MTSS I-BAR domain containing 2

Overview
NameMTSS I-BAR domain containing 2
Smed IDSMED30019871
Length (bp)2856
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MTSS I-BAR domain containing 2 (SMED30019871) t-SNE clustered cells

Violin plots show distribution of expression levels for MTSS I-BAR domain containing 2 (SMED30019871) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MTSS I-BAR domain containing 2 (SMED30019871) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MTSS I-BAR domain containing 2 (SMED30019871) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019871

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30019871h1SMcG0002683 dd_Smed_v4_3525_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30019871h1SMcG0018310 dd_Smed_v4_6612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019871h1SMcG0018310 dd_Smed_v4_6612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019871h1SMcG0018310 dd_Smed_v4_6612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019871h1SMcG0018310 Contig38296uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019871h1SMcG0018310 Contig38296newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019871h1SMcG0018311 Contig38296uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019871h1SMcG0018311 Contig38296newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30019871h1SMcG0018310 dd_Smed_v6_6612_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30019871h1SMcG0018310 dd_Smed_v4_6612_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Human
Match: MTSS2 (MTSS I-BAR domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25094])

HSP 1 Score: 217.238 bits (552), Expect = 8.661e-59
Identity = 106/251 (42.23%), Postives = 170/251 (67.73%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K+S PIWEDF SK+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +NQLDKD  KE K+A+   KK S ++++LQKKA  R  + G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  ++++L +I+ L  ++  L + T  P +LP  SE++I+ +
Sbjct:    1 METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKA--RKELLGKGDLQPQLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEPHKLPPASEQVIKDL 249          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Human
Match: MTSS2 (MTSS I-BAR domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25094])

HSP 1 Score: 215.312 bits (547), Expect = 3.914e-58
Identity = 104/251 (41.43%), Postives = 169/251 (67.33%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K+S PIWEDF SK+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +NQLDKD  KE K+A+   KK S ++++LQK   +R  + G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  ++++L +I+ L  ++  L + T  P +LP  SE++I+ +
Sbjct:    1 METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQK---RRAKVPGKGDLQPQLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEPHKLPPASEQVIKDL 248          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Human
Match: MTSS1 (MTSS I-BAR domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20443])

HSP 1 Score: 212.231 bits (539), Expect = 4.481e-57
Identity = 121/282 (42.91%), Postives = 187/282 (66.31%), Query Frame = 3
Query:   72 DVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSV-ASLN 914
            + S L  +F  I+ D K S P+WEDF++K+ KL + L+  ++ + AF +AFQK+AD+AT+T+G T+EIG++ TR+CMR R +E K++  S+ LI  L NP+Q+++E+WK+ +NQLDKD  KE KKA+   KK S ++++LQKKA K  ++ G G +Q Q++ AL++  +KY  L+  E   +R+A+I ER RFC   S ++PV+E +IS+L +I+ L  + + L   T+ P +LP  SE++   ILD  L GS  S    +  +  S+   SRKSSV +SLN
Sbjct:    8 ECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKVDTL-GRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQV---ILD--LKGSDYSWSYQTPPSSPSTTM-SRKSSVCSSLN 282          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Human
Match: MTSS1 (MTSS I-BAR domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20443])

HSP 1 Score: 211.46 bits (537), Expect = 6.079e-57
Identity = 121/282 (42.91%), Postives = 185/282 (65.60%), Query Frame = 3
Query:   72 DVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSV-ASLN 914
            + S L  +F  I+ D K S P+WEDF++K+ KL + L+  ++ + AF +AFQK+AD+AT+T+G T+EIG++ TR+CMR R +E K++  S+ LI  L NP+Q+++E+WK+ +NQLDKD  KE KKA+   KK S ++++LQKKA K     G G +Q Q++ AL++  +KY  L+  E   +R+A+I ER RFC   S ++PV+E +IS+L +I+ L  + + L   T+ P +LP  SE++   ILD  L GS  S    +  +  S+   SRKSSV +SLN
Sbjct:    8 ECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKK-----GRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQV---ILD--LKGSDYSWSYQTPPSSPSTTM-SRKSSVCSSLN 278          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Human
Match: MTSS1 (MTSS I-BAR domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20443])

HSP 1 Score: 211.46 bits (537), Expect = 7.295e-57
Identity = 121/282 (42.91%), Postives = 185/282 (65.60%), Query Frame = 3
Query:   72 DVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSV-ASLN 914
            + S L  +F  I+ D K S P+WEDF++K+ KL + L+  ++ + AF +AFQK+AD+AT+T+G T+EIG++ TR+CMR R +E K++  S+ LI  L NP+Q+++E+WK+ +NQLDKD  KE KKA+   KK S ++++LQKKA K     G G +Q Q++ AL++  +KY  L+  E   +R+A+I ER RFC   S ++PV+E +IS+L +I+ L  + + L   T+ P +LP  SE++   ILD  L GS  S    +  +  S+   SRKSSV +SLN
Sbjct:    8 ECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKK-----GRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQV---ILD--LKGSDYSWSYQTPPSSPSTTM-SRKSSVCSSLN 278          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Celegans
Match: M04F3.5 (pep chromosome:WBcel235:I:4773818:4788358:-1 gene:WBGene00019771.1 transcript:M04F3.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M04F3.5)

HSP 1 Score: 82.4185 bits (202), Expect = 7.712e-16
Identity = 56/253 (22.13%), Postives = 115/253 (45.45%), Query Frame = 3
Query:   51 LMDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQIL 809
            LMD  + + + LT ++  ++ D K++ P W+    K+ KL   L+    C + F EA Q + D A + +GA++++GA  TR+C++QR +E ++++ ++ L   L+  +Q +   WK   + +DK                   + +  KK   R     + ++  Q E   K                    +  +R +F F    + PVL +Q+++L + + L +++  L           V++E+++  I+
Sbjct:    3 LMDPDA-EFNLLTTLYQSVVHDMKHTYPGWDALSQKAQKLGTQLRATAQCLSTFTEAMQGVCDNANNLKGASRDVGACVTRVCIKQRAIENRMRSWADALCEELAISLQQRGNYWKSRCHDMDK------------------TAAKHVKKVRSRKQRPDVTAMNEQREICTK-------------------VLTEQRTQFSFFIGTLMPVLNAQMNMLDEGAHLRQVVDNLDSTVKH-----VDTEQLVSSIV 212          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Celegans
Match: M04F3.5 (pep chromosome:WBcel235:I:4773818:4777717:-1 gene:WBGene00019771.1 transcript:M04F3.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M04F3.5)

HSP 1 Score: 82.0333 bits (201), Expect = 8.962e-16
Identity = 53/242 (21.90%), Postives = 109/242 (45.04%), Query Frame = 3
Query:   84 LTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQIL 809
            LT ++  ++ D K++ P W+    K+ KL   L+    C + F EA Q + D A + +GA++++GA  TR+C++QR +E ++++ ++ L   L+  +Q +   WK   + +DK                   + +  KK   R     + ++  Q E   K                    +  +R +F F    + PVL +Q+++L + + L +++  L           V++E+++  I+
Sbjct:   10 LTTLYQSVVHDMKHTYPGWDALSQKAQKLGTQLRATAQCLSTFTEAMQGVCDNANNLKGASRDVGACVTRVCIKQRAIENRMRSWADALCEELAISLQQRGNYWKSRCHDMDK------------------TAAKHVKKVRSRKQRPDVTAMNEQREICTK-------------------VLTEQRTQFSFFIGTLMPVLNAQMNMLDEGAHLRQVVDNLDSTVKH-----VDTEQLVSSIV 209          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0332941)

HSP 1 Score: 189.119 bits (479), Expect = 2.209e-49
Identity = 108/282 (38.30%), Postives = 171/282 (60.64%), Query Frame = 3
Query:   72 DVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI-----LDPELVGSTKSNCNVSGNTVFSSGFGSRKSSV 902
            D S L  +F +I+ D KN+SP+WEDF++K+ KLH  L+  +    A+ +AFQKIAD AT+++GA+KEIG + TR+C+R + +E ++KT ++ ++  L  P+Q+++EDWKR    +DKD  KE K+ ++  KK S +++RLQKKA ++G   GL SL   ++  +++   +   L+ VE   LR AM+ ER R+C     ++PV+  +  +++++  L E M+++ L T  P  LP  SEE+I        L PE  G        S     S+  GSRKSSV
Sbjct:    8 DSSALGSLFQQIINDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQKIADAATNSRGASKEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKA-RKGQTDGLQSL---MDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSIALVTKEPSVLPQASEELIHDAKASINLYPESPGGGSG----SQGGGCSNSLGSRKSSV 281          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0302035)

HSP 1 Score: 189.889 bits (481), Expect = 2.862e-49
Identity = 95/243 (39.09%), Postives = 157/243 (64.61%), Query Frame = 3
Query:   72 DVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQ 800
            D S L  +F +I+ D KN+SP+WEDF++K+ KLH  L+  +    A+ +AFQKIAD AT+++GA+KEIG + TR+C+R + +E ++KT ++ ++  L  P+Q+++EDWKR    +DKD  KE K+ ++  KK S +++RLQKKA ++G   GL SL   ++  +++   +   L+ VE   LR AM+ ER R+C     ++PV+  +  +++++  L E M+++ L T  P  LP  SEE+I 
Sbjct:    8 DSSALGSLFQQIINDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQKIADAATNSRGASKEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKA-RKGQTDGLQSL---MDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSIALVTKEPSVLPQASEELIH 246          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0302577)

HSP 1 Score: 189.889 bits (481), Expect = 3.289e-49
Identity = 95/243 (39.09%), Postives = 157/243 (64.61%), Query Frame = 3
Query:   72 DVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQ 800
            D S L  +F +I+ D KN+SP+WEDF++K+ KLH  L+  +    A+ +AFQKIAD AT+++GA+KEIG + TR+C+R + +E ++KT ++ ++  L  P+Q+++EDWKR    +DKD  KE K+ ++  KK S +++RLQKKA ++G   GL SL   ++  +++   +   L+ VE   LR AM+ ER R+C     ++PV+  +  +++++  L E M+++ L T  P  LP  SEE+I 
Sbjct:    8 DSSALGSLFQQIINDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQKIADAATNSRGASKEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKA-RKGQTDGLQSL---MDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSIALVTKEPSVLPQASEELIH 246          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0306614)

