------------GCLYDRIGSYYQGTVNITDTNQACANW---NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSS----------PLAP---LTKT--SGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            NYCRN DN+    WCY  + +   + YC  +  G               C Y+  GS Y+G +  T + + C  W        + T  NFP   +    N CRNP  +R  PWC+      R+ +CRI  C  ++          P+ P   LT++  S  A CK T  G  Y G++S T    TC  W+ ++   P+ +              N CRNP  D  GPWCYT    +  +YC +P+C 
Sbjct:  319 NYCRNPDNER-KPWCYTTDPETRWE-YCNVESCGNEPRPDEPVIAPNEDC-YEDNGSSYRGVMTETISGKKCQAWASMEPHSHVKTPQNFPTADLRR--NLCRNPDGDRA-PWCYTTDPSVRWEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCK-TGSGISYRGSVSKTVAGVTCQAWSAST---PHLSSFTPQAHPDKGLDSNKCRNPDGDVNGPWCYTTDPNKKWDYCQIPECE 555          

HSP 3 Score: 78.9518 bits (193), Expect = 1.006e-15
Identity = 57/177 (32.20%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  355 IGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANA---SNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            IG+ Y+GT + T +   C  W  + +     N    S   A   SN+CRNP  ++GGPWC+      R+  C I  C +               C   + G  Y G IS T +  TC  W++   +N  Y  P +F    + E  NYCRNP  +   PWC+T S  +  E+CSV +C
Sbjct:  104 IGTDYRGTKSKTKSGTLCQRW--ESTFPHKPNITPRSHPKADLESNFCRNPDGDKGGPWCYTTDPAKRWENCDIQDCTEE--------------CMHCS-GENYRGKISTTESGLTCQRWDSQKPHNHGY-MPSVFPEKYLEE--NYCRNPDGEPK-PWCFTESPAKRWEFCSVSRC 259          
BLAST of plasminogen-1 vs. Ensembl Cavefish
Match: ENSAMXT00000018418.2 (plasminogen [Source:NCBI gene;Acc:103036400])

HSP 1 Score: 91.6633 bits (226), Expect = 6.395e-20
Identity = 77/250 (30.80%), Postives = 106/250 (42.40%), Query Frame = 1
Query:  169 NVNPIFHPAILPDESFAD-ASNYCRNLDNDTVGAWCYV-------RNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSL---YTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSP--LAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            N+ P  HP        AD  SN+CRN D D  G WCY         N D+   + C  +C           G  Y+G ++ T++   C  W+ +      Y  S FPE  +    NYCRNP +    PWC+ +S   R+ FC +  C    P  +  L  T+G+        G  Y G +S+T +  TC  W +     P+ +     N        NYCRNP N+   PWCYT       EYC+V  C 
Sbjct:  144 NITPRSHPK-------ADLESNFCRNPDGDKGGPWCYTTDPAKRWENCDI---QDCTEECMHC-------SGENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYLEE--NYCRNP-DGEPKPWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNCTTGD--------GNTYRGTVSVTESGKTCQSWASQL---PHKHSRTPDNYPCKGLDQNYCRNPDNERK-PWCYTTDPETRWEYCNVESCG 361          

HSP 2 Score: 84.3445 bits (207), Expect = 1.676e-17
Identity = 74/249 (29.72%), Postives = 107/249 (42.97%), Query Frame = 1
Query:  229 NYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIW------------GCLYDRIGSYYQGTVNITDTNQACANW---NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSS----------PLAP---LTKT--SGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNIS 879
            NYCRN DN+    WCY  + +   + YC  +  G               C Y+  GS Y+G +  T + + C  W        + T  NFP   +    N CRNP  +R  PWC+      R+ +CRI  C  ++          P+ P   LT++  S  A CK T  G  Y G++S T    TC  W+ ++   P+ +              N CRNP  D  GPWCYT    +  +YC +P+C + 
Sbjct:  330 NYCRNPDNER-KPWCYTTDPETRWE-YCNVESCGNEPRPDEPVIAPNEDC-YEDNGSSYRGVMTETISGKKCQAWASMEPHSHVKTPQNFPTADLRR--NLCRNPDGDRA-PWCYTTDPSVRWEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCK-TGSGISYRGSVSKTVAGVTCQAWSAST---PHLSSFTPQAHPDKGLDSNKCRNPDGDVNGPWCYTTDPNKKWDYCQIPECALD 568          

HSP 3 Score: 78.9518 bits (193), Expect = 1.111e-15
Identity = 57/177 (32.20%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  355 IGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANA---SNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            IG+ Y+GT + T +   C  W  + +     N    S   A   SN+CRNP  ++GGPWC+      R+  C I  C +               C   + G  Y G IS T +  TC  W++   +N  Y  P +F    + E  NYCRNP  +   PWC+T S  +  E+CSV +C
Sbjct:  115 IGTDYRGTKSKTKSGTLCQRW--ESTFPHKPNITPRSHPKADLESNFCRNPDGDKGGPWCYTTDPAKRWENCDIQDCTEE--------------CMHCS-GENYRGKISTTESGLTCQRWDSQKPHNHGY-MPSVFPEKYLEE--NYCRNPDGEPK-PWCFTESPAKRWEFCSVSRC 270          
BLAST of plasminogen-1 vs. Ensembl Cavefish
Match: hgfa (hepatocyte growth factor-like [Source:NCBI gene;Acc:103045938])

HSP 1 Score: 88.1965 bits (217), Expect = 9.698e-19
Identity = 75/281 (26.69%), Postives = 121/281 (43.06%), Query Frame = 1
Query:   58 FKSQTSTEQFLESCVPW-MSVPLQYNNLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANA--SNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYC-SVPQCNISQ 882
            +K + S  +   SC  W +SVP ++N                 + PA    + F    N+CRN D D  G WC+  + +   ++    QCS +  C+    G  Y+G ++ T++ + C  W+ +   +     P          NYCRNP NN   PWC+     TR+ +C I  C     +     T+          G  Y G +++T +  TC  W++   +N  Y  P  +    + E  NYCRNP    + PWC+T      +  C S+P+C+ +Q
Sbjct:  121 YKGRRSVTRSGVSCQAWNVSVPHEHN-----------------YKPA--KHKKFDLRENFCRNPDKDVSGPWCFTNSSETRYQECGLPQCSEV-QCMQCN-GEAYRGPMDHTESGKECQRWDSQ-RPHKHKYQPHRHSGKGLDDNYCRNP-NNDVRPWCYTTDKNTRWEYCNISLCDSDHTVDEDVTTAC-----FRGQGERYRGRVNVTPSGATCQRWDSQFPHNHTYT-PHNYKCKDLRE--NYCRNPDGSEI-PWCFTTDPKVRKALCTSIPRCSETQ 369          

HSP 2 Score: 84.3445 bits (207), Expect = 1.395e-17
Identity = 69/239 (28.87%), Postives = 97/239 (40.59%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYC--------KTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN---------ASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT--MSGVQEYCSVPQCNISQ 882
             NYCRN +ND V  WCY  + +   + YC         T    +    +   G  Y+G VN+T +   C  W        DS FP N               NYCRNP  +   PWC+      R   C  IP C ++       + +G +          Y GN+S T +   C LW+  +     Y++     T++     N CRNP  D  GPWCYT   S   +YC + +C  S+
Sbjct:  242 DNYCRNPNND-VRPWCYTTDKNTRWE-YCNISLCDSDHTVDEDVTTACFRGQGERYRGRVNVTPSGATCQRW--------DSQFPHNHTYTPHNYKCKDLRENYCRNPDGSEI-PWCFTTDPKVRKALCTSIPRCSETQEKPECYEDNGES----------YRGNVSKTRSGIPCGLWSDHT-----YSRDTRSGTASAGLQLNLCRNPDRDKHGPWCYTSNSSIPWDYCGLERCKTSK 454          

HSP 3 Score: 77.411 bits (189), Expect = 2.884e-15
Identity = 66/222 (29.73%), Postives = 99/222 (44.59%), Query Frame = 1
Query:  241 NLDNDTVGAWCYVR-NGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFP---ENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCSVPQCNISQTT 888
            + D  T GA    R N DLY KK    +C  I G      G  Y+G  ++T +  +C  WN+  S+  + N+            N+CRNP  +  GPWC+  S+ TR+  C +P C +   +    + +G A          Y G +  T +   C  W++   +   Y QP   +   + +  NYCRNP+ND   PWCYT       EYC++  C+   T 
Sbjct:   85 SFDRFTEGAQKERRANHDLYEKKDYVREC--IVG-----SGVNYKGRRSVTRSGVSCQAWNV--SVPHEHNYKPAKHKKFDLRENFCRNPDKDVSGPWCFTNSSETRYQECGLPQCSEVQCM----QCNGEA----------YRGPMDHTESGKECQRWDSQRPHKHKY-QPHRHSGKGLDD--NYCRNPNNDVR-PWCYTTDKNTRWEYCNISLCDSDHTV 279          
BLAST of plasminogen-1 vs. Ensembl Cavefish
Match: hgfa (hepatocyte growth factor-like [Source:NCBI gene;Acc:103045938])

