ATP binding cassette subfamily A member 1

Overview
NameATP binding cassette subfamily A member 1
Smed IDSMED30019868
Length (bp)5301
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP binding cassette subfamily A member 1 (SMED30019868) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP binding cassette subfamily A member 1 (SMED30019868) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Human
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:29])

HSP 1 Score: 881.708 bits (2277), Expect = 0.000e+0
Identity = 598/1739 (34.39%), Postives = 931/1739 (53.54%), Query Frame = 1
Query:  514 YNELGEIICGSPEND-FKLFMRNFIKNQRRKRSLLT--CQLIFQSFFQNSIVKFE---------------MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWR---------------LHFQTFLLDYISNNVF-------INDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPL--------DSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTF---LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDL-TEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQ----------NPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWL------MMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWS----PASILDI--------PMVSPECDCS----KTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGW-SSKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            Y  +  I+CG PE    K+   N+ ++   K        +   ++F+ NS   +                ++  L PL+ GK+ Y P+    RQ++ + N TF+ L         W                +     LLD   N+ F       ++   +   A+ + +P+   + N   ++   +   +  ++    I R + C  L++  P+         S++ +D+      R F A I+F      +TP +      + Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ ++QA I ++T  E  + G  M  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W SWFIS+++ L++   ++ V L+L  +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+     LLS VAF    ++   +E+   GVQ+ NLF++P E   F +   + +M+ D+F+Y ++TWY+EAVFPGQYG+ +PW F C +SYW       +S P    +NQ   I+    E EP +LKLG+SI NLVK+Y       ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYIL +DIR+EM +IRQ +G+CPQ+NVLFD LTVE+HI+FY  LK + +  +++ + ++  DV L + K+ + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   ++ ++++AR++E+   + T VLP        F ELF  +D  ++++ I SYG+S+T+LEE+FLKVA++     ++ E S  +      +       +    F             +P+ +++  L   D    + +KG+ L QQQ +AL  KR   A+R  KGF A+++LP + +   ++F  I     K   +++ PW+       +S    E+  T        L L+N L      D G  G RCM  NP    + +  C    E   W+    P +I+D+           SP C CS    K    +C     G  P   R   ++D L +LTG NISDYL+K + ++  K            YGGF   + +T     S+ + D+   ++++  +  ++ +     LNSL +F+  L     +        ++W N+KG+ ++ ++ N+ +N +LR+ L K       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L  INDILK VFLIFP F LGRG++D+  N    ++++ +   N     L WD+ G  LF++    + ++++ ++I+     R      K S L      N ED DV  ER+R+      +D+L +  LTKIY                     + R+ AV+ +C G+  GECFGLLGVNGAGK++TF
Sbjct:  301 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNGTEEDAETFYDNSTTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPKIWTFMENSQEMDLVRMLLDSRDNDHFWEQQLDGLDWTAQDIVAFLAKHPEDVQSSNG--SVYTWREAFNETNQAIRTISRFMECVNLNKLEPIATEVWLINKSMELLDE------RKFWAGIVFTG----ITPGSIELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGTEK-KTGVYMQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFTLKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWFGEESDEKSHP---GSNQK-RISEICMEEEPTHLKLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYR-QGRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE---SGVDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQYTFVSNDAPEDTGT--------LELLNALT----KDPG-FGTRCMEGNP----IPDTPCQAGEEE--WTTAPVPQTIMDLFQNGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGL-PPPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNTQALPPSQEVNDA--IKQMKKHLKLAKDSSADRFLNSLGRFMTGLDTKNNV--------KVWFNNKGWHAISSFLNVINNAILRANLQKGE-NPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTDN--KLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVNAKLSPL------NDEDEDVRRERQRILDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTF 1956          

HSP 2 Score: 179.874 bits (455), Expect = 1.817e-44
Identity = 101/320 (31.56%), Postives = 169/320 (52.81%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + I  L K+Y   + P ++ + +     +    LG NGAGK++T  +LTG  + + G A++    I + +  + Q +G CPQ++ + + LT  +H+ F+ LL+ + + E+  V    I+ + L +     + + SGG KRKLS AMA IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           + SN + + +  F  +    + + E+ R      LP    +      +F  L Q    + I  Y +S T+L++VF+  A D
Sbjct: 1912 LEIKELTKIYRRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIVVRIAGSNPDLKPVQDFFGLAFPGSVLKEKHRNMLQYQLPS---SLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKD 2223          

HSP 3 Score: 65.855 bits (159), Expect = 9.364e-10
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            QLR LLWKN   +RR+   LL+E+  PL +  IL +VR S   Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    6 QLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Human
Match: ABCA7 (ATP binding cassette subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:37])