HSP 1 Score: 189.889 bits (481), Expect = 4.377e-49
Identity = 95/243 (39.09%), Postives = 157/243 (64.61%), Query Frame = 3
Query:   72 DVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQ 800
            D S L  +F +I+ D KN+SP+WEDF++K+ KLH  L+  +    A+ +AFQKIAD AT+++GA+KEIG + TR+C+R + +E ++KT ++ ++  L  P+Q+++EDWKR    +DKD  KE K+ ++  KK S +++RLQKKA ++G   GL SL   ++  +++   +   L+ VE   LR AM+ ER R+C     ++PV+  +  +++++  L E M+++ L T  P  LP  SEE+I 
Sbjct:    8 DSSALGSLFQQIINDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQKIADAATNSRGASKEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKA-RKGQTDGLQSL---MDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSIALVTKEPSVLPQASEELIH 246          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0302578)

HSP 1 Score: 190.274 bits (482), Expect = 6.320e-49
Identity = 95/243 (39.09%), Postives = 157/243 (64.61%), Query Frame = 3
Query:   72 DVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQ 800
            D S L  +F +I+ D KN+SP+WEDF++K+ KLH  L+  +    A+ +AFQKIAD AT+++GA+KEIG + TR+C+R + +E ++KT ++ ++  L  P+Q+++EDWKR    +DKD  KE K+ ++  KK S +++RLQKKA ++G   GL SL   ++  +++   +   L+ VE   LR AM+ ER R+C     ++PV+  +  +++++  L E M+++ L T  P  LP  SEE+I 
Sbjct:    8 DSSALGSLFQQIINDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQKIADAATNSRGASKEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKA-RKGQTDGLQSL---MDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSIALVTKEPSVLPQASEELIH 246          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Zebrafish
Match: mtss1lb (MTSS I-BAR domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-140718-4])

HSP 1 Score: 210.69 bits (535), Expect = 5.060e-57
Identity = 101/238 (42.44%), Postives = 164/238 (68.91%), Query Frame = 3
Query:   93 MFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            +F  I+ D K S P+WEDF +K+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL  P+QD++EDWK+ +NQLDKD  KE K+++   KK S ++++LQKKA K     G G LQ Q++ A+++  + Y  ++  E   +RRA++ ER RFC   S ++PV+  +I++L +I+ L  ++  LT+ T  P +LP  SE++I+ +
Sbjct:   19 LFQAIVNDMKCSYPVWEDFNAKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIEAKLRHFTNALMESLITPLQDRIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARK-----GRGDLQPQLDSAMQDVNDMYLLMEETEKQAVRRALVEERGRFCTFISFLQPVVNGEIAMLGEITHLQAIIDDLTVLTSDPHKLPPASEQVIKDL 251          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Zebrafish
Match: mtss1la (MTSS I-BAR domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-030219-89])

HSP 1 Score: 207.994 bits (528), Expect = 7.936e-56
Identity = 115/302 (38.08%), Postives = 187/302 (61.92%), Query Frame = 3
Query:    6 FFLNWLI*SVFSLSLLMDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASL 911
             F++W   +   L  +M+    +   L  +F  I+ D K S P+WEDF++K+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+  +  P+QDK+E+WK+ +  LDKD  KE K+++   KK S ++++LQKKA K     G G LQ Q+  A+++  + Y  ++  E   +RRA++ ER R+C   S ++PV+  +I++L + + L  +++ LT+ T  P +LP  SE++   ILD  L GS   N +        S  GSRKSS+ SL
Sbjct:   33 LFIHWEQNNNPGLGDMMESVEKECGALGGLFQAIVNDMKYSYPVWEDFITKATKLHSQLRTTVLATAAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIEAKLRHFTNALMEKMIGPLQDKIEEWKKTAALLDKDHAKEYKRSRQEIKKKSSDTIKLQKKARK-----GRGGLQPQLNSAMQDVNDMYLLMEETEKQAVRRALLEERGRYCTFISFLQPVVVGEIAMLGEATHLQAIIEDLTVLTTDPHKLPEASEQV---ILD--LKGS-DYNWSYQTPPSSPSSIGSRKSSLCSL 323          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Zebrafish
Match: mtss1la (MTSS I-BAR domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-030219-89])

HSP 1 Score: 206.068 bits (523), Expect = 3.656e-55
Identity = 112/286 (39.16%), Postives = 181/286 (63.29%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASL 911
            M+    +   L  +F  I+ D K S P+WEDF++K+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+  +  P+QDK+E+WK+ +  LDKD  KE K+++   KK S ++++LQKKA  R  + G G LQ Q+  A+++  + Y  ++  E   +RRA++ ER R+C   S ++PV+  +I++L + + L  +++ LT+ T  P +LP  SE++   ILD  L GS   N +        S  GSRKSS+ SL
Sbjct:    1 MESVEKECGALGGLFQAIVNDMKYSYPVWEDFITKATKLHSQLRTTVLATAAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIEAKLRHFTNALMEKMIGPLQDKIEEWKKTAALLDKDHAKEYKRSRQEIKKKSSDTIKLQKKA--RKELPGRGGLQPQLNSAMQDVNDMYLLMEETEKQAVRRALLEERGRYCTFISFLQPVVVGEIAMLGEATHLQAIIEDLTVLTTDPHKLPEASEQV---ILD--LKGS-DYNWSYQTPPSSPSSIGSRKSSLCSL 278          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Zebrafish
Match: mtss1 (MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081105-141])

HSP 1 Score: 178.718 bits (452), Expect = 2.943e-46
Identity = 109/286 (38.11%), Postives = 178/286 (62.24%), Query Frame = 3
Query:   54 MDVG-SNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVAS 908
            MD G   + S L  +F  I+ D K S P WEDF++K  KL + L+  ++ +++F +AFQK+AD+AT T+GATKEIG++ TR+CMR R +E K+K  +  L+ +L  P++ K+E+WK+ ++QLDKD  KE KKA++  KK S ++++LQKK  K         ++ Q++ AL++   +Y  L+  E   + RA+I ER RFC   + +KPVL+ +IS+L +++ L  +++ L   T  P+ LP  SE++I  +   + + S ++      NT+      SRKSS++S
Sbjct:    1 MDAGMEKECSALGGLFQIIMNDMKASYPAWEDFVTKGAKLQSQLRTTIIVTSSFLDAFQKVADIATGTRGATKEIGSALTRMCMRHRSIENKLKLFTTALMDNLITPLELKIEEWKKVASQLDKDHAKEYKKARSEIKKKSSDTIKLQKKVKKGKD-----EVRMQLDSALQDVNTRYAVLEETEKRAVCRALIEERGRFCSFVTMLKPVLDEEISMLGEVTHLQTILEDLGNLTADPNTLPPASEQVILDLKGSDYIYSYQTPPASPSNTL------SRKSSISS 275          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Xenopus
Match: acss2.2 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:Xenbase;Acc:XB-GENE-5916994])

HSP 1 Score: 211.075 bits (536), Expect = 3.244e-57
Identity = 104/251 (41.43%), Postives = 168/251 (66.93%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D KNS PIWEDF SK+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +N LDK+  +E K+A+   KK S ++++LQKKA  R  + G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  +I +L +++ L  +++ L + T  P +LP  SE++I  +
Sbjct:    1 MESVDKECGALGGLFQAIINDMKNSYPIWEDFSSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANTLDKEHAREYKRARHEIKKKSSDTLKLQKKA--RKEVLGKGDLQPQLDHALQDVNDMYLLLEETEKQAVRRALIEERGRFCSFITLLQPVVNGEIHMLAEVTHLQAIIEDLVVLTDEPHKLPAASEQVITDL 249          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Xenopus
Match: acss2.2 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:Xenbase;Acc:XB-GENE-5916994])

HSP 1 Score: 211.46 bits (537), Expect = 6.506e-57
Identity = 104/251 (41.43%), Postives = 168/251 (66.93%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D KNS PIWEDF SK+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +N LDK+  +E K+A+   KK S ++++LQKKA  R  + G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  +I +L +++ L  +++ L + T  P +LP  SE++I  +
Sbjct:    1 MESVDKECGALGGLFQAIINDMKNSYPIWEDFSSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANTLDKEHAREYKRARHEIKKKSSDTLKLQKKA--RKEVLGKGDLQPQLDHALQDVNDMYLLLEETEKQAVRRALIEERGRFCSFITLLQPVVNGEIHMLAEVTHLQAIIEDLVVLTDEPHKLPAASEQVITDL 249          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Xenopus
Match: acss2.2 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:Xenbase;Acc:XB-GENE-5916994])

HSP 1 Score: 211.075 bits (536), Expect = 8.312e-57
Identity = 104/251 (41.43%), Postives = 167/251 (66.53%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D KNS PIWEDF SK+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +N LDK+  +E K+A+   KK S ++++LQKKA K     G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  +I +L +++ L  +++ L + T  P +LP  SE++I  +
Sbjct:    1 MESVDKECGALGGLFQAIINDMKNSYPIWEDFSSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANTLDKEHAREYKRARHEIKKKSSDTLKLQKKARK-----GKGDLQPQLDHALQDVNDMYLLLEETEKQAVRRALIEERGRFCSFITLLQPVVNGEIHMLAEVTHLQAIIEDLVVLTDEPHKLPAASEQVITDL 246          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Xenopus
Match: acss2.2 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:Xenbase;Acc:XB-GENE-5916994])