HSP 1 Score: 87.4261 bits (215), Expect = 1.326e-18
Identity = 74/280 (26.43%), Postives = 121/280 (43.21%), Query Frame = 1
Query:   58 FKSQTSTEQFLESCVPW-MSVPLQYNNLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWN-LKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYC-SVPQCNISQ 882
            +K + S  +   SC  W +SVP ++N                 + PA    + F    N+CRN D D  G WC+  + +   ++    QCS +  C+    G  Y+G ++ T++ + C  W+  +   +       +      NYCRNP NN   PWC+     TR+ +C I  C     +     T+          G  Y G +++T +  TC  W++   +N  Y  P  +    + E  NYCRNP    + PWC+T      +  C S+P+C+ +Q
Sbjct:  119 YKGRRSVTRSGVSCQAWNVSVPHEHN-----------------YKPA--KHKKFDLRENFCRNPDKDVSGPWCFTNSSETRYQECGLPQCSEV-QCMQCN-GEAYRGPMDHTESGKECQRWDSQRPHKHKYQPHRHSGKGLDDNYCRNP-NNDVRPWCYTTDKNTRWEYCNISLCDSDHTVDEDVTTAC-----FRGQGERYRGRVNVTPSGATCQRWDSQFPHNHTYT-PHNYKCKDLRE--NYCRNPDGSEI-PWCFTTDPKVRKALCTSIPRCSETQ 367          

HSP 2 Score: 83.9593 bits (206), Expect = 2.108e-17
Identity = 69/239 (28.87%), Postives = 97/239 (40.59%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIKKYC--------KTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN---------ASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT--MSGVQEYCSVPQCNISQ 882
             NYCRN +ND V  WCY  + +   + YC         T    +    +   G  Y+G VN+T +   C  W        DS FP N               NYCRNP  +   PWC+      R   C  IP C ++       + +G +          Y GN+S T +   C LW+  +     Y++     T++     N CRNP  D  GPWCYT   S   +YC + +C  S+
Sbjct:  240 DNYCRNPNND-VRPWCYTTDKNTRWE-YCNISLCDSDHTVDEDVTTACFRGQGERYRGRVNVTPSGATCQRW--------DSQFPHNHTYTPHNYKCKDLRENYCRNPDGSEI-PWCFTTDPKVRKALCTSIPRCSETQEKPECYEDNGES----------YRGNVSKTRSGIPCGLWSDHT-----YSRDTRSGTASAGLQLNLCRNPDRDKHGPWCYTSNSSIPWDYCGLERCKTSK 452          

HSP 3 Score: 77.0258 bits (188), Expect = 4.228e-15
Identity = 66/222 (29.73%), Postives = 99/222 (44.59%), Query Frame = 1
Query:  241 NLDNDTVGAWCYVR-NGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFP---ENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCSVPQCNISQTT 888
            + D  T GA    R N DLY KK    +C  I G      G  Y+G  ++T +  +C  WN+  S+  + N+            N+CRNP  +  GPWC+  S+ TR+  C +P C +   +    + +G A          Y G +  T +   C  W++   +   Y QP   +   + +  NYCRNP+ND   PWCYT       EYC++  C+   T 
Sbjct:   83 SFDRFTEGAQKERRANHDLYEKKDYVREC--IVG-----SGVNYKGRRSVTRSGVSCQAWNV--SVPHEHNYKPAKHKKFDLRENFCRNPDKDVSGPWCFTNSSETRYQECGLPQCSEVQCM----QCNGEA----------YRGPMDHTESGKECQRWDSQRPHKHKY-QPHRHSGKGLDD--NYCRNPNNDVR-PWCYTTDKNTRWEYCNISLCDSDHTV 277          
BLAST of plasminogen-1 vs. Ensembl Cavefish
Match: mst1 (macrophage stimulating 1 [Source:NCBI gene;Acc:103025427])

HSP 1 Score: 85.1149 bits (209), Expect = 8.185e-18
Identity = 75/252 (29.76%), Postives = 96/252 (38.10%), Query Frame = 1
Query:  181 IFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGI----------WGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENS---------IANASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQE--YCSVPQC 870
            I+ P   PD+S  D  NYCRN D   V  WCY  + D+  +     +CSGI            C   R G  Y+G VN T +  AC  W        D+ FP                 NYCRNP  +   PWC+      R   C +I  C            +G            Y G +  T     C  W+  + +    N P     + + E  NYCRNP  D  GPWCYT     E  YC++ QC
Sbjct:  225 IYQPEKYPDKSLDD--NYCRNPDASPV-PWCYTTDPDVERENCDIRKCSGIPKRRLRPSYTTNCFRGR-GEDYRGKVNETTSGIACQKW--------DAQFPHEHPFYPHTYECKGLVENYCRNPDGSEA-PWCFTSLPEMRTALCLQIKRCADDIEAEDCYHENGK----------NYRGIVRKTRKGIICQKWSANTPHQTKIN-PKTHPDANLTE--NYCRNPDGDLHGPWCYTTDPKTEFDYCAIKQC 450          

HSP 2 Score: 72.0182 bits (175), Expect = 2.150e-13
Identity = 53/190 (27.89%), Postives = 76/190 (40.00%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANAS-------NYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQCNISQTTGSLKKN 906
            G  Y+G V+ T + + C  W         S FP +     S       NYCRNP  +R GPWC+      R+  C IP C+    +                 G +Y G +  T N   C  W+    +   Y QP  +   ++ +  NYCRNP    + PWCYT     E      C+I + +G  K+ 
Sbjct:  116 GEDYRGKVSKTQSGKTCQQWW--------SKFPHDHRWTPSPTNGLELNYCRNPDGDRIGPWCYTTDPERRYESCNIPLCKDEVCI--------------NCNGEDYRGQVDHTVNGRECQRWDQQYPHQHIY-QPEKYPDKSLDD--NYCRNPDASPV-PWCYTTDPDVER---ENCDIRKCSGIPKRR 276          

HSP 3 Score: 71.633 bits (174), Expect = 2.333e-13
Identity = 60/209 (28.71%), Postives = 92/209 (44.02%), Query Frame = 1
Query:  229 NYCRNLDNDTVGAWCYVRNGDLYIKK----YCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTT-SFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT 831
            NYCRN D D +G WCY  + +   +      CK +      C+ +  G  Y+G V+ T   + C  W+ +     +Y    +P+ S+ +  NYCRNP +    PWC+          C I  C  S       + S    C     G +Y G ++ TT+   C  W+      +P+Y  P  +    + E  NYCRNP + +  PWC+T
Sbjct:  156 NYCRNPDGDRIGPWCYTTDPERRYESCNIPLCKDEV-----CI-NCNGEDYRGQVDHTVNGRECQRWDQQYPHQHIYQPEKYPDKSLDD--NYCRNP-DASPVPWCYTTDPDVERENCDIRKC--SGIPKRRLRPSYTTNC-FRGRGEDYRGKVNETTSGIACQKWDAQFPHEHPFY--PHTYECKGLVE--NYCRNP-DGSEAPWCFT 347          
BLAST of plasminogen-1 vs. Ensembl Sea Lamprey
Match: hgfb (hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GENE-041014-3])

HSP 1 Score: 81.2629 bits (199), Expect = 2.826e-17
Identity = 72/246 (29.27%), Postives = 106/246 (43.09%), Query Frame = 1
Query:  178 PIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSL---YTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRI-PFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTM--SGVQEYCS-VPQCNISQTTGS 894
            P F+PA      F    N CRN   +    WCY  + +   ++    +C  +  C+  R G +Y+G V+ TD+ + C  W+L+      YT   FP   + +  NYCRNP N R  PWC+       + +C I P C  S    P  +  G    +    G +Y G  + T     C  W       P+ +  +  N        NYCRNP      PWC+T+  S  ++ CS +P+C    T GS
Sbjct:   87 PSFYPA------FDLEGNSCRNPAQEPGEPWCYTMDSNRRRERCGIPRCDEV-PCVECR-GEHYRGLVDHTDSQRECQRWDLQHPHNHNYTPDRFPNAGLDD--NYCRNP-NGRMRPWCFTTDPHQPWEYCSIKPGCCASKATRPAME--GRPCLEER--GEDYRGRANHTKGGIPCQHWAAQ---QPHRHTYLEHNYPCSGLDRNYCRNPDGREEAPWCFTLDPSVRRQLCSHIPRC-AQPTAGS 313          