HSP 1 Score: 174.096 bits (440), Expect = 2.717e-44
Identity = 97/262 (37.02%), Postives = 160/262 (61.07%), Query Frame = 3
Query:   36 FSLSLLMDVGSNDVSTLTLMFNKILLDFKNSSPIW-----EDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            FS +LL+         L L F   L     S P++       F S S    ++ +  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +N LDK+  +E K+A+   KK S ++++LQKKA K     G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  +I +L +++ L  +++ L + T  P +LP  SE++I  +
Sbjct:   15 FSHTLLLSC------KLALAFFYQLYFSSQSFPLFTFHLSSSFFSASMLFTSSFRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANTLDKEHAREYKRARHEIKKKSSDTLKLQKKARK-----GKGDLQPQLDHALQDVNDMYLLLEETEKQAVRRALIEERGRFCSFITLLQPVVNGEIHMLAEVTHLQAIIEDLVVLTDEPHKLPAASEQVITDL 265          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Xenopus
Match: ENSXETT00000003339.1 (metastasis suppressor 1, gene 2 [Source:NCBI gene;Acc:100492573])

HSP 1 Score: 157.532 bits (397), Expect = 1.872e-39
Identity = 96/245 (39.18%), Postives = 147/245 (60.00%), Query Frame = 3
Query:   72 DVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            + S L  +F  I+ D K S P WEDF+SK+ KL + LK +++ + +F +AFQKIAD+A +T+GATKEIG++ TR+CMR R +E ++K L+  L  SL NP++ K+E+WK+ +NQLDKD  KE KKA+   KK S ++++LQKK  K          + Q++  L++  +KY  L+  E   + RA++ ER RFC   S +KP++         +         L L    P +LP  SE++I  +
Sbjct:    8 ECSALGGLFQTIINDMKASYPTWEDFVSKATKLQSHLKTMIIVTGSFLDAFQKIADMAINTRGATKEIGSALTRMCMRHRNIESRLKHLTVALSDSLINPLEGKIEEWKKVANQLDKDHAKEYKKARADIKKKSSDTIKLQKKVKKGKD-----DARVQLDSVLQDVNDKYLLLEETEKKAVYRALVEERGRFCMFVSFLKPLI---------VCPEHSFSVYLYLYIWEPSKLPPMSEQVIHDL 238          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Mouse
Match: Mtss2 (MTSS I-BAR domain containing 2 [Source:MGI Symbol;Acc:MGI:3039591])

HSP 1 Score: 214.927 bits (546), Expect = 2.415e-58
Identity = 106/251 (42.23%), Postives = 169/251 (67.33%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K+S PIWEDF SK+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +NQLDKD  KE K+A+   KK S ++++LQKKA K     G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  ++++L +I+ L  ++  L + T  P +LP  SE++I+ +
Sbjct:    1 METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKAAKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK-----GKGDLQPQLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTADPHKLPPASEQVIKDL 246          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Mouse
Match: Mtss1 (MTSS I-BAR domain containing 1 [Source:MGI Symbol;Acc:MGI:2384818])

HSP 1 Score: 212.616 bits (540), Expect = 2.406e-57
Identity = 122/286 (42.66%), Postives = 188/286 (65.73%), Query Frame = 3
Query:   60 VGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSV-ASLN 914
            V   + S L  +F  I+ D K S P+WEDF++K+ KL + L+  ++ + AF +AFQK+AD+AT+T+G T+EIG++ TR+CMR R +E K++  S+ LI  L NP+Q+++E+WK+ +NQLDKD  KE KKA+   KK S ++++LQKKA K+   +G G +Q Q++ AL++  +KY  L+  E   +R+A+I ER RFC   S ++PV+E +IS+L +I+ L  + + L   T+ P +LP  SE++   ILD  L GS  S    +  +  S+   SRKSSV +SLN
Sbjct:    4 VIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKA-KKVDAQGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQV---ILD--LKGSDYSWSYQTPPSSPSTTM-SRKSSVCSSLN 282          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Mouse
Match: Mtss2 (MTSS I-BAR domain containing 2 [Source:MGI Symbol;Acc:MGI:3039591])

HSP 1 Score: 152.91 bits (385), Expect = 4.871e-38
Identity = 78/189 (41.27%), Postives = 129/189 (68.25%), Query Frame = 3
Query:  240 LATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            +AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +NQLDKD  KE K+A+   KK S ++++LQKKA K     G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  ++++L +I+ L  ++  L + T  P +LP  SE++I+ +
Sbjct:    1 MATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK-----GKGDLQPQLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTADPHKLPPASEQVIKDL 184          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Mouse
Match: Mtss2 (MTSS I-BAR domain containing 2 [Source:MGI Symbol;Acc:MGI:3039591])

HSP 1 Score: 96.6709 bits (239), Expect = 2.150e-21
Identity = 55/140 (39.29%), Postives = 89/140 (63.57%), Query Frame = 3
Query:  387 EDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            EDWK+ +NQLDKD  KE K+A+   KK S ++++LQKKA K     G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  ++++L +I+ L  ++  L + T  P +LP  SE++I+ +
Sbjct:    2 EDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK-----GKGDLQPQLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTADPHKLPPASEQVIKDL 136          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Mouse
Match: Mtss2 (MTSS I-BAR domain containing 2 [Source:MGI Symbol;Acc:MGI:3039591])

HSP 1 Score: 86.6557 bits (213), Expect = 1.645e-17
Identity = 51/134 (38.06%), Postives = 84/134 (62.69%), Query Frame = 3
Query:  405 SNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            +NQLDKD  KE K+A+   KK S ++++LQKKA K     G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  ++++L +I+ L  ++  L + T  P +LP  SE++I+ +
Sbjct:    4 ANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK-----GKGDLQPQLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTADPHKLPPASEQVIKDL 132          
BLAST of MTSS I-BAR domain containing 2 vs. UniProt/SwissProt
Match: sp|Q765P7|MTSS2_HUMAN (Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 4.159e-58
Identity = 106/251 (42.23%), Postives = 170/251 (67.73%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K+S PIWEDF SK+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +NQLDKD  KE K+A+   KK S ++++LQKKA  R  + G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  ++++L +I+ L  ++  L + T  P +LP  SE++I+ +
Sbjct:    1 METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKA--RKELLGKGDLQPQLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEPHKLPPASEQVIKDL 249          
BLAST of MTSS I-BAR domain containing 2 vs. UniProt/SwissProt
Match: sp|Q6P9S0|MTSS2_MOUSE (Protein MTSS 2 OS=Mus musculus OX=10090 GN=Mtss2 PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.689e-57
Identity = 106/251 (42.23%), Postives = 169/251 (67.33%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K+S PIWEDF SK+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +NQLDKD  KE K+A+   KK S ++++LQKKA K     G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  ++++L +I+ L  ++  L + T  P +LP  SE++I+ +
Sbjct:    1 METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKAAKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK-----GKGDLQPQLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTADPHKLPPASEQVIKDL 246          
BLAST of MTSS I-BAR domain containing 2 vs. UniProt/SwissProt
Match: sp|Q8R1S4|MTSS1_MOUSE (Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.014e-56
Identity = 118/279 (42.29%), Postives = 183/279 (65.59%), Query Frame = 3
Query:   72 DVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVAS 908
            + S L  +F  I+ D K S P+WEDF++K+ KL + L+  ++ + AF +AFQK+AD+AT+T+G T+EIG++ TR+CMR R +E K++  S+ LI  L NP+Q+++E+WK+ +NQLDKD  KE KKA+   K  S ++++LQKKA K+   +G G +Q Q++ AL++  +KY  L+  E   +R+A+I ER RFC   S ++PV+E +IS+L +I+ L  + + L   T+ P +LP  SE++   ILD  L GS  S    +  +  S+   SRKSSV S
Sbjct:    8 ECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKNKSSDTLKLQKKA-KKVDAQGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQV---ILD--LKGSDYSWSYQTPPSSPSTTM-SRKSSVCS 279          
BLAST of MTSS I-BAR domain containing 2 vs. UniProt/SwissProt
Match: sp|O43312|MTSS1_HUMAN (Protein MTSS 1 OS=Homo sapiens OX=9606 GN=MTSS1 PE=1 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 3.503e-56
Identity = 121/282 (42.91%), Postives = 185/282 (65.60%), Query Frame = 3
Query:   72 DVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSV-ASLN 914
            + S L  +F  I+ D K S P+WEDF++K+ KL + L+  ++ + AF +AFQK+AD+AT+T+G T+EIG++ TR+CMR R +E K++  S+ LI  L NP+Q+++E+WK+ +NQLDKD  KE KKA+   KK S ++++LQKKA K     G G +Q Q++ AL++  +KY  L+  E   +R+A+I ER RFC   S ++PV+E +IS+L +I+ L  + + L   T+ P +LP  SE++   ILD  L GS  S    +  +  S+   SRKSSV +SLN
Sbjct:    8 ECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKK-----GRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQV---ILD--LKGSDYSWSYQTPPSSPSTTM-SRKSSVCSSLN 278          
BLAST of MTSS I-BAR domain containing 2 vs. TrEMBL
Match: A0A4D9EP79 (E3 ubiquitin-protein ligase SMURF1 OS=Platysternon megacephalum OX=55544 GN=DR999_PMT05898 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 4.807e-58
Identity = 107/251 (42.63%), Postives = 170/251 (67.73%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K+S PIWEDF SK+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+QD++EDWK+ +NQLDKD  KE K+A+   KK S ++++LQKKA K     G G LQ Q++ AL++  + Y  ++  E   +R+A+I ER RFC   + ++PV+  +I++L +I+ L  +M+ L + T  P +LP  SE++I+ +
Sbjct:    1 METVDKECGALGGLFQAIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIEAKLRQFTNALMESLVNPLQDRIEDWKKTANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK-----GKGDLQPQLDSALQDVNDMYLLMEETEKQAVRKALIEERGRFCTFITFLQPVVTGEITMLGEITHLQGIMEDLVVLTAEPHKLPPASEQVIKDL 246          
BLAST of MTSS I-BAR domain containing 2 vs. TrEMBL
Match: A0A1A8HGI4 (Metastasis suppressor 1-like (Fragment) OS=Nothobranchius korthausae OX=1143690 GN=MTSS1L PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 5.632e-58
Identity = 105/251 (41.83%), Postives = 170/251 (67.73%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K S P+WEDF +K+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL  P+QDK+EDWK+ +NQLDKD  KE K+++   KK S ++++LQKKA  R  M+G G LQ Q++ A+++  +    ++ +E   +RRA++ ER RFC   S ++PV+  +I++L +I+ L  ++  LTL T  P +LP  SE++I+ +
Sbjct:    7 METVEKECGALGGLFQAIVNDMKCSYPVWEDFSAKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIEAKLRQFTNALMESLITPLQDKIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKA--RKEMQGRGDLQPQLDSAMQDVTDMCLLMEEMEKQAVRRALVEERGRFCTFISFLQPVVNGEIAMLGEITHLQAIIDDLTLLTTDPHKLPPASEQVIKDL 255          
BLAST of MTSS I-BAR domain containing 2 vs. TrEMBL
Match: A0A0B7A6N4 (IMD domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF96433 PE=4 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 9.693e-58
Identity = 111/255 (43.53%), Postives = 167/255 (65.49%), Query Frame = 3
Query:   54 MDVGS----NDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            MD GS     D   L  +F  I+ D + SSPIWEDF  KS KLH +LK  ++   AF EAFQK+AD+AT ++GAT+EIG++ TRLCMR R +E  +K L++ ++ +L  P+QDKLEDWK+   Q+DKD  +E KKAK   KKA+ +++RLQKK V++GS  G   +Q +++ A+ +   KY  L+  E   +R A+I ER RFC   +C+KP ++ ++ LLT+++ ++E+M+ L +    P  LP  SE++I  +
Sbjct:   11 MDAGSYNPEKDSVILGGLFQSIINDLRGSSPIWEDFTYKSVKLHTSLKTTVVAVGAFLEAFQKVADMATSSKGATREIGSALTRLCMRHRSIESHLKALTSSILDNLVAPLQDKLEDWKKSVAQIDKDHSRENKKAKQDIKKAASDTIRLQKK-VRKGSTHGKSDMQQKLDSAMLDVNSKYHQLEETEKNSVRSALIEERSRFCLFITCLKPFVDQELKLLTEMTHINEIMENLCMQASDPAILPASSEQVIMDL 264          
BLAST of MTSS I-BAR domain containing 2 vs. TrEMBL
Match: A0A480KNL6 (MTSS1-like protein isoform X2 OS=Sus scrofa OX=9823 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.867e-57
Identity = 106/251 (42.23%), Postives = 169/251 (67.33%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K+S PIWEDF SK+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +NQLDKD  KE K+A+   KK S ++++LQKKA K     G G LQ Q++ AL++  + Y  L+  E   +RRA+I ER RFC   + ++PV+  ++++L +I+ L  ++  L + T  P +LP  SE++I+ +
Sbjct:    1 METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK-----GKGDLQPQLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEPHKLPPASEQVIKDL 246          
BLAST of MTSS I-BAR domain containing 2 vs. TrEMBL
Match: H0Z6N9 (MTSS I-BAR domain containing 2 OS=Taeniopygia guttata OX=59729 GN=MTSS2 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 3.620e-57
Identity = 106/251 (42.23%), Postives = 171/251 (68.13%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K+S PIWEDF SK+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+QD++EDWK+ +NQLDKD  KE K+A+   KK S ++++LQKKA K   + G G LQ Q++ AL++  + Y  L+  E   +R+A+I ER RFC   + ++PV+  ++++L +I+ L  +++ L + T  P +LP  SE++I+ +
Sbjct:    1 METAEKECGALGGLFQAIINDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIEAKLRQFTNALMESLINPLQDRIEDWKKTANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARKVPHLAGKGDLQPQLDNALQDVNDMYLLLEETEKQAVRKALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIEDLVVLTAEPHKLPPASEQVIKDL 251          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Cavefish
Match: mtss1lb (MTSS I-BAR domain containing 2 [Source:NCBI gene;Acc:103026560])

HSP 1 Score: 212.231 bits (539), Expect = 1.685e-57
Identity = 103/251 (41.04%), Postives = 168/251 (66.93%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K S P+WEDF +K+ KLH  L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +NQLDKD  KE K+++   KK S ++++LQKKA K     G G LQ Q++ A+++  + Y  ++  E   +RRA++ ER RFC   S ++PV+  +I++L +I+ L  ++  LT+ T  P +LP  SE++I+ +
Sbjct:    1 MESVEKECGALGGLFQAIVNDMKCSYPVWEDFSAKATKLHAQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARK-----GRGDLQPQLDSAMQDVNDMYLLMEETEKQAVRRALVEERGRFCTFISFLQPVVNGEIAMLGEITHLQAIIDDLTVLTTDPHKLPPASEQVIKDL 246          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Cavefish
Match: mtss1lb (MTSS I-BAR domain containing 2 [Source:NCBI gene;Acc:103026560])

HSP 1 Score: 212.231 bits (539), Expect = 5.117e-57
Identity = 103/251 (41.04%), Postives = 168/251 (66.93%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K S P+WEDF +K+ KLH  L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL NP+Q+++EDWK+ +NQLDKD  KE K+++   KK S ++++LQKKA K     G G LQ Q++ A+++  + Y  ++  E   +RRA++ ER RFC   S ++PV+  +I++L +I+ L  ++  LT+ T  P +LP  SE++I+ +
Sbjct:    1 MESVEKECGALGGLFQAIVNDMKCSYPVWEDFSAKATKLHAQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARK-----GRGDLQPQLDSAMQDVNDMYLLMEETEKQAVRRALVEERGRFCTFISFLQPVVNGEIAMLGEITHLQAIIDDLTVLTTDPHKLPPASEQVIKDL 246          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Cavefish
Match: mtss1la (MTSS1-like protein [Source:NCBI gene;Acc:103039604])

HSP 1 Score: 207.994 bits (528), Expect = 3.254e-56
Identity = 108/286 (37.76%), Postives = 182/286 (63.64%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASL 911
            M+    +   L  +F  ++ D KNS P+WEDF +K+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+  L  P+QDK+E+WK+ +  LDKD  KE K+++   KK S ++++LQKKA K     G G LQ Q++ A+++ ++ Y  ++  E   +RRA++ ER R+C   S ++PV+  +I++L +++ L  ++  LT+ T  P +LP  SE++I  +   +   S ++  +   +T      GSRKSS+ SL
Sbjct:    1 MESVEKECGALGGLFQAVVNDMKNSYPVWEDFSAKATKLHSQLRTTVLATAAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIEAKLRHFTNALMERLITPLQDKIEEWKKTAGLLDKDHAKEYKRSRQEIKKKSSDTLKLQKKARK-----GRGGLQPQLDSAMQDVSDMYLLMEETEKQAVRRALLEERGRYCTFISFLQPVVNGEIAMLGEVTHLQAIIDDLTVLTTDPHKLPEASEQVILDLKGSDYSWSYQTPPSSPSST------GSRKSSLCSL 275          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Cavefish
Match: mtss1la (MTSS1-like protein [Source:NCBI gene;Acc:103039604])

HSP 1 Score: 207.994 bits (528), Expect = 6.158e-56
Identity = 108/286 (37.76%), Postives = 182/286 (63.64%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASL 911
            M+    +   L  +F  ++ D KNS P+WEDF +K+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+  L  P+QDK+E+WK+ +  LDKD  KE K+++   KK S ++++LQKKA K     G G LQ Q++ A+++ ++ Y  ++  E   +RRA++ ER R+C   S ++PV+  +I++L +++ L  ++  LT+ T  P +LP  SE++I  +   +   S ++  +   +T      GSRKSS+ SL
Sbjct:   38 MESVEKECGALGGLFQAVVNDMKNSYPVWEDFSAKATKLHSQLRTTVLATAAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIEAKLRHFTNALMERLITPLQDKIEEWKKTAGLLDKDHAKEYKRSRQEIKKKSSDTLKLQKKARK-----GRGGLQPQLDSAMQDVSDMYLLMEETEKQAVRRALLEERGRYCTFISFLQPVVNGEIAMLGEVTHLQAIIDDLTVLTTDPHKLPEASEQVILDLKGSDYSWSYQTPPSSPSST------GSRKSSLCSL 312          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Cavefish
Match: mtss1la (MTSS1-like protein [Source:NCBI gene;Acc:103039604])