HSP 2 Score: 80.4925 bits (197), Expect = 4.130e-17
Identity = 74/252 (29.37%), Postives = 98/252 (38.89%), Query Frame = 1
Query:  190 PAILPDESFADASNYCRNLDNDTVGAWCYVRNGD-----LYIKKYC---KTQCSGIWG--CLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNISQTTGSL 897
            P   P+    D  NYCRN  N  +  WC+  +         IK  C   K     + G  CL +R G  Y+G  N T     C +W  +      Y + N+P + +    NYCRNP      PWC+      R   C  IP C Q +  +     SG A          Y G ++ T +   C  WN TS + P+Y                 CRNP  D  GPWC+T       +YCSV  C  +    SL
Sbjct:  170 PDRFPNAGLDD--NYCRN-PNGRMRPWCFTTDPHQPWEYCSIKPGCCASKATRPAMEGRPCLEER-GEDYRGRANHTKGGIPCQHWAAQQPHRHTYLEHNYPCSGLDR--NYCRNPDGREEAPWCFTLDPSVRRQLCSHIPRCAQPTAGSQCYSGSGTA----------YRGGVATTRHGLQCQAWNATSPHKPWYTPKSHPGAGLEGHS---CRNPDGDPWGPWCFTSDPHLPWDYCSVEACGDNFPLSSL 402          

HSP 3 Score: 73.559 bits (179), Expect = 7.908e-15
Identity = 65/206 (31.55%), Postives = 86/206 (41.75%), Query Frame = 1
Query:  289 DLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANW---NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSV-PQCNISQTT 888
            DLY +K        + GC Y   GS Y+G  N T++   C  W       S Y  S +P   +    N CRNP    G PWC+   +  R   C IP C +     P  +  G            Y G +  T +   C  W+    +N  Y  P  F  + + +  NYCRNP N  M PWC+T    Q  EYCS+ P C  S+ T
Sbjct:   40 DLYERK------EYVRGC-YTGNGSGYRGDKNYTESGLPCQAWGDSEPHDSRYLPSFYPAFDLE--GNSCRNPAQEPGEPWCYTMDSNRRRERCGIPRCDE----VPCVECRGE----------HYRGLVDHTDSQRECQRWDLQHPHNHNYT-PDRFPNAGLDD--NYCRNP-NGRMRPWCFTTDPHQPWEYCSIKPGCCASKAT 218          
BLAST of plasminogen-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003778.1 (pep scaffold:Pmarinus_7.0:GL482904:4425:14035:-1 gene:ENSPMAG00000003419.1 transcript:ENSPMAT00000003778.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 1.955e-13
Identity = 48/185 (25.95%), Postives = 82/185 (44.32%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANW--NLKGSL-YTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQ----QSSPLAPLTKTSGNATCKS----TAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMS-GVQ-EYCSVPQCN 873
            G  Y G V+ T + + C  W  N    + +   + PE  +    N+CRNP  ++ GPWC+ +  +     C +P C     Q  P++P    +  A           G +Y G +++T +   C  W+  + +   Y+ P+    + +      CRNP  D  G WCYT   G+  +YC++  C+
Sbjct:  112 GEQYIGNVSFTKSGRQCQLWTSNFPHQVRFKPVDHPEKQLV--ENFCRNPDASQDGPWCYTRDPLVPREPCSVPTCDKDPNQHVPVSPRVTPTKPAPRPQGPCVPGAGEDYRGPVNVTRSGRHCQAWSAQTPHVSRYS-PLTHRAAGLEGA--ACRNPDGDEEGAWCYTTDPGLTIDYCALHYCD 291          

HSP 2 Score: 58.151 bits (139), Expect = 1.166e-9
Identity = 32/81 (39.51%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  637 TAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGV--QEYCSVPQCN 873
            T  G +Y GN+S T +   C LW T++F +    +PV      + E  N+CRNP     GPWCYT   +  +E CSVP C+
Sbjct:  109 TGNGEQYIGNVSFTKSGRQCQLW-TSNFPHQVRFKPVDHPEKQLVE--NFCRNPDASQDGPWCYTRDPLVPREPCSVPTCD 186          
BLAST of plasminogen-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001728.1 (pep scaffold:Pmarinus_7.0:GL477419:32233:56220:-1 gene:ENSPMAG00000001561.1 transcript:ENSPMAT00000001728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 1.008e-11
Identity = 68/245 (27.76%), Postives = 109/245 (44.49%), Query Frame = 1
Query:  208 ESFADAS---NYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQ--CSGIWGCLYDRIGSYYQGTVN---ITDTNQACANWNLKGSL-YTDSNFPENS--IANASNYCRNPTNNRGGPWCWLQSNITR---FGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGE--------YAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQC 870
            E F +A    NYCRN D+D  G WC  ++ ++ + +YC  Q   SG      ++  +  +G  N   +  TN A    + + ++ ++ S  P+N   ++  ++YC        G WC   +N  R   +  C I +C       P  + + + T  STA+ G+        Y G  ++T+   TC  W + S   P+ +Q V  N +       YCRNP  D  GPWCYT       +YC +  C
Sbjct:   48 EGFPEAGLENNYCRNPDSDPNGPWCITQDPNV-LWEYCALQRCASGPSPTGAEQRATLSRGEKNGLSVRSTNPAPNVPHYRRAIPHSRSYNPDNGPCLSLQTSYCYT-QQQPPGLWCNSANNHFRRNSWEHCDI-YCDSFIQTNPFARPNAD-TLPSTALFGQDCVFGSRGYRGAQAVTSGGKTCQAWASQS---PHRHQFVPANYTDADLSLGYCRNPDGDLAGPWCYTTDSATRWQYCGIAHC 285          
BLAST of plasminogen-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005055.1 (pep scaffold:Pmarinus_7.0:GL479085:195887:200886:-1 gene:ENSPMAG00000004594.1 transcript:ENSPMAT00000005055.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 7.709e-8
Identity = 33/102 (32.35%), Postives = 44/102 (43.14%), Query Frame = 1
Query:  640 AIGGEYAGNISITTNNNTCALWNTTSFYNPYY-------------NQPVLFNTS------TMAEVF---NYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
             +G  Y G +S TT+   C  W+T   + P Y             +  V+ + S      T  E+    N+CRNP +   GPWCYT    Q  E CSVP C 
Sbjct:   45 GLGISYRGTVSKTTSGRQCQFWSTNKPHRPKYLPFSRCEWTNARQHLSVMLSASHHFTPWTHPELGLEDNFCRNPDHGVSGPWCYTTDPAQRWEVCSVPACR 146          
BLAST of plasminogen-1 vs. Ensembl Nematostella
Match: EDO48215 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKA9])

HSP 1 Score: 56.225 bits (134), Expect = 1.022e-8
Identity = 35/113 (30.97%), Postives = 54/113 (47.79%), Query Frame = 1
Query:  646 GGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEV---FNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNISQTTGSLKKNTVIQIESKILVLTCCAILAFI 969
            G  Y GNIS+T     C  WN T+   P+++   L + +T  E+    NYCRNP      PWC+T    Q  +YC + +C+         +  VI + S +  +  C ++A I
Sbjct:  258 GEHYNGNISVTEKGFGCQRWNVTT---PHFH---LMSPATYHELRGGHNYCRNPGGKKQRPWCFTTDPRQRYDYCDIAKCD---------EPPVIHVVSILYTVIPCLLIAVI 355          

HSP 2 Score: 49.6766 bits (117), Expect = 1.170e-6
Identity = 21/76 (27.63%), Postives = 35/76 (46.05%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWNLKG-SLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQ 582
            G +Y G +++T+    C  WN+     +  S    + +    NYCRNP   +  PWC+      R+ +C I  C +
Sbjct:  258 GEHYNGNISVTEKGFGCQRWNVTTPHFHLMSPATYHELRGGHNYCRNPGGKKQRPWCFTTDPRQRYDYCDIAKCDE 333          
BLAST of plasminogen-1 vs. Ensembl Nematostella
Match: EDO28926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T536])

HSP 1 Score: 49.6766 bits (117), Expect = 3.897e-8
Identity = 27/83 (32.53%), Postives = 44/83 (53.01%), Query Frame = 1
Query:  340 CLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFPENSIANASNYCRNPTN-NRGGPWCWLQSNITRFGFCRIPFC 576
            C Y   G  Y G +N+T +  +C  W+ +      +  + +PE  + NASN+CRNP      GPWC+  + + R+ +C +P C
Sbjct:    2 CYYGE-GVGYHGNINVTKSGISCQPWSSQCPHHHYHNSTQYPE--LINASNFCRNPGGMGPDGPWCYTTNKLVRWEYCDVPKC 81          