HSP 1 Score: 207.994 bits (528), Expect = 6.291e-56
Identity = 108/286 (37.76%), Postives = 182/286 (63.64%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASL 911
            M+    +   L  +F  ++ D KNS P+WEDF +K+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+  L  P+QDK+E+WK+ +  LDKD  KE K+++   KK S ++++LQKKA K     G G LQ Q++ A+++ ++ Y  ++  E   +RRA++ ER R+C   S ++PV+  +I++L +++ L  ++  LT+ T  P +LP  SE++I  +   +   S ++  +   +T      GSRKSS+ SL
Sbjct:    1 MESVEKECGALGGLFQAVVNDMKNSYPVWEDFSAKATKLHSQLRTTVLATAAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIEAKLRHFTNALMERLITPLQDKIEEWKKTAGLLDKDHAKEYKRSRQEIKKKSSDTLKLQKKARK-----GRGGLQPQLDSAMQDVSDMYLLMEETEKQAVRRALLEERGRYCTFISFLQPVVNGEIAMLGEVTHLQAIIDDLTVLTTDPHKLPEASEQVILDLKGSDYSWSYQTPPSSPSST------GSRKSSLCSL 275          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001774.1 (pep scaffold:Pmarinus_7.0:GL476804:163249:239367:-1 gene:ENSPMAG00000001586.1 transcript:ENSPMAT00000001774.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 198.749 bits (504), Expect = 1.293e-53
Identity = 101/235 (42.98%), Postives = 164/235 (69.79%), Query Frame = 3
Query:   93 MFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEII 797
            +F  ++ D K S P+WEDF++K+ KL++ L+   +   AF +AFQK+AD+AT+T+G+T+EIG++ TR+C+R R +E K++ +S  L+ SL +P+Q+K+EDWKR +NQLDKD  KE K+ +   KK S ++++LQKK V++G  +G+  +Q Q+E AL++  + Y  L+  E   +RRA+I ER RFC     ++PVL+ +IS+L +++ L  +++ LT  T  P RLP  SE++I
Sbjct:   15 LFQAVINDMKGSYPVWEDFVNKATKLNSQLRTTTVAVVAFLDAFQKVADMATNTRGSTREIGSALTRVCIRHRSIESKLRQVSTALMESLVSPLQEKIEDWKRSANQLDKDHAKEYKRVRQEIKKKSSDTLKLQKK-VRKG--KGV-DVQPQLELALQDVNDSYLLLEETEKGAVRRALIEERGRFCTFVYHLRPVLDQEISMLEEVTHLQTIVQDLTNMTSDPHRLPPASEQVI 245          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002029.1 (pep scaffold:Pmarinus_7.0:GL477038:82432:99356:-1 gene:ENSPMAG00000001830.1 transcript:ENSPMAT00000002029.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 1.878e-19
Identity = 74/193 (38.34%), Postives = 112/193 (58.03%), Query Frame = 3
Query:  336 LSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASLN 914
            L+++L+G    P+Q+KLE+WK+ + QLDKD  KE KKA+   KK S +++RLQKKA K   + G   +Q  ++ AL+   + Y  LQ  E   +RRA++ ER R+C     ++ VL  ++++L D++ L  ++  L+  T  P  LP  SE++   ILD  L GS   N +        S  GSRKSS+ SLN
Sbjct:    2 LASNLLG----PLQEKLEEWKKTAAQLDKDHAKEYKKARQEIKKKSTDTIRLQKKAKKE--IIGNREVQPALDSALQEVTDTYLLLQEEEKQAVRRALLEERSRYCTFTYMLRDVLTHEVAMLGDVTHLQAILDDLSSLTKDPHALPPASEQL---ILD--LKGS-DYNWSYQTPPSSPSTSGSRKSSMCSLN 182          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002039.1 (pep scaffold:Pmarinus_7.0:GL477038:84867:99356:-1 gene:ENSPMAG00000001830.1 transcript:ENSPMAT00000002039.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 6.307e-19
Identity = 57/150 (38.00%), Postives = 89/150 (59.33%), Query Frame = 3
Query:  348 LIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEII 797
            L  +L  P+Q+KLE+WK+ + QLDKD  KE KKA+   KK S +++RLQKKA K     G   +Q  ++ AL+   + Y  LQ  E   +RRA++ ER R+C     ++ VL  ++++L D++ L  ++  L+  T  P  LP  SE++I
Sbjct:    2 LASNLLGPLQEKLEEWKKTAAQLDKDHAKEYKKARQEIKKKSTDTIRLQKKAKK-----GNREVQPALDSALQEVTDTYLLLQEEEKQAVRRALLEERSRYCTFTYMLRDVLTHEVAMLGDVTHLQAILDDLSSLTKDPHALPPASEQLI 146          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002035.1 (pep scaffold:Pmarinus_7.0:GL477038:82432:99356:-1 gene:ENSPMAG00000001830.1 transcript:ENSPMAT00000002035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 1.069e-18
Identity = 58/154 (37.66%), Postives = 93/154 (60.39%), Query Frame = 3
Query:  336 LSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEII 797
            L+++L+G    P+Q+KLE+WK+ + QLDKD  KE KKA+   KK S +++RLQKKA K     G   +Q  ++ AL+   + Y  LQ  E   +RRA++ ER R+C     ++ VL  ++++L D++ L  ++  L+  T  P  LP  SE++I
Sbjct:    2 LASNLLG----PLQEKLEEWKKTAAQLDKDHAKEYKKARQEIKKKSTDTIRLQKKAKK-----GNREVQPALDSALQEVTDTYLLLQEEEKQAVRRALLEERSRYCTFTYMLRDVLTHEVAMLGDVTHLQAILDDLSSLTKDPHALPPASEQLI 146          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Nematostella
Match: EDO47387 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMQ4])

HSP 1 Score: 83.5741 bits (205), Expect = 1.846e-19
Identity = 31/82 (37.80%), Postives = 60/82 (73.17%), Query Frame = 3
Query:   93 MFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTL 338
            +   I+ D KNS+P+W+DF+ K+ KLH+AL+     + +F +AFQ++AD+A +++G++++IG S T++ MR + ++ ++K L
Sbjct:   11 LIQSIINDLKNSAPVWDDFVGKAGKLHSALRRKFRAADSFLDAFQRVADVANNSRGSSRDIGQSLTKMVMRHKSIDGQLKAL 92          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Medaka
Match: MTSS2 (MTSS1-like protein [Source:NCBI gene;Acc:101154768])

HSP 1 Score: 209.92 bits (533), Expect = 2.441e-56
Identity = 102/251 (40.64%), Postives = 168/251 (66.93%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K S P+WEDF +K+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL  P+QDK+EDWK+ +NQLDKD  KE K+++   KK S ++++LQKKA K     G G LQ Q++ A+++ ++    ++ +E   +RRA++ ER RFC     ++PV+  +I++L +I+ L  ++  LT+ T  P +LP  SE++I+ +
Sbjct:    7 METVEKECGALGGLFQAIVNDMKCSYPVWEDFSAKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIEAKLRQFTNALMESLIAPLQDKIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARK-----GRGDLQPQLDNAVQDVSDMCLLMEEMEKQAVRRALVEERGRFCTFIGFLQPVVNGEIAMLGEITHLQAIIDDLTVLTTDPHKLPPASEQVIKDL 252          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Medaka
Match: MTSS2 (MTSS1-like protein [Source:NCBI gene;Acc:101154768])

HSP 1 Score: 209.92 bits (533), Expect = 3.816e-56
Identity = 102/251 (40.64%), Postives = 168/251 (66.93%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K S P+WEDF +K+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL  P+QDK+EDWK+ +NQLDKD  KE K+++   KK S ++++LQKKA K     G G LQ Q++ A+++ ++    ++ +E   +RRA++ ER RFC     ++PV+  +I++L +I+ L  ++  LT+ T  P +LP  SE++I+ +
Sbjct:    7 METVEKECGALGGLFQAIVNDMKCSYPVWEDFSAKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIEAKLRQFTNALMESLIAPLQDKIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARK-----GRGDLQPQLDNAVQDVSDMCLLMEEMEKQAVRRALVEERGRFCTFIGFLQPVVNGEIAMLGEITHLQAIIDDLTVLTTDPHKLPPASEQVIKDL 252          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Medaka
Match: MTSS2 (MTSS1-like protein [Source:NCBI gene;Acc:101154768])

HSP 1 Score: 208.764 bits (530), Expect = 3.919e-56
Identity = 102/251 (40.64%), Postives = 168/251 (66.93%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K S P+WEDF +K+ KLH+ L+  +L + AF +AFQK+AD+AT+T+GAT++IG++ TR+CMR R +E K++  +N L+ SL  P+QDK+EDWK+ +NQLDKD  KE K+++   KK S ++++LQKKA K     G G LQ Q++ A+++ ++    ++ +E   +RRA++ ER RFC     ++PV+  +I++L +I+ L  ++  LT+ T  P +LP  SE++I+ +
Sbjct:    1 METVEKECGALGGLFQAIVNDMKCSYPVWEDFSAKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMCMRHRSIEAKLRQFTNALMESLIAPLQDKIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARK-----GRGDLQPQLDNAVQDVSDMCLLMEEMEKQAVRRALVEERGRFCTFIGFLQPVVNGEIAMLGEITHLQAIIDDLTVLTTDPHKLPPASEQVIKDL 246          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Medaka
Match: mtss1la (MTSS1-like protein [Source:NCBI gene;Acc:101164641])

HSP 1 Score: 204.142 bits (518), Expect = 1.694e-54
Identity = 98/251 (39.04%), Postives = 169/251 (67.33%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K+S P+WEDF +K+ KLH  L+  +L + AF +AFQK+AD+AT+++GAT++IG++ TR+CMR R +E K++  SN L+  L  P+QD++E+WK+ +NQLDKD  KE K+++   K+ S ++++LQKKA K     G G+L+ Q++ A+++  + Y  ++  E   +RRA++ ER R+C   S ++PV+  +I++L +I+ L  +++ LT+ T  P +LP  SE++I+ +
Sbjct:    1 MESVEKECGALGGLFQAIVNDMKSSYPVWEDFSAKATKLHAQLRTTILAAVAFLDAFQKVADMATNSRGATRDIGSALTRMCMRHRSIEAKLRHFSNVLMEGLVTPLQDRIEEWKKTANQLDKDHTKEYKRSRQEIKRKSLDTIKLQKKARK-----GRGNLRPQLDSAMQDVNDLYLLMEETEKQAVRRALLEERGRYCSFISLLQPVVNVEIAMLGEITHLQAIVEDLTVLTEDPHKLPPASEQVIRDL 246          
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Medaka
Match: mtss1la (MTSS1-like protein [Source:NCBI gene;Acc:101164641])

HSP 1 Score: 202.986 bits (515), Expect = 2.777e-54
Identity = 98/251 (39.04%), Postives = 169/251 (67.33%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQI 806
            M+    +   L  +F  I+ D K+S P+WEDF +K+ KLH  L+  +L + AF +AFQK+AD+AT+++GAT++IG++ TR+CMR R +E K++  SN L+  L  P+QD++E+WK+ +NQLDKD  KE K+++   K+ S ++++LQKKA K     G G+L+ Q++ A+++  + Y  ++  E   +RRA++ ER R+C   S ++PV+  +I++L +I+ L  +++ LT+ T  P +LP  SE++I+ +
Sbjct:    1 MESVEKECGALGGLFQAIVNDMKSSYPVWEDFSAKATKLHAQLRTTILAAVAFLDAFQKVADMATNSRGATRDIGSALTRMCMRHRSIEAKLRHFSNVLMEGLVTPLQDRIEEWKKTANQLDKDHTKEYKRSRQEIKRKSLDTIKLQKKARK-----GRGNLRPQLDSAMQDVNDLYLLMEETEKQAVRRALLEERGRYCSFISLLQPVVNVEIAMLGEITHLQAIVEDLTVLTEDPHKLPPASEQVIRDL 246          
BLAST of MTSS I-BAR domain containing 2 vs. Planmine SMEST
Match: SMESG000028682.1 (SMESG000028682.1)

HSP 1 Score: 1371.3 bits (3548), Expect = 0.000e+0
Identity = 741/791 (93.68%), Postives = 742/791 (93.81%), Query Frame = 3
Query:   93 MFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASLNSHQSFSSGCGPSSTA----------------------------------------KGETNDTNLGASYLSMTSSMQEASGCSGDYRVSDDDSKKNFELEKSGXXXXXXXXXXXXXXXXXXXXXXXVKTPSSPSASLWSEKLNPSSDVGPKFVASRHTISGTSIYSRPALSPGIFEPLNKTEHRSDATLQKMDQSKQLYPNQAIPLPVYTNLQELTNAAQRKFSMXXXXXXXXXXX---XXETSEFEMDSNRASLNLTNSVTDHYASHSGSKTPGLRRMTLPEVMQSEKDGKNQNNSFKMKNYALANLTIKENNENDDEEVTPTSSPKLRHVRKSKTFMSRNTESLTYFPNIVYSSIPIQYPQKYVPKPINSSQPSQQMSTLTRTSESHHINCAQIGRNHHRTTSLSDNTHDYENVEINNASMSPTIQNNVAVNRPLEVHYFNPTQGLVINELNQQLKRQKPIPNSMVITENINWXXXXXXXXXXXXXXXAEEEIRLASIPIPNRHEVIIRHYSSPNV 2336
            MFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIKETKKAKTHWKKASGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAM HERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASLNSHQSFSSGCGPSSTA                                        KGETNDTNLGASYLSMTSSMQEASGCSGDYRVSDDDSKKNFELEKSGEEDSDDEEEEIEDEDEEEESEEDVKTPSSPSASLWSEKLNPSSDVGPKFVASRHTISGTSIYSRPALSPGIFEPLNKTEHRSDATLQKMDQSKQLYPNQAIPLPVYTNLQELTNAAQRKFSMQQQQQ     +   AQETSEFEMDSNRASLNLTNSVTDHYASHSGSKTPGLRRMTLPEVMQSEKDGKNQNNSFKMKNYALANLTIKENNENDDEEVTPTSSPKLRHVRKSKTFMSRNTESLTYFPNIVYSSIPIQYPQKYVPKPINSSQPSQQMSTLTRTSESHHINCAQIGRNHHRTTSLSDNTHDYENVEINNASMSPTIQNNVAVNRPLEVHYFNPTQGLVINELNQQLKRQKPIPNSMVITENINWTDLDPDLPMPPPPTTAEEEIRLASIPIPNRHEVIIRHYSSPNV
Sbjct:    1 MFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIKETKKAKTHWKKASGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMTHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASLNSHQSFSSGCGPSSTATKLSHHYSDVDFSHFGTMHSLRPSERGSIKSFFDSSVKFKKGETNDTNLGASYLSMTSSMQEASGCSGDYRVSDDDSKKNFELEKSGEEDSDDEEEEIEDEDEEEESEEDVKTPSSPSASLWSEKLNPSSDVGPKFVASRHTISGTSIYSRPALSPGIFEPLNKTEHRSDATLQKMDQSKQLYPNQAIPLPVYTNLQELTNAAQRKFSMQQQQQQQQPYSQQNAQETSEFEMDSNRASLNLTNSVTDHYASHSGSKTPGLRRMTLPEVMQSEKDGKNQNNSFKMKNYALANLTIKENNENDDEEVTPTSSPKLRHVRKSKTFMSRNTESLTYFPNIVYSSIPIQYPQKYVPKPINSSQPSQQMSTLTRTSESHHINCAQIGRNHHRTTSLSDNTHDYENVEINNASMSPTIQNNVAVNRPLEVHYFNPTQGLVINELNQQLKRQKPIPNSMVITENINWTDLDPDLPMPPPPTTAEEEIRLASIPIPNRHEVIIRHYSSPNV 791          
BLAST of MTSS I-BAR domain containing 2 vs. Planmine SMEST
Match: SMESG000028682.1 (SMESG000028682.1)

HSP 1 Score: 966.066 bits (2496), Expect = 0.000e+0
Identity = 530/580 (91.38%), Postives = 531/580 (91.55%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASLNSHQSFSSGCGPSSTA----------------------------------------KGETNDTNLGASYLSMTSSMQEASGCSGDYRVSDDDSKKNFELEKSGXXXXXXXXXXXXXXXXXXXXXXXVKTPSSPSASLWSEKLNPSSDVGPKFVASRHTISGTSIYSRPALSPGIFEPLNKTEHRSDATLQKMDQSKQLYPNQAIPLPVYTNLQELTNAAQRKFSMXXXXXXXXXXX---XXETSEFEMDSNRASLNLTNSVTDHYASHSGSKTPGLRRMTLPEVMQSEKDGKNQ 1664
            MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIKETKKAKTHWKKASGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAM HERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASLNSHQSFSSGCGPSSTA                                        KGETNDTNLGASYLSMTSSMQEASGCSGDYRVSDDDSKKNFELEKSGEEDSDDEEEEIEDEDEEEESEEDVKTPSSPSASLWSEKLNPSSDVGPKFVASRHTISGTSIYSRPALSPGIFEPLNKTEHRSDATLQKMDQSKQLYPNQAIPLPVYTNLQELTNAAQRKFSMQQQQQ     +   AQETSEFEMDSNRASLNLTNSVTDHYASHSGSKTPGLRRMTLPEVMQSEKDGKNQ
Sbjct:    1 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIKETKKAKTHWKKASGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMTHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASLNSHQSFSSGCGPSSTATKLSHHYSDVDFSHFGTMHSLRPSERGSIKSFFDSSVKFKKGETNDTNLGASYLSMTSSMQEASGCSGDYRVSDDDSKKNFELEKSGEEDSDDEEEEIEDEDEEEESEEDVKTPSSPSASLWSEKLNPSSDVGPKFVASRHTISGTSIYSRPALSPGIFEPLNKTEHRSDATLQKMDQSKQLYPNQAIPLPVYTNLQELTNAAQRKFSMQQQQQQQQPYSQQNAQETSEFEMDSNRASLNLTNSVTDHYASHSGSKTPGLRRMTLPEVMQSEKDGKNQ 580          

HSP 2 Score: 289.271 bits (739), Expect = 6.222e-85
Identity = 152/153 (99.35%), Postives = 153/153 (100.00%), Query Frame = 3
Query: 1878 VPKPINSSQPSQQMSTLTRTSESHHINCAQIGRNHHRTTSLSDNTHDYENVEINNASMSPTIQNNVAVNRPLEVHYFNPTQGLVINELNQQLKRQKPIPNSMVITENINWXXXXXXXXXXXXXXXAEEEIRLASIPIPNRHEVIIRHYSSPNV 2336
            +PKPINSSQPSQQMSTLTRTSESHHINCAQIGRNHHRTTSLSDNTHDYENVEINNASMSPTIQNNVAVNRPLEVHYFNPTQGLVINELNQQLKRQKPIPNSMVITENINWTDLDPDLPMPPPPTTAEEEIRLASIPIPNRHEVIIRHYSSPNV
Sbjct:  581 MPKPINSSQPSQQMSTLTRTSESHHINCAQIGRNHHRTTSLSDNTHDYENVEINNASMSPTIQNNVAVNRPLEVHYFNPTQGLVINELNQQLKRQKPIPNSMVITENINWTDLDPDLPMPPPPTTAEEEIRLASIPIPNRHEVIIRHYSSPNV 733          
BLAST of MTSS I-BAR domain containing 2 vs. Planmine SMEST
Match: SMESG000028682.1 (SMESG000028682.1)

HSP 1 Score: 960.288 bits (2481), Expect = 0.000e+0
Identity = 517/527 (98.10%), Postives = 518/527 (98.29%), Query Frame = 3
Query:   93 MFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASLNSHQSFSSGCGPSSTAKGETNDTNLGASYLSMTSSMQEASGCSGDYRVSDDDSKKNFELEKSGXXXXXXXXXXXXXXXXXXXXXXXVKTPSSPSASLWSEKLNPSSDVGPKFVASRHTISGTSIYSRPALSPGIFEPLNKTEHRSDATLQKMDQSKQLYPNQAIPLPVYTNLQELTNAAQRKFSMXXXXXXXXXXX---XXETSEFEMDSNRASLNLTNSVTDHYASHSGSKTPGLRRMTLPEVMQSEKDGKNQ 1664
            MFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIKETKKAKTHWKKASGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAM HERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASLNSHQSFSSGCGPSSTAKGETNDTNLGASYLSMTSSMQEASGCSGDYRVSDDDSKKNFELEKSGEEDSDDEEEEIEDEDEEEESEEDVKTPSSPSASLWSEKLNPSSDVGPKFVASRHTISGTSIYSRPALSPGIFEPLNKTEHRSDATLQKMDQSKQLYPNQAIPLPVYTNLQELTNAAQRKFSMQQQQQ     +   AQETSEFEMDSNRASLNLTNSVTDHYASHSGSKTPGLRRMTLPEVMQSEKDGKNQ
Sbjct:    1 MFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIKETKKAKTHWKKASGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMTHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASLNSHQSFSSGCGPSSTAKGETNDTNLGASYLSMTSSMQEASGCSGDYRVSDDDSKKNFELEKSGEEDSDDEEEEIEDEDEEEESEEDVKTPSSPSASLWSEKLNPSSDVGPKFVASRHTISGTSIYSRPALSPGIFEPLNKTEHRSDATLQKMDQSKQLYPNQAIPLPVYTNLQELTNAAQRKFSMQQQQQQQQPYSQQNAQETSEFEMDSNRASLNLTNSVTDHYASHSGSKTPGLRRMTLPEVMQSEKDGKNQ 527          