HSP 2 Score: 47.7506 bits (112), Expect = 1.924e-7
Identity = 31/81 (38.27%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  646 GGEYAGNISITTNNNTCALWNTTSFYNPYYNQ---PVLFNTSTMAEVFNYCRNPSN-DTMGPWCYTMSGV--QEYCSVPQC 870
            G  Y GNI++T +  +C  W++   ++ Y+N    P L N S      N+CRNP      GPWCYT + +   EYC VP+C
Sbjct:    7 GVGYHGNINVTKSGISCQPWSSQCPHHHYHNSTQYPELINAS------NFCRNPGGMGPDGPWCYTTNKLVRWEYCDVPKC 81          
BLAST of plasminogen-1 vs. Ensembl Nematostella
Match: EDO43993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX97])

HSP 1 Score: 50.447 bits (119), Expect = 5.259e-7
Identity = 42/174 (24.14%), Postives = 69/174 (39.66%), Query Frame = 1
Query:  481 NYCRNPTNNRGGPWCWLQSNITRFGFCR-IPFCQ-QSSPLAPLTKTSGNATCKST-------AIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQCNISQTTGSLKKNTVIQIESKILVLTCCAILAFISV 975
             +CR+         C L+ +  +  F + +P C     P +P  KT    T K           G +Y G +++T     C  W +        N PV +  S      N+CRNP      PWCY      EYC +P+C  S+ + ++           +L+L   +I+ ++ V
Sbjct:   73 RFCRDDCEVLQNTVCKLEFHYAKQRFAKMLPDCSVLPGPGSPEYKTCIRVTMKGEDNQYCYNGTGEDYIGRLNVTKYGMPCLSWKS--------NDPV-YKLS-----HNFCRNPRGQHEAPWCYVDKNTYEYCVIPKC--SEASDAI---------MAVLILAFVSIIVYLKV 221          

HSP 2 Score: 46.595 bits (109), Expect = 8.558e-6
Identity = 24/81 (29.63%), Postives = 37/81 (45.68%), Query Frame = 1
Query:  346 YDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSS 588
            Y+  G  Y G +N+T     C +W     +Y  S+          N+CRNP      PWC++  N   + +C IP C ++S
Sbjct:  133 YNGTGEDYIGRLNVTKYGMPCLSWKSNDPVYKLSH----------NFCRNPRGQHEAPWCYVDKNT--YEYCVIPKCSEAS 201          
BLAST of plasminogen-1 vs. Ensembl Nematostella
Match: EDO39763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S935])

HSP 1 Score: 46.2098 bits (108), Expect = 1.005e-6
Identity = 26/81 (32.10%), Postives = 41/81 (50.62%), Query Frame = 1
Query:  340 CLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPE-NSIANASNYCRNPTN-NRGGPWCWLQSNITRFGFCRIPFC 576
            C Y   G  Y G +N+T +  +C  W+ +       N  +   + NASN+CRNP      GPWC+  + + R+ +C +P C
Sbjct:   11 CYYGE-GVGYHGNINVTKSGISCQPWSSQCPHRHYHNSTQYTELINASNFCRNPGGMGPDGPWCYTTNMMVRWEYCDVPKC 90          

HSP 2 Score: 45.8246 bits (107), Expect = 1.442e-6
Identity = 28/78 (35.90%), Postives = 40/78 (51.28%), Query Frame = 1
Query:  646 GGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSN-DTMGPWCYT--MSGVQEYCSVPQC 870
            G  Y GNI++T +  +C  W++   +  Y+N       + +    N+CRNP      GPWCYT  M    EYC VP+C
Sbjct:   16 GVGYHGNINVTKSGISCQPWSSQCPHRHYHNS---TQYTELINASNFCRNPGGMGPDGPWCYTTNMMVRWEYCDVPKC 90          
BLAST of plasminogen-1 vs. Ensembl Nematostella
Match: EDO30193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1H4])

HSP 1 Score: 44.669 bits (104), Expect = 2.300e-6
Identity = 24/80 (30.00%), Postives = 35/80 (43.75%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWN----LKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQS 585
            G  Y+GT+N T     C  WN     + +   D            NYCRNP   +  PWC+     TR+ +C I  C+++
Sbjct:    2 GRDYRGTMNFTAKGVTCQPWNEQWPHQHTEMADPLVAAREGLGKHNYCRNPGGRKHRPWCYTTLEKTRWQYCEIRSCRKT 81          
BLAST of plasminogen-1 vs. Ensembl Medaka
Match: hgfb (hepatocyte growth factor [Source:NCBI gene;Acc:101167035])

HSP 1 Score: 85.5001 bits (210), Expect = 7.348e-18
Identity = 68/223 (30.49%), Postives = 109/223 (48.88%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIK-KYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNL---KGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQE--YCS-VPQC 870
             NYCRN DN TVG WC+  +    ++ + C   QCS +  C+ +  G  Y+G ++ T++ + C  W+L      L+    +P+  + +  NYCRNP N R  PWC+     T + +C I  C ++ P + + +T+     K    G  Y G + +T    TC  W++   +N  +  P  +    + E  NYCRNP      PWC+T        +C+ +PQC
Sbjct:  152 ENYCRNPDNSTVGPWCFTTDPRPQLRHQECGIPQCSEV-ECI-NCNGEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGLDD--NYCRNP-NGRHRPWCFTTDPNTPWEYCTIKVC-ETPPDSNVVETTECFQGK----GEGYRGVVDMTPTGLTCQRWDSQYPHNHSF-IPEAYRCKDLRE--NYCRNPDGQDF-PWCFTTDPRVRTMFCTNIPQC 360          

HSP 2 Score: 80.8777 bits (198), Expect = 2.053e-16
Identity = 80/256 (31.25%), Postives = 103/256 (40.23%), Query Frame = 1
Query:  181 IFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNG----DLYIKKYCKT----QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENS--IANA-------SNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCNISQTT 888
            +FHP   PD+   D  NYCRN  N     WC+  +     +    K C+T           C   + G  Y+G V++T T   C  W        DS +P N   I  A        NYCRNP + +  PWC+      R  FC  IP C   + LA     S         +G  Y G  S T +N  C  W   S  N      ++          NYCRNP  D  GPWCYT +     +YCS+  C+ SQ T
Sbjct:  224 LFHPKRYPDKGLDD--NYCRN-PNGRHRPWCFTTDPNTPWEYCTIKVCETPPDSNVVETTECFQGK-GEGYRGVVDMTPTGLTCQRW--------DSQYPHNHSFIPEAYRCKDLRENYCRNP-DGQDFPWCFTTDPRVRTMFCTNIPQCGTQNRLANECYES---------LGENYRGQQSRTRSNLPCGPWREHS--NSGERGMLMVGLEG-----NYCRNPDGDKHGPWCYTNNSAISWDYCSIKPCDASQNT 450          

HSP 3 Score: 48.9062 bits (115), Expect = 5.436e-6
Identity = 38/133 (28.57%), Postives = 54/133 (40.60%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIK-----KYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENS---IANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAP 600
             NYCRN D      WC+  +  +          C TQ      C Y+ +G  Y+G  + T +N  C  W         SN  E     +    NYCRNP  ++ GPWC+  ++   + +C I  C  S    P
Sbjct:  328 ENYCRNPDGQDF-PWCFTTDPRVRTMFCTNIPQCGTQNRLANEC-YESLGENYRGQQSRTRSNLPCGPWR------EHSNSGERGMLMVGLEGNYCRNPDGDKHGPWCYTNNSAISWDYCSIKPCDASQNTIP 452          
BLAST of plasminogen-1 vs. Ensembl Medaka
Match: hgfb (hepatocyte growth factor [Source:NCBI gene;Acc:101167035])

HSP 1 Score: 85.1149 bits (209), Expect = 1.016e-17
Identity = 68/223 (30.49%), Postives = 109/223 (48.88%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIK-KYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNL---KGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQE--YCS-VPQC 870
             NYCRN DN TVG WC+  +    ++ + C   QCS +  C+ +  G  Y+G ++ T++ + C  W+L      L+    +P+  + +  NYCRNP N R  PWC+     T + +C I  C ++ P + + +T+     K    G  Y G + +T    TC  W++   +N  +  P  +    + E  NYCRNP      PWC+T        +C+ +PQC
Sbjct:  158 ENYCRNPDNSTVGPWCFTTDPRPQLRHQECGIPQCSEV-ECI-NCNGEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGLDD--NYCRNP-NGRHRPWCFTTDPNTPWEYCTIKVC-ETPPDSNVVETTECFQGK----GEGYRGVVDMTPTGLTCQRWDSQYPHNHSF-IPEAYRCKDLRE--NYCRNPDGQDF-PWCFTTDPRVRTMFCTNIPQC 366          