HSP 2 Score: 288.5 bits (737), Expect = 3.072e-85
Identity = 152/153 (99.35%), Postives = 153/153 (100.00%), Query Frame = 3
Query: 1878 VPKPINSSQPSQQMSTLTRTSESHHINCAQIGRNHHRTTSLSDNTHDYENVEINNASMSPTIQNNVAVNRPLEVHYFNPTQGLVINELNQQLKRQKPIPNSMVITENINWXXXXXXXXXXXXXXXAEEEIRLASIPIPNRHEVIIRHYSSPNV 2336
            +PKPINSSQPSQQMSTLTRTSESHHINCAQIGRNHHRTTSLSDNTHDYENVEINNASMSPTIQNNVAVNRPLEVHYFNPTQGLVINELNQQLKRQKPIPNSMVITENINWTDLDPDLPMPPPPTTAEEEIRLASIPIPNRHEVIIRHYSSPNV
Sbjct:  528 MPKPINSSQPSQQMSTLTRTSESHHINCAQIGRNHHRTTSLSDNTHDYENVEINNASMSPTIQNNVAVNRPLEVHYFNPTQGLVINELNQQLKRQKPIPNSMVITENINWTDLDPDLPMPPPPTTAEEEIRLASIPIPNRHEVIIRHYSSPNV 680          
BLAST of MTSS I-BAR domain containing 2 vs. Planmine SMEST
Match: SMESG000038576.1 (SMESG000038576.1)

HSP 1 Score: 230.72 bits (587), Expect = 2.522e-64
Identity = 135/312 (43.27%), Postives = 204/312 (65.38%), Query Frame = 3
Query:   54 MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQG-ATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFS--------------SGFGSRKSSVASLNSHQSFSSGCG 944
            MD   N+  +L+ +F+  L D K S P+W+D + K  +LH A+++V+  +++F E+FQKIADLAT++   A+K+IG S TRL +RQR +  K+KT++  +   + +P+Q +L++WKR + Q+DKDRIKET++AK+  KKAS E  RLQKKA+KRGSM+GLGSLQ QVE ALK AA+KY +L+ +E   +RR +I ER RFC+  +C+ PVLE QI++ +++ +L+E+  T+T     P+ L   SE++I+ I+ P  + S   +  V+ +  +S              S   SRKSSV S+NS  S S   G
Sbjct:    1 MDYVPNNFKSLSELFDCTLSDLKGSIPLWDDLVIKITRLHAAMRSVVQANSSFLESFQKIADLATNSSALASKDIGTSLTRLSLRQRSLHLKMKTMNESMACRIIDPMQQRLDEWKRCNLQIDKDRIKETRRAKSELKKASEEKNRLQKKAMKRGSMKGLGSLQMQVEVALKEAADKYQALENIEYDCVRRVVIEERSRFCYFVNCLMPVLECQINMFSEMQTLEEIRNTITSLIENPNGLTQSSEDLIRSIIRPLSLSSM--DAVVAASIAYSTTPPPSTDTGSSEGSLMSSRKSSVLSINSEASSSHSGG 310          
BLAST of MTSS I-BAR domain containing 2 vs. Planmine SMEST
Match: SMESG000038660.1 (SMESG000038660.1)

HSP 1 Score: 106.686 bits (265), Expect = 3.170e-23
Identity = 96/316 (30.38%), Postives = 167/316 (52.85%), Query Frame = 3
Query:  135 IWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIXXXXXXXXXXXXXSGESVRLQKKAVKRGSMR-GLGSLQN-QVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTLT-LNTVFPDRLPVESEEIIQQILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASLNSHQSFSSGCGPSSTAKGETNDTNLGASYLSMTSSMQE-ASGCSGDYRVSDDDS 1070
            IWED +SKS K HN++K + L S+   ++   + D+A+ +    K  G S T+L +RQ+ +E K+ TL+++L  +LS+ +   L +W++ S  L ++R  + KKA   ++K+  E  R +KK  K+ + + GL    + Q++ A ++A  K   ++ +E   +RRA I ER+RF      +KP+L+ Q+S+  D+ +L+E++  L    +   D  P E E+ IQ+      + +  + C     +       S++ S AS  SH S +S     ST   E N+ NL  + + M+S + E  S  S D  +  D S
Sbjct:   22 IWEDLISKSLKFHNSIKLMTLSSSDLLDSLHSVCDIASKSPCCIKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKKNAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQE----HTIDNRSTTCIPRSYSTL-----SKQKSTASTGSHSSLNSNS--MSTTSSEWNNNNLITACMEMSSRLNENMSNLSHDSGIKSDKS 326          
The following BLAST results are available for this feature:
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTSS28.661e-5942.23MTSS I-BAR domain containing 2 [Source:HGNC Symbol... [more]
MTSS23.914e-5841.43MTSS I-BAR domain containing 2 [Source:HGNC Symbol... [more]
MTSS14.481e-5742.91MTSS I-BAR domain containing 1 [Source:HGNC Symbol... [more]
MTSS16.079e-5742.91MTSS I-BAR domain containing 1 [Source:HGNC Symbol... [more]
MTSS17.295e-5742.91MTSS I-BAR domain containing 1 [Source:HGNC Symbol... [more]
back to top
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
M04F3.57.712e-1622.13pep chromosome:WBcel235:I:4773818:4788358:-1 gene:... [more]
M04F3.58.962e-1621.90pep chromosome:WBcel235:I:4773818:4777717:-1 gene:... [more]
back to top
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mim2.209e-4938.30gene:FBgn0053558 transcript:FBtr0332941[more]
mim2.862e-4939.09gene:FBgn0053558 transcript:FBtr0302035[more]
mim3.289e-4939.09gene:FBgn0053558 transcript:FBtr0302577[more]
mim4.377e-4939.09gene:FBgn0053558 transcript:FBtr0306614[more]
mim6.320e-4939.09gene:FBgn0053558 transcript:FBtr0302578[more]
back to top
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mtss1lb5.060e-5742.44MTSS I-BAR domain containing 2b [Source:ZFIN;Acc:Z... [more]
mtss1la7.936e-5638.08MTSS I-BAR domain containing 2a [Source:ZFIN;Acc:Z... [more]
mtss1la3.656e-5539.16MTSS I-BAR domain containing 2a [Source:ZFIN;Acc:Z... [more]
mtss12.943e-4638.11MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss2.23.244e-5741.43acyl-CoA synthetase short-chain family member 2, g... [more]
acss2.26.506e-5741.43acyl-CoA synthetase short-chain family member 2, g... [more]
acss2.28.312e-5741.43acyl-CoA synthetase short-chain family member 2, g... [more]
acss2.22.717e-4437.02acyl-CoA synthetase short-chain family member 2, g... [more]
ENSXETT00000003339.11.872e-3939.18metastasis suppressor 1, gene 2 [Source:NCBI gene;... [more]
back to top
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mtss22.415e-5842.23MTSS I-BAR domain containing 2 [Source:MGI Symbol;... [more]
Mtss12.406e-5742.66MTSS I-BAR domain containing 1 [Source:MGI Symbol;... [more]
Mtss24.871e-3841.27MTSS I-BAR domain containing 2 [Source:MGI Symbol;... [more]
Mtss22.150e-2139.29MTSS I-BAR domain containing 2 [Source:MGI Symbol;... [more]
Mtss21.645e-1738.06MTSS I-BAR domain containing 2 [Source:MGI Symbol;... [more]
back to top
BLAST of MTSS I-BAR domain containing 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q765P7|MTSS2_HUMAN4.159e-5842.23Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE... [more]
sp|Q6P9S0|MTSS2_MOUSE1.689e-5742.23Protein MTSS 2 OS=Mus musculus OX=10090 GN=Mtss2 P... [more]
sp|Q8R1S4|MTSS1_MOUSE2.014e-5642.29Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 P... [more]
sp|O43312|MTSS1_HUMAN3.503e-5642.91Protein MTSS 1 OS=Homo sapiens OX=9606 GN=MTSS1 PE... [more]
back to top
BLAST of MTSS I-BAR domain containing 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D9EP794.807e-5842.63E3 ubiquitin-protein ligase SMURF1 OS=Platysternon... [more]
A0A1A8HGI45.632e-5841.83Metastasis suppressor 1-like (Fragment) OS=Nothobr... [more]
A0A0B7A6N49.693e-5843.53IMD domain-containing protein (Fragment) OS=Arion ... [more]
A0A480KNL61.867e-5742.23MTSS1-like protein isoform X2 OS=Sus scrofa OX=982... [more]
H0Z6N93.620e-5742.23MTSS I-BAR domain containing 2 OS=Taeniopygia gutt... [more]
back to top
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtss1lb1.685e-5741.04MTSS I-BAR domain containing 2 [Source:NCBI gene;A... [more]
mtss1lb5.117e-5741.04MTSS I-BAR domain containing 2 [Source:NCBI gene;A... [more]
mtss1la3.254e-5637.76MTSS1-like protein [Source:NCBI gene;Acc:103039604... [more]
mtss1la6.158e-5637.76MTSS1-like protein [Source:NCBI gene;Acc:103039604... [more]
mtss1la6.291e-5637.76MTSS1-like protein [Source:NCBI gene;Acc:103039604... [more]
back to top
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000001774.11.293e-5342.98pep scaffold:Pmarinus_7.0:GL476804:163249:239367:-... [more]
ENSPMAT00000002029.11.878e-1938.34pep scaffold:Pmarinus_7.0:GL477038:82432:99356:-1 ... [more]
ENSPMAT00000002039.16.307e-1938.00pep scaffold:Pmarinus_7.0:GL477038:84867:99356:-1 ... [more]
ENSPMAT00000002035.11.069e-1837.66pep scaffold:Pmarinus_7.0:GL477038:82432:99356:-1 ... [more]
back to top
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO473871.846e-1937.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MTSS I-BAR domain containing 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTSS22.441e-5640.64MTSS1-like protein [Source:NCBI gene;Acc:101154768... [more]
MTSS23.816e-5640.64MTSS1-like protein [Source:NCBI gene;Acc:101154768... [more]
MTSS23.919e-5640.64MTSS1-like protein [Source:NCBI gene;Acc:101154768... [more]
mtss1la1.694e-5439.04MTSS1-like protein [Source:NCBI gene;Acc:101164641... [more]
mtss1la2.777e-5439.04MTSS1-like protein [Source:NCBI gene;Acc:101164641... [more]
back to top
BLAST of MTSS I-BAR domain containing 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028682.10.000e+093.68SMESG000028682.1[more]
SMESG000028682.16.222e-8591.38SMESG000028682.1[more]
SMESG000028682.13.072e-8598.10SMESG000028682.1[more]
SMESG000038576.12.522e-6443.27SMESG000038576.1[more]
SMESG000038660.13.170e-2330.38SMESG000038660.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019871 ID=SMED30019871|Name=MTSS I-BAR domain containing 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2856bp
TGAATTTCTTTTTAAATTGGTTGATATAGTCTGTATTTTCACTTTCATTA
TTAATGGATGTGGGATCGAATGATGTTTCTACATTAACTCTAATGTTTAA
CAAAATTCTTTTGGATTTTAAAAATAGTTCACCAATTTGGGAAGATTTTT
TATCAAAATCCAATAAACTTCACAATGCTCTCAAAAATGTTTTGCTATGC
TCAACGGCCTTTTGGGAAGCATTTCAAAAAATTGCCGATTTGGCAACAGA
TACCCAAGGAGCAACGAAAGAAATCGGAGCTTCTTTTACTAGATTATGTA
TGCGTCAAAGATTGATGGAATGTAAAATAAAAACTTTAAGCAACCATCTT
ATTGGAAGTTTATCAAATCCAGTTCAGGACAAATTAGAAGACTGGAAACG
CTACTCAAATCAGCTGGATAAAGACCGAATTAAGGAAACTAAAAAAGCTA
AAACCCATTGGAAGAAAGCGTCTGGAGAATCTGTTAGATTACAGAAAAAG
GCTGTGAAACGCGGAAGTATGCGAGGTCTTGGATCATTGCAAAACCAAGT
TGAAGGTGCTTTGAAAAATGCTGCAGAAAAATATACGAGTCTACAGACAG
TCGAATCTATTTACCTTAGACGTGCTATGATCCACGAACGCGAGAGATTT
TGTTTTTTATTCTCATGCATGAAACCGGTTCTGGAATCCCAGATCAGTTT
ATTAACAGACATATCGAGTTTGGATGAACTAATGAAAACTCTTACATTGA
ATACGGTATTTCCAGATCGGTTACCGGTTGAATCAGAGGAAATAATTCAA
CAAATATTAGATCCAGAATTAGTCGGCTCAACTAAGTCCAACTGCAATGT
TAGTGGAAATACAGTATTCTCAAGTGGTTTTGGTAGTCGGAAATCTAGTG
TTGCGTCATTAAATAGCCATCAGTCTTTTAGTTCCGGCTGTGGTCCGTCT
TCAACAGCGAAAGGAGAAACAAATGATACCAATCTCGGAGCTAGTTATTT
GTCAATGACATCATCAATGCAAGAAGCCAGTGGGTGCAGTGGGGATTATC
GTGTTTCTGATGATGATAGCAAAAAAAATTTTGAACTGGAAAAATCCGGT
GAAGAGGATAGTGACGACGAAGAAGAGGAAATTGAGGATGAGGACGAAGA
GGAAGAAAGTGAAGAAGATGTTAAAACTCCAAGCAGTCCATCGGCCTCAC
TATGGAGTGAGAAATTAAATCCATCTTCTGATGTCGGTCCGAAATTTGTT
GCTTCGAGACATACAATTAGTGGAACAAGTATATATTCTCGACCAGCTTT
ATCACCTGGAATTTTTGAACCACTCAACAAAACTGAACACCGATCAGATG
CTACCTTGCAAAAAATGGACCAATCTAAACAGCTTTATCCAAATCAAGCG
ATTCCTTTACCGGTTTATACGAATTTACAAGAGCTAACTAATGCAGCCCA
AAGAAAATTCTCCATGCAACAACAGCAACAACCATACAGCCAACAAAATG
CACAGGAAACTTCCGAATTTGAGATGGATTCGAATCGTGCTAGTCTAAAC
CTAACAAATTCTGTCACAGATCATTACGCGTCACATTCAGGCTCAAAAAC
CCCTGGATTGAGAAGAATGACATTACCAGAGGTGATGCAATCAGAAAAAG
ACGGCAAAAATCAAAATAATTCTTTCAAAATGAAAAATTATGCCTTAGCA
AATTTAACTATAAAGGAAAATAATGAAAATGATGATGAAGAAGTTACACC
AACTTCGAGTCCAAAATTAAGACATGTCAGAAAATCCAAGACTTTTATGT
CGAGAAATACTGAAAGTCTTACTTATTTTCCAAATATAGTATATTCCAGC
ATTCCGATTCAATATCCTCAAAAATATGTGCCGAAACCTATAAATTCATC
TCAACCATCACAGCAAATGTCGACATTAACCCGGACATCCGAATCTCACC
ATATCAATTGTGCCCAGATTGGCAGAAACCATCACCGGACAACTTCTCTG
AGTGATAATACTCATGATTATGAAAATGTTGAAATTAACAATGCCTCAAT
GTCCCCAACAATTCAAAATAATGTAGCTGTAAATCGCCCTTTGGAAGTAC
ACTATTTCAATCCCACTCAAGGTCTTGTAATAAATGAACTCAACCAACAA
TTAAAACGTCAAAAACCGATTCCAAACTCTATGGTAATCACGGAAAACAT
AAATTGGACTGATTTAGATCCCGACCTACCAATGCCACCTCCGCCGACAA
CAGCCGAAGAAGAGATTAGATTAGCTTCAATACCGATTCCAAACCGCCAC
GAAGTAATTATCAGGCACTATTCATCGCCAAATGTGTAGGAATCAAGCTG
ACATGATTTGATCTCAAGTTTTGAAATACTAATAATAATGATGATATTTC
AAGAATAATTATTTATTACGTTAGAGTTTTTGAGAGTTTTTTTTTCATTT
AAAGTTTTCAATGTATTAACGATTGTTACATTTCCTCATTTCTCTTGACG
GCAATTGGAATTATTTATACGAATCTTGCCAGAAAGAGAAACAAATTTGT
ATGATTTTGTACGATTTCTTGCAGATTGAACCATGTGAATATTGTTCTAG
TTATTTGAATGTTTTTTATAAATATTTCCAACGTTACTAAATATGAATAA
TAATAATAATAATAATGTAAAGACAACTGATGTTGAGCTGGATACAGATG
AATTCGAGTTGGATTTTCGCATGTCGTTAGGGGAAATGATACTTAAACAG
CGGCATACGATGATGTTCGATTCGATTCGTGAGGGCGCAGCAGAGGAATG
CTTTGGGGATTAAATCACTGTATTTTAATGAATAAAATTTGATATGGAAA
AAAAAA
back to top