HSP 2 Score: 80.4925 bits (197), Expect = 3.105e-16
Identity = 80/256 (31.25%), Postives = 104/256 (40.62%), Query Frame = 1
Query:  181 IFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIK----KYCKT----QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENS--IANA-------SNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGV--QEYCSVPQCNISQTT 888
            +FHP   PD+   D  NYCRN  N     WC+  + +   +    K C+T           C   + G  Y+G V++T T   C  W        DS +P N   I  A        NYCRNP + +  PWC+      R  FC  IP C   + LA     S         +G  Y G  S T +N  C  W   S  N      ++          NYCRNP  D  GPWCYT +     +YCS+  C+ SQ T
Sbjct:  230 LFHPKRYPDKGLDD--NYCRN-PNGRHRPWCFTTDPNTPWEYCTIKVCETPPDSNVVETTECFQGK-GEGYRGVVDMTPTGLTCQRW--------DSQYPHNHSFIPEAYRCKDLRENYCRNP-DGQDFPWCFTTDPRVRTMFCTNIPQCGTQNRLANECYES---------LGENYRGQQSRTRSNLPCGPWREHS--NSGERGMLMVGLEG-----NYCRNPDGDKHGPWCYTNNSAISWDYCSIKPCDASQNT 456          

HSP 3 Score: 48.521 bits (114), Expect = 6.540e-6
Identity = 38/133 (28.57%), Postives = 54/133 (40.60%), Query Frame = 1
Query:  226 SNYCRNLDNDTVGAWCYVRNGDLYIK-----KYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENS---IANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAP 600
             NYCRN D      WC+  +  +          C TQ      C Y+ +G  Y+G  + T +N  C  W         SN  E     +    NYCRNP  ++ GPWC+  ++   + +C I  C  S    P
Sbjct:  334 ENYCRNPDGQDF-PWCFTTDPRVRTMFCTNIPQCGTQNRLANEC-YESLGENYRGQQSRTRSNLPCGPWR------EHSNSGERGMLMVGLEGNYCRNPDGDKHGPWCYTNNSAISWDYCSIKPCDASQNTIP 458          
BLAST of plasminogen-1 vs. Ensembl Medaka
Match: mst1 (hepatocyte growth factor-like protein [Source:NCBI gene;Acc:101168450])

HSP 1 Score: 83.5741 bits (205), Expect = 3.203e-17
Identity = 60/209 (28.71%), Postives = 94/209 (44.98%), Query Frame = 1
Query:  229 NYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRI-----GSYYQGTVNITDTNQACANWNLKG---SLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT 831
            NYCRN D D +G WCY  + +   +     QC        D +     G  Y+G V+ T T + C  W+ +     +Y    +P+ S+ +  NYCRNP +    PWC+    +     C I  C +  P+    ++S    C     G +Y G ++ T +   C  WN   F + +   P ++    + E  NYCRNP + +  PWC+T
Sbjct:  154 NYCRNPDGDNIGPWCYTTDPERRYESCNIPQCK-------DEVCITCNGEDYRGQVDHTATGKECQRWDQQHPHQHIYQPEKYPDKSLDD--NYCRNP-DASPVPWCYTTDPLVERENCNISKCPE-VPVEKRQRSSFTTNC-FRGRGEDYRGKVNETLSGIPCQRWN-AQFPHEHPFHPNIYECKGLEE--NYCRNP-DGSEAPWCFT 346          

HSP 2 Score: 82.8037 bits (203), Expect = 4.585e-17
Identity = 74/253 (29.25%), Postives = 99/253 (39.13%), Query Frame = 1
Query:  181 IFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYC-----------KTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIAN---------ASNYCRNPTNNRGGPWCWLQSNITRFGFC-RIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQE--YCSVPQC 870
            I+ P   PD+S  D  NYCRN D   V  WCY  +  L  ++ C           K Q S      +   G  Y+G VN T +   C  WN        + FP     +           NYCRNP  +   PWC+  +   R   C +I  C+         + +G            Y G +  T    TC  WN  + +    N P+    + + E  NYCRNP  D  GPWCYT     E  YC++ QC
Sbjct:  223 IYQPEKYPDKSLDD--NYCRNPDASPV-PWCYTTD-PLVERENCNISKCPEVPVEKRQRSSFTTNCFRGRGEDYRGKVNETLSGIPCQRWN--------AQFPHEHPFHPNIYECKGLEENYCRNPDGSEA-PWCFTSAPEMRTALCLQIKRCEDDIEAEDCYQENGK----------NYRGIVRKTRKGVTCQRWNVNTPHRTKIN-PLTHPEANLTE--NYCRNPDGDQHGPWCYTTDPKTEFDYCAIKQC 449          

HSP 3 Score: 68.5514 bits (166), Expect = 2.698e-12
Identity = 59/200 (29.50%), Postives = 83/200 (41.50%), Query Frame = 1
Query:  283 NGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNF--PENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGV--QEYCSVPQC 870
            N DLY KK    QC  I G      G  Y+G V  T +   C  W    S +   ++  P  S     NYCRNP  +  GPWC+      R+  C IP C+    +              T  G +Y G +  T     C  W+    +   Y QP  +   ++ +  NYCRNP    + PWCYT   +  +E C++ +C
Sbjct:   96 NCDLYEKKVYVRQC--IVG-----KGEDYRGKVFTTKSGLNCQQW---WSKFPHDHWWTPTASNGLELNYCRNPDGDNIGPWCYTTDPERRYESCNIPQCKDEVCI--------------TCNGEDYRGQVDHTATGKECQRWDQQHPHQHIY-QPEKYPDKSLDD--NYCRNPDASPV-PWCYTTDPLVERENCNISKC 267          
BLAST of plasminogen-1 vs. Ensembl Medaka
Match: f2 (prothrombin [Source:NCBI gene;Acc:101170246])

HSP 1 Score: 80.8777 bits (198), Expect = 2.121e-16
Identity = 48/177 (27.12%), Postives = 78/177 (44.07%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWN--LKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT-MSG--VQEYCSVPQCN 873
            G  Y G ++IT + + C +W+      ++ + N  E +     N+CRNP     GPWC+ +    +   CR+P C +      +       T      G +Y G++S+T   +TC  W++        ++  +          N CRNP ND  GPWCY  +SG    +YC +  C 
Sbjct:   89 GHNYNGNIHITKSGRVCQHWSHSFPHPIFREFNASEPNSILQENFCRNPDKRSEGPWCFTKDPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPNYGVDYTGDLSVTLGGHTCIQWSSPQAKALSKDKEFIPEVQLTG---NKCRNPDNDPEGPWCYVHISGNITVDYCDLDLCE 262          

HSP 2 Score: 51.9878 bits (123), Expect = 5.479e-7
Identity = 40/153 (26.14%), Postives = 65/153 (42.48%), Query Frame = 1
Query:  175 NPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRN-------------GDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWN--LKGSLYTDSNF-PENSIANASNYCRNPTNNRGGPWCWLQ--SNITRFGFCRIPFCQ 579
            +PIF      + +     N+CRN D  + G WC+ ++             G+ ++      +      CL +  G  Y G +++T     C  W+     +L  D  F PE  +    N CRNP N+  GPWC++    NIT   +C +  C+
Sbjct:  114 HPIFREFNASEPNSILQENFCRNPDKRSEGPWCFTKDPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPN-YGVDYTGDLSVTLGGHTCIQWSSPQAKALSKDKEFIPE--VQLTGNKCRNPDNDPEGPWCYVHISGNIT-VDYCDLDLCE 262          
BLAST of plasminogen-1 vs. Ensembl Medaka
Match: f2 (prothrombin [Source:NCBI gene;Acc:101170246])

HSP 1 Score: 80.4925 bits (197), Expect = 2.504e-16
Identity = 48/177 (27.12%), Postives = 78/177 (44.07%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANWN--LKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT-MSG--VQEYCSVPQCN 873
            G  Y G ++IT + + C +W+      ++ + N  E +     N+CRNP     GPWC+ +    +   CR+P C +      +       T      G +Y G++S+T   +TC  W++        ++  +          N CRNP ND  GPWCY  +SG    +YC +  C 
Sbjct:  116 GHNYNGNIHITKSGRVCQHWSHSFPHPIFREFNASEPNSILQENFCRNPDKRSEGPWCFTKDPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPNYGVDYTGDLSVTLGGHTCIQWSSPQAKALSKDKEFIPEVQLTG---NKCRNPDNDPEGPWCYVHISGNITVDYCDLDLCE 289          