protein sequence of SMED30019871-orf-1

>SMED30019871-orf-1 ID=SMED30019871-orf-1|Name=SMED30019871-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=762bp
MDVGSNDVSTLTLMFNKILLDFKNSSPIWEDFLSKSNKLHNALKNVLLCS
TAFWEAFQKIADLATDTQGATKEIGASFTRLCMRQRLMECKIKTLSNHLI
GSLSNPVQDKLEDWKRYSNQLDKDRIKETKKAKTHWKKASGESVRLQKKA
VKRGSMRGLGSLQNQVEGALKNAAEKYTSLQTVESIYLRRAMIHERERFC
FLFSCMKPVLESQISLLTDISSLDELMKTLTLNTVFPDRLPVESEEIIQQ
ILDPELVGSTKSNCNVSGNTVFSSGFGSRKSSVASLNSHQSFSSGCGPSS
TAKGETNDTNLGASYLSMTSSMQEASGCSGDYRVSDDDSKKNFELEKSGE
EDSDDEEEEIEDEDEEEESEEDVKTPSSPSASLWSEKLNPSSDVGPKFVA
SRHTISGTSIYSRPALSPGIFEPLNKTEHRSDATLQKMDQSKQLYPNQAI
PLPVYTNLQELTNAAQRKFSMQQQQQPYSQQNAQETSEFEMDSNRASLNL
TNSVTDHYASHSGSKTPGLRRMTLPEVMQSEKDGKNQNNSFKMKNYALAN
LTIKENNENDDEEVTPTSSPKLRHVRKSKTFMSRNTESLTYFPNIVYSSI
PIQYPQKYVPKPINSSQPSQQMSTLTRTSESHHINCAQIGRNHHRTTSLS
DNTHDYENVEINNASMSPTIQNNVAVNRPLEVHYFNPTQGLVINELNQQL
KRQKPIPNSMVITENINWTDLDPDLPMPPPPTTAEEEIRLASIPIPNRHE
VIIRHYSSPNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0097178ruffle assembly
GO:0007009plasma membrane organization
GO:0001701in utero embryonic development
GO:0007015actin filament organization
GO:0007399nervous system development
GO:0007517muscle organ development
GO:0010960magnesium ion homeostasis
GO:0030036actin cytoskeleton organization
GO:0030041actin filament polymerization
GO:0030282bone mineralization
GO:0032233positive regulation of actin filament bundle assembly
GO:0034334adherens junction maintenance
GO:0050680negative regulation of epithelial cell proliferation
GO:0061333renal tubule morphogenesis
GO:0071498cellular response to fluid shear stress
GO:0072001renal system development
GO:0072102glomerulus morphogenesis
GO:0072160nephron tubule epithelial cell differentiation
GO:2001013epithelial cell proliferation involved in renal tubule morphogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027267AH/BAR_dom_sf
IPR027682MTSS1
IPR030127MTSS1/MTSS2
IPR013606I-BAR_dom
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0003785actin monomer binding
GO:0005102signaling receptor binding
GO:0042802identical protein binding
GO:0051015actin filament binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005912adherens junction
GO:0015629actin cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 346..373
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 558..573
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 349..372
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 375..389
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 327..394
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 331..348
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 467..495
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 556..575
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 3..250
e-value: 2.1E-82
score: 277.8
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 13..251
IPR013606IMD/I-BAR domainPFAMPF08397IMDcoord: 15..241
e-value: 3.1E-52
score: 177.1
IPR013606IMD/I-BAR domainPROSITEPS51338IMDcoord: 1..133
score: 13.366
IPR027682I-BAR domain containing protein MTSS1PANTHERPTHR15708:SF10METASTASIS SUPPRESSOR PROTEIN 1coord: 6..298
IPR030127I-BAR domain containing protein MTSS1/MTSS2PANTHERPTHR15708ACTIN BUNDLING/MISSING IN METASTASIS-RELATEDcoord: 6..298