HSP 2 Score: 51.9878 bits (123), Expect = 5.433e-7
Identity = 40/153 (26.14%), Postives = 65/153 (42.48%), Query Frame = 1
Query:  175 NPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRN-------------GDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWN--LKGSLYTDSNF-PENSIANASNYCRNPTNNRGGPWCWLQ--SNITRFGFCRIPFCQ 579
            +PIF      + +     N+CRN D  + G WC+ ++             G+ ++      +      CL +  G  Y G +++T     C  W+     +L  D  F PE  +    N CRNP N+  GPWC++    NIT   +C +  C+
Sbjct:  141 HPIFREFNASEPNSILQENFCRNPDKRSEGPWCFTKDPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPN-YGVDYTGDLSVTLGGHTCIQWSSPQAKALSKDKEFIPEVQL--TGNKCRNPDNDPEGPWCYVHISGNIT-VDYCDLDLCE 289          
BLAST of plasminogen-1 vs. Planmine SMEST
Match: SMESG000018453.1 (SMESG000018453.1)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 324/331 (97.89%), Postives = 325/331 (98.19%), Query Frame = 1
Query:    1 MAPVCKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQCNISQTTGSLKKNTVIQIESKILVLTCCAILAFISVTGGHFH 993
            MAPVCKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLS  SNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIW CLYDRIGSYYQGTVNITD+NQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNN GGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEY GNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYC VPQCNISQTTGSLKKNTVIQIESKILVLTCCAILAFISVTGGHFH
Sbjct:  195 MAPVCKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSGGSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWACLYDRIGSYYQGTVNITDSNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNPGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYGGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCPVPQCNISQTTGSLKKNTVIQIESKILVLTCCAILAFISVTGGHFH 525          

HSP 2 Score: 98.5969 bits (244), Expect = 1.645e-22
Identity = 70/186 (37.63%), Postives = 92/186 (49.46%), Query Frame = 1
Query:  349 DRIGSYYQGTVNITDTNQACANW-NLKGSL--YTDSNFPENSIANASNYCRNPTNNRG----GPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQ---PVLFNTSTMAEVFNYCRNPSNDTMGPWCYT--MSGVQEYCSVPQC 870
            D IG  Y G  +++D    CA W N  G+L   + S FP+ SI NA NYCRNP +  G     PWCWLQ+N   FG+C IP C                 C++T IG  + G IS T +  TC  WN+ S +   YN    P+     T+ +  N CRNP++   G WC+T   + V E C  P C
Sbjct:   31 DSIGIEYIGNQSVSDIG-PCAMWFNASGNLNYLSSSQFPDTSIQNAKNYCRNPKSPLGVYEPRPWCWLQTNPDTFGYCTIPLC--------------TGICRNTYIGETFRGTISKTISGQTCQNWNSQSPHTHSYNSGNWPI--QGETIDQAGNNCRNPNSSPYGLWCFTNISTPVWEPCMAPVC 199          

HSP 3 Score: 79.337 bits (194), Expect = 5.102e-16
Identity = 72/254 (28.35%), Postives = 106/254 (41.73%), Query Frame = 1
Query:  199 LPDESFADASNYCRN----LDNDTVGAWCYVR-NGDLYIKKYCKTQ-CSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSL---YTDSNFP--ENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSF----------------YNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG---VQEYCSVPQC 870
             PD S  +A NYCRN    L       WC+++ N D +   YC    C+GI  C    IG  ++GT++ T + Q C NWN +      Y   N+P    +I  A N CRNP ++  G WC+   +   +  C  P C+ +S             C +      +    S      +C  W +                    NP +  P +    + A+  NYCRN  NDT+G WCY  +G   +++YC   QC
Sbjct:   67 FPDTSIQNAKNYCRNPKSPLGVYEPRPWCWLQTNPDTF--GYCTIPLCTGI--CRNTYIGETFRGTISKTISGQTCQNWNSQSPHTHSYNSGNWPIQGETIDQAGNNCRNPNSSPYGLWCFTNISTPVWEPCMAPVCKSTS------------NCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSGGSNVNPIF-HPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-QC 302          
BLAST of plasminogen-1 vs. Planmine SMEST
Match: SMESG000018456.1 (SMESG000018456.1)

HSP 1 Score: 399.823 bits (1026), Expect = 2.430e-129
Identity = 197/304 (64.80%), Postives = 244/304 (80.26%), Query Frame = 1
Query:    1 MAPVCKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSISSN-VNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALW-NTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQCNISQTTGSLKKN 906
            MAPVCKST+ CVNGVTNYLFKSQT+TEQ+L+SCVPW ++PLQY+N ++ P++  +S+ VNPIFHPA+LPD S +DASNYCRN DNDTVG WCY             T CSGIW CL+DR GSYYQG V++T+ N+ CA W+ KGS+YT++NFPENSIANA+NYCRNPTNN GGPWCWLQS++ +FGFC IP CQQ+ PL PLT T+GNATC+ST  G EYAG I+ITTN+N CA W  TT+FYNPY+N+P+LF T+TMAEV NYCRNP+ D  GPWCYT +G QEYC++P+C  + T  ++ +N
Sbjct:  195 MAPVCKSTTGCVNGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCY-------------TPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFCTIPTCQQTPPLPPLTTTAGNATCQSTTSGVEYAGTIAITTNSNPCAPWTTTTTFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKC-FTTTPATITRN 484          

HSP 2 Score: 108.612 bits (270), Expect = 9.976e-26
Identity = 89/297 (29.97%), Postives = 132/297 (44.44%), Query Frame = 1
Query:    7 PVCKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTV-GAWCYV-RNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANW-NLKGSLYTDSNFPENSIANASNYCRNPTN--NRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQCNISQ 882
            P   + +NC   V    +    ST    ++C  W SV                   N  F+ +  PD S A+A NYCRNL    + G +C+V  N  + +   C T       C     G  Y GT  I+ +   C  W N+  +    + FP+ SI  A NYCR+P+N  +  GP+C+  +++T    C I +C                 C+++    +YAG I   TN+  C  W  T   N  +  P L N + + +  NYCRNP +D +GPWCY  S V+ YC +P C+ +Q
Sbjct:  478 PATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSV------------------TNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTAT-----CRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCY--TSLTTTETCNISYCTPQ--------------CRNSQTATDYAG-IVNRTNSGVCMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQ 732          

HSP 3 Score: 95.9005 bits (237), Expect = 2.145e-21
Identity = 73/212 (34.43%), Postives = 99/212 (46.70%), Query Frame = 1
Query:  292 LYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKG---SLYTDSNFPENSIANASNYCRNPTNNRG----GPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQ---PVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSG--VQEYCSVPQCNISQTTG 891
            L+ K   +  C  +     D +G  Y GT + +D N  CA W       +    S FP+ SI NA NYCRNP++  G     PWCWLQ++   FG+C IP C                 C++T+ G  + G  S T +  TC  W++ S +   YN    P+     T+ +  N CRNP+N + G WCYT S   V E C  P C    TTG
Sbjct:   12 LFYKTKSQQSCLEVPKNPGDPLGIEYIGTQSTSD-NGTCAVWTTAAGNVNYLLSSQFPDISIQNAQNYCRNPSSPIGIYEPRPWCWLQADTKSFGYCTIPSCA--------------GICRTTSFGEIFQGTGSKTISGLTCQNWSSQSPHAHSYNSGNWPI--TGETIVQAGNNCRNPNNSSFGLWCYTTSAFPVWEPCMAPVC--KSTTG 204          

HSP 4 Score: 94.3597 bits (233), Expect = 6.239e-21
Identity = 76/263 (28.90%), Postives = 111/263 (42.21%), Query Frame = 1
Query:  187 HPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQ-CSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSN---------FPENSIANASNYCRNPTNNR---GGPWCWLQ------SNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNT------TSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTM---GPWCYTMSGVQEYCSVPQCNISQTTG 891
            +P +L      DA+NYCRN D+D +G WCY+ +    +K YC+   CS   GC        Y G +N+T    +C  W+       D++          P+ S  +A NYCR PTN     G PWC+        S ++ FG+C +  C                +C +      Y G  + T+N   C +W+T      +    P Y   +L + + +A   NYCR P+ D      PWCY           P   +SQTTG
Sbjct:  685 NPQLLNAAKLEDAANYCRNPDSDPLGPWCYLES---QVKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPTFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC---------------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVA-ANNYCRVPTRDIGYINQPWCYVS---------PSSVLSQTTG 919          

HSP 5 Score: 90.1225 bits (222), Expect = 1.626e-19
Identity = 64/243 (26.34%), Postives = 100/243 (41.15%), Query Frame = 1
Query:  208 ESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANW--------------------NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQE--YCSVPQC 870
            E+   A N CRN +N + G WCY  +     +      C    GC+       ++         Q+C  W                    ++   ++  +  P+ S+++ASNYCRNP N+  G WC+                         T  SG   C     G  Y G +S+T  N TCA+W++        N    F  +++A   NYCRNP+N+T GPWC+  S + +  +C++P C
Sbjct:  161 ETIVQAGNNCRNPNNSSFGLWCYTTSAFPVWEPCMAPVCKSTTGCVNGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCY-------------------------TPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNAN----FPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFCTIPTC 374          

HSP 6 Score: 87.0409 bits (214), Expect = 1.985e-18
Identity = 72/230 (31.30%), Postives = 104/230 (45.22%), Query Frame = 1
Query:  199 LPDESFADASNYCRNLDNDTVG-----AWCYVRNGDLYIKKYCKT-QCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLK---GSLYTDSNFP--ENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYA------GNISITTNNN--TCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYT 831
             PD S  +A NYCRN  +  +G      WC+++  D     YC    C+GI  C     G  +QGT + T +   C NW+ +      Y   N+P    +I  A N CRNP N+  G WC+  S    +  C  P C+ ++          N   KS     +Y        NI +  +N   T  +  T+   NP +  P L   +++++  NYCRNP NDT+G WCYT
Sbjct:   67 FPDISIQNAQNYCRN-PSSPIGIYEPRPWCWLQ-ADTKSFGYCTIPSCAGI--CRTTSFGEIFQGTGSKTISGLTCQNWSSQSPHAHSYNSGNWPITGETIVQAGNNCRNPNNSSFGLWCYTTSAFPVWEPCMAPVCKSTTGCV---NGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATPTILTTSDIVNPIF-HPALLPDASLSDASNYCRNPDNDTVGGWCYT 288          

HSP 7 Score: 75.8702 bits (185), Expect = 9.105e-15
Identity = 66/227 (29.07%), Postives = 92/227 (40.53%), Query Frame = 1
Query:    7 PVCKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTV---GAWCY-----VRNGDLYIKKYCK-TQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWN---------LKGSLYTDSNFPENSIANASNYCRNPTNNRG---GPWCWL-------QSNITRFGFCRIPFCQQSSPLAPL 603
            PVC  T  C      + +    +  +   SC+ W   P         P+L   ++++P F   +LPD S  DA NYCR   N +      WCY     V    L    YC  T C+    C      S Y G  N T     C  W+         L G  Y  S  P+N++  A+NYCR PT + G    PWC++       Q+    FGFC I  C  ++ + P+
Sbjct:  726 PVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYP---------PAL-FDASISPTFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICT---SCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAIINPI 939          
BLAST of plasminogen-1 vs. Planmine SMEST
Match: SMESG000026301.1 (SMESG000026301.1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.099e-21
Identity = 59/170 (34.71%), Postives = 82/170 (48.24%), Query Frame = 1
Query:  379 VNITDTNQACANWN--LKGSLYTD-SNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEY--CSVPQCN 873
            +N + T + CA W+  L   L  D  NFPE       NYCRNP N R G WC +  N   + +C +P C              N  CK +  G EY G+I+ITT+   C  W T + +  +     LF  + + E  N CRNP     GPWCYT++    +  C+VP+C+
Sbjct:    1 MNESTTGKRCAQWSKSLLDRLKVDVENFPELEGVFTQNYCRNPKNFRNGLWCVVDENSLDWEYCNVPIC-----------IKDNNWCKDSDKGEEYYGDINITTSGLACRKWITQNNFKEH-----LFPENNLTEAGNNCRNPDGHANGPWCYTLNQNVRWGECNVPRCD 154          

HSP 2 Score: 70.4774 bits (171), Expect = 5.332e-13
Identity = 44/135 (32.59%), Postives = 61/135 (45.19%), Query Frame = 1
Query:  199 LPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYD-------RIGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQ 582
             P+       NYCRN  N   G WC V    L  + YC         C+ D         G  Y G +NIT +  AC  W  + + + +  FPEN++  A N CRNP  +  GPWC+  +   R+G C +P C +
Sbjct:   28 FPELEGVFTQNYCRNPKNFRNGLWCVVDENSLDWE-YCNVPI-----CIKDNNWCKDSDKGEEYYGDINITTSGLACRKWITQNN-FKEHLFPENNLTEAGNNCRNPDGHANGPWCYTLNQNVRWGECNVPRCDK 155          
BLAST of plasminogen-1 vs. Planmine SMEST
Match: SMESG000026300.1 (SMESG000026300.1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.589e-20
Identity = 54/177 (30.51%), Postives = 80/177 (45.20%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANW---NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            GS Y G+V+ T T + C  W   N+K       ++P+       N+CRNP     GPWC +    +++  C IP C                 CK + +GGEY GNI+ T +   C +W+    ++        F    + +V N CRNP   T GPWC+  S     E C++P C+
Sbjct:   24 GSEYIGSVDRTKTGKICQKWSEENIKKFKLQFLDYPDRESIVTHNFCRNPNQVPDGPWCIVDRENSKWEHCDIPSC-----------IKDRNWCKDSELGGEYFGNINFTKSGKPCRVWSDKDTFDGKS-----FPEKNLKDVGNKCRNPDGKTSGPWCFVSSEDDNWENCNIPNCD 184          

HSP 2 Score: 67.781 bits (164), Expect = 4.138e-12
Identity = 40/134 (29.85%), Postives = 61/134 (45.52%), Query Frame = 1
Query:  202 PDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDR-------IGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQ 582
            PD       N+CRN +    G WC V       ++  K +   I  C+ DR       +G  Y G +N T + + C  W+ K + +   +FPE ++ +  N CRNP     GPWC++ S    +  C IP C +
Sbjct:   59 PDRESIVTHNFCRNPNQVPDGPWCIVD------RENSKWEHCDIPSCIKDRNWCKDSELGGEYFGNINFTKSGKPCRVWSDKDT-FDGKSFPEKNLKDVGNKCRNPDGKTSGPWCFVSSEDDNWENCNIPNCDE 185          
BLAST of plasminogen-1 vs. Planmine SMEST
Match: SMESG000026300.1 (SMESG000026300.1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.754e-20
Identity = 54/177 (30.51%), Postives = 80/177 (45.20%), Query Frame = 1
Query:  358 GSYYQGTVNITDTNQACANW---NLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQ--EYCSVPQCN 873
            GS Y G+V+ T T + C  W   N+K       ++P+       N+CRNP     GPWC +    +++  C IP C                 CK + +GGEY GNI+ T +   C +W+    ++        F    + +V N CRNP   T GPWC+  S     E C++P C+
Sbjct:   46 GSEYIGSVDRTKTGKICQKWSEENIKKFKLQFLDYPDRESIVTHNFCRNPNQVPDGPWCIVDRENSKWEHCDIPSC-----------IKDRNWCKDSELGGEYFGNINFTKSGKPCRVWSDKDTFDGKS-----FPEKNLKDVGNKCRNPDGKTSGPWCFVSSEDDNWENCNIPNCD 206          

HSP 2 Score: 67.781 bits (164), Expect = 4.391e-12
Identity = 40/134 (29.85%), Postives = 61/134 (45.52%), Query Frame = 1
Query:  202 PDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWGCLYDR-------IGSYYQGTVNITDTNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQ 582
            PD       N+CRN +    G WC V       ++  K +   I  C+ DR       +G  Y G +N T + + C  W+ K + +   +FPE ++ +  N CRNP     GPWC++ S    +  C IP C +
Sbjct:   81 PDRESIVTHNFCRNPNQVPDGPWCIVD------RENSKWEHCDIPSCIKDRNWCKDSELGGEYFGNINFTKSGKPCRVWSDKDT-FDGKSFPEKNLKDVGNKCRNPDGKTSGPWCFVSSEDDNWENCNIPNCDE 207          
The following BLAST results are available for this feature:
BLAST of plasminogen-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLG3.323e-2332.02plasminogen [Source:HGNC Symbol;Acc:HGNC:9071][more]
MST16.691e-1726.57macrophage stimulating 1 [Source:HGNC Symbol;Acc:H... [more]
HGF1.519e-1629.27hepatocyte growth factor [Source:HGNC Symbol;Acc:H... [more]
HGF1.645e-1629.27hepatocyte growth factor [Source:HGNC Symbol;Acc:H... [more]
F23.313e-1628.64coagulation factor II, thrombin [Source:HGNC Symbo... [more]
back to top
BLAST of plasminogen-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cam-14.984e-936.36Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-15.012e-936.36Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-15.440e-936.36Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
back to top
BLAST of plasminogen-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nrk5.469e-726.50gene:FBgn0020391 transcript:FBtr0087728[more]
Ror9.720e-635.14gene:FBgn0010407 transcript:FBtr0079978[more]
back to top
BLAST of plasminogen-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plg1.204e-2029.79plasminogen [Source:ZFIN;Acc:ZDB-GENE-030131-1411][more]
hgfb7.600e-1832.37hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GE... [more]
f26.285e-1725.45coagulation factor II (thrombin) [Source:ZFIN;Acc:... [more]
hgfa3.242e-1628.91hepatocyte growth factor a [Source:ZFIN;Acc:ZDB-GE... [more]
hgfa4.270e-1629.51hepatocyte growth factor a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of plasminogen-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000025429.11.041e-2331.67plasminogen [Source:NCBI gene;Acc:100496227][more]
ENSXETT00000037813.11.075e-2332.35plasminogen [Source:NCBI gene;Acc:100496227][more]
ENSXETT00000037804.14.649e-2332.35plasminogen [Source:NCBI gene;Acc:100496227][more]
ENSXETT00000037863.14.769e-2332.35plasminogen [Source:NCBI gene;Acc:100496227][more]
ENSXETT00000025361.16.279e-2332.35plasminogen [Source:NCBI gene;Acc:100496227][more]
back to top
BLAST of plasminogen-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plg5.646e-2231.67plasminogen [Source:MGI Symbol;Acc:MGI:97620][more]
Mst11.074e-1826.32macrophage stimulating 1 (hepatocyte growth factor... [more]
Mst18.390e-1825.51macrophage stimulating 1 (hepatocyte growth factor... [more]
F21.539e-1631.31coagulation factor II [Source:MGI Symbol;Acc:MGI:8... [more]
Hgf1.984e-1628.62hepatocyte growth factor [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of plasminogen-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O18783|PLMN_MACEU4.174e-2532.28Plasminogen OS=Macropus eugenii OX=9315 GN=PLG PE=... [more]
sp|P06868|PLMN_BOVIN5.770e-2332.79Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2[more]
sp|Q5R8X6|PLMN_PONAB8.776e-2332.79Plasminogen OS=Pongo abelii OX=9601 GN=PLG PE=2 SV... [more]
sp|P12545|PLMN_MACMU1.566e-2232.39Plasminogen OS=Macaca mulatta OX=9544 GN=PLG PE=2 ... [more]
sp|P00747|PLMN_HUMAN1.596e-2232.02Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV... [more]
back to top
BLAST of plasminogen-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIL40.000e+097.54Plasminogen-1 (Fragment) OS=Schmidtea mediterranea... [more]
A0A267H0U01.278e-4336.99Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EUC82.834e-4336.64Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HYP52.860e-4338.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H6I26.544e-3631.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of plasminogen-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000018419.25.730e-2030.92plasminogen [Source:NCBI gene;Acc:103036400][more]
ENSAMXT00000018418.26.395e-2030.80plasminogen [Source:NCBI gene;Acc:103036400][more]
hgfa9.698e-1926.69hepatocyte growth factor-like [Source:NCBI gene;Ac... [more]
hgfa1.326e-1826.43hepatocyte growth factor-like [Source:NCBI gene;Ac... [more]
mst18.185e-1829.76macrophage stimulating 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of plasminogen-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hgfb2.826e-1729.27hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000003778.11.955e-1325.95pep scaffold:Pmarinus_7.0:GL482904:4425:14035:-1 g... [more]
ENSPMAT00000001728.11.008e-1127.76pep scaffold:Pmarinus_7.0:GL477419:32233:56220:-1 ... [more]
ENSPMAT00000005055.17.709e-832.35pep scaffold:Pmarinus_7.0:GL479085:195887:200886:-... [more]
back to top
BLAST of plasminogen-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of plasminogen-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO482151.022e-830.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289263.897e-832.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439935.259e-724.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397631.005e-632.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301932.300e-630.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of plasminogen-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hgfb7.348e-1830.49hepatocyte growth factor [Source:NCBI gene;Acc:101... [more]
hgfb1.016e-1730.49hepatocyte growth factor [Source:NCBI gene;Acc:101... [more]
mst13.203e-1728.71hepatocyte growth factor-like protein [Source:NCBI... [more]
f22.121e-1627.12prothrombin [Source:NCBI gene;Acc:101170246][more]
f22.504e-1627.12prothrombin [Source:NCBI gene;Acc:101170246][more]
back to top
BLAST of plasminogen-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018453.11.645e-2297.89SMESG000018453.1[more]
SMESG000018456.12.430e-12964.80SMESG000018456.1[more]
SMESG000026301.13.099e-2134.71SMESG000026301.1[more]
SMESG000026300.11.589e-2030.51SMESG000026300.1[more]
SMESG000026300.11.754e-2030.51SMESG000026300.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019873
GenBankAFJ24868.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019873 ID=SMED30019873|Name=plasminogen-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1017bp
ATGGCACCAGTTTGTAAATCAACATCCAACTGTGTAAATGGGGTGACCAA
TTATCTATTTAAATCTCAAACATCAACTGAACAATTTCTTGAAAGTTGCG
TCCCGTGGATGAGCGTTCCGCTTCAATATAACAACCTAGCTTCAATGCCG
TCGCTTAGTATAAGTAGCAATGTAAATCCAATTTTCCATCCAGCAATACT
TCCCGATGAAAGCTTTGCTGACGCTAGTAATTACTGTAGAAATCTAGACA
ATGATACCGTCGGTGCATGGTGCTATGTTAGGAATGGGGATTTATATATA
AAAAAATATTGCAAAACTCAATGCTCAGGAATATGGGGTTGCTTGTACGA
CAGAATTGGTTCATATTACCAAGGAACAGTAAATATTACTGACACCAATC
AAGCATGTGCAAATTGGAATTTAAAAGGCTCACTTTATACAGATTCTAAT
TTTCCTGAAAATTCGATTGCTAATGCATCAAACTATTGCAGAAATCCCAC
AAACAACCGTGGAGGACCTTGGTGTTGGCTACAGAGTAATATTACAAGAT
TCGGCTTTTGTAGAATACCATTCTGTCAACAATCTTCACCATTGGCACCA
TTAACAAAAACTTCTGGAAATGCTACCTGTAAATCGACTGCCATTGGTGG
AGAATATGCCGGCAACATATCTATTACCACCAATAATAATACTTGCGCAT
TATGGAACACGACCTCGTTTTATAATCCTTACTACAACCAACCAGTTTTA
TTCAACACTTCGACAATGGCCGAAGTTTTTAATTATTGTAGAAATCCAAG
TAATGACACAATGGGCCCATGGTGCTACACCATGTCGGGTGTCCAGGAAT
ATTGTTCAGTACCACAATGCAATATTTCTCAAACGACGGGATCTTTAAAA
AAAAACACAGTCATTCAAATCGAAAGCAAAATATTGGTTCTTACTTGTTG
CGCTATTCTTGCGTTCATATCCGTAACTGGTGGACATTTTCATTAAATTC
CGTTTTCTTGTTGTGAG
back to top

protein sequence of SMED30019873-orf-1

>SMED30019873-orf-1 ID=SMED30019873-orf-1|Name=SMED30019873-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=332bp
MAPVCKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMP
SLSISSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYI
KKYCKTQCSGIWGCLYDRIGSYYQGTVNITDTNQACANWNLKGSLYTDSN
FPENSIANASNYCRNPTNNRGGPWCWLQSNITRFGFCRIPFCQQSSPLAP
LTKTSGNATCKSTAIGGEYAGNISITTNNNTCALWNTTSFYNPYYNQPVL
FNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCSVPQCNISQTTGSLK
KNTVIQIESKILVLTCCAILAFISVTGGHFH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038178Kringle_sf
IPR000001Kringle
IPR018056Kringle_CS
IPR013806Kringle-like
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00018KRINGLEcoord: 279..290
score: 36.01
coord: 256..276
score: 35.58
coord: 131..143
score: 25.54
coord: 115..130
score: 35.61
NoneNo IPR availablePANTHERPTHR24261:SF13PLASMINOGENcoord: 58..316
NoneNo IPR availablePANTHERPTHR24261FAMILY NOT NAMEDcoord: 58..316
NoneNo IPR availableTMHMMTMhelixcoord: 311..330
IPR000001KringleSMARTSM00130KR_2coord: 208..292
e-value: 5.5E-7
score: 26.8
coord: 116..194
e-value: 2.4E-8
score: 39.1
IPR000001KringlePFAMPF00051Kringlecoord: 215..290
e-value: 4.4E-13
score: 49.3
coord: 118..192
e-value: 3.2E-13
score: 49.8
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 120..192
score: 14.754
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 20..114
score: 10.039
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 216..290
score: 14.888
IPR038178Kringle superfamilyGENE3DG3DSA:2.40.20.10coord: 199..300
e-value: 6.9E-19
score: 70.3
coord: 112..198
e-value: 6.3E-19
score: 70.4
IPR038178Kringle superfamilyGENE3DG3DSA:2.40.20.10coord: 6..111
e-value: 7.5E-8
score: 34.2
IPR018056Kringle, conserved sitePROSITEPS00021KRINGLE_1coord: 262..275
IPR018056Kringle, conserved sitePROSITEPS00021KRINGLE_1coord: 78..91
IPR018056Kringle, conserved sitePROSITEPS00021KRINGLE_1coord: 162..175
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 72..107
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 215..303
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 115..198