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 536/1634 (32.80%), Postives = 855/1634 (52.33%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRL---HFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIF------NETFQYLTPK-NTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXX------------------------XXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCN---ILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD-----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIR--CMNPSIYRLDNYQCFYRNENNM----WSPASILDIPMVSPECDCSKTG-NQICNDLRSGGPPNSY--RIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDS--PFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNS--NSIVKHEYNA-LQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRN-----TEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            ++  L PLI GK+ + P+    R+++ + N TF+ L  LR     W +      TF+ D  +  +    ++   +      P   D +  L      +S++D  S  +SW             + R   C  LD+   L++      L +++ +      F A ++F      ++  ++ TP      +  +IR+ +  +  T K +  DRFW P P  +  TD +YV  GF++LQ+ +++A +  V +  +   G  +  MPYPCY+ D FL+ L+  LP  L +AW  SVT+ +K++V EKE+RL++ M+ MGL+  V W+ WF+S +   ++   ++ + L+L  I   S   VVF  +  + ++ + Q+F++S FFS+AN+A+  GG+ YF+ Y+ +V+ +     L      +  LLS VAF    + +   E+  EG Q+ N+   P   + F +     L+++D+ +Y L TWY+EAV PGQYG+ +PWNF   RSYW          P     +    +     E  P  L  G+S+ +L K +P +  P +  L+L+FY+  ITAFLGHNGAGKTTT+SIL+G+F PS G+A+IL  D+R+ M +IR  +G+CPQYNVLFD LTV++H++FYG LK +    +     R+++DV L  K +  + HLSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP +RRGIW+LL+KYR   RT+IL+THH+DEA+ L DRVA+++ G+L CCGS +FL+R  G GYYL+L+K +   +                         S      +L  V+ ++  AR++EE   +  +VLP    +   F  LF+ LD  +AE+ +  YG+SDTSLEE+FLKV ++       ++ S   + C     L + LR+     E  L        +   DQ         ++G+ L +QQ+ AL +KR+  A+R  +G  A+++LP L +   ++F  I         +++SP      M    ++ F        G    LE+     L E+G+    +  S +R    +        +    W+P S       SP C CS+ G  ++  D  +          +  S + + NLTG N+SD+L+K +P+L R+            YGGF          S + +G S    W  L      +  +    NL +       Q + K          IW N+KG+ SM A+ N  SN +LR+ L     +   + I+  N P+ + +       +    +++ ++I V+F +SF+PASF + L+EERV+ +K  Q + G++P +YW+ NFLWD+  Y++P  I+++IF+AF  ++Y+   N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G   +++TF+L++   + + L+E++ ILK+VFLIFP F LGRG++D+  N         +   ++ + L+W++ G+ L           + ++I     +   +  + ++  L +  +R+      ED DV  ERER+       DVL + NLTK+Y            +G+        R  AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct:  283 LWRRLKPLILGKLLFAPDTPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEAL------RSFLDPGSGGYSWQDAHADVGHLVGTLGRVTECLSLDK---LEAAPSEAALVSRALQLLAEHRFWAGVVFLGPEDSSDPTEHPTPDLGPGHVRIKIRMDIDVVTRTNKIR--DRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVR-VLSGANPRAGLYLQQMPYPCYVDDVFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCLGPFLLSAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACGGLAYFSLYLPYVLCVAWRDRLPAGGRVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVGTRPTADV-FSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPPKSPAPCPTPLDPKVLV-----EEAPPGLSPGVSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLKYR-EGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGSCGQHLCTGIAGLDVTLRLKMPPQETALENGEPAGSAPETDQGSGPDAVGRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSP-----TMYGAQVSFFSEDAPGDPGRARLLEAL----LQEAGLEEPPVQHSSHRFSAPEVPAEVAKVLASGNWTPES------PSPACQCSRPGARRLLPDCPAAAGGPPPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELWALLSPLPGGA-LDRVLKNLTAWAHSLDAQDSLK----------IWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHA-HSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELF--SDQKLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDRQFQSPLRWEVVGKNL-----------LAMVIQGPLFLLFTLLLQHRSQLLPQPRVRSLPLLGEEDEDVARERERVVQGATQGDVLVLRNLTKVY------------RGQ--------RMPAVDRLCLGIPPGECFGLLGVNGAGKTSTF 1837          

HSP 2 Score: 169.088 bits (427), Expect = 4.043e-41
Identity = 98/318 (30.82%), Postives = 157/318 (49.37%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + NL K+Y   ++P ++ L L     +    LG NGAGKT+T  ++TG    S G A +    +  E  +    +G CPQ + +F+ LT  +H+     L+ + + ++       +  + L+   +  +   SGG KRKL+ A+A +G+  VVFLDEPT G+DP ARR +W+ L+      R+++LT+H M+E + L  R+AI+  G+ +C GS   LK +F  G+ L+L         +         FV      A + E    +    LP     +     +F  L  H AE  +  + +S T LEEVFL  + D
Sbjct: 1795 LRNLTKVYRGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQPAA-------AFVAAEFPGAELREAHGGRLRFQLPPGGRCA--LARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKD 2103          

HSP 3 Score: 70.8626 bits (172), Expect = 3.156e-11
Identity = 34/80 (42.50%), Postives = 45/80 (56.25%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQ 264
             QL  LLWKNF  +RR+   LL+EL  PL + FIL AVR S    +   C F  K + S G +P+L   +C  N +C+ Q
Sbjct:    5 TQLMLLLWKNFMYRRRQPVQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLICNVNNTCFPQ 84          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Human
Match: ABCA4 (ATP binding cassette subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:34])

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 538/1733 (31.04%), Postives = 880/1733 (50.78%), Query Frame = 1
Query:  523 LGEIICGSPE--------------NDFKLFMRNFIKNQRR-------KRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLR--------LASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYN----------IKSSESIPLMRNNNQNCEINHQAF-ESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXX--------------------------------XILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLI-------NKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQK-----QSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMV-----------SPECDCSK----TGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF-----VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEM--EQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYN---SNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESG-IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            L +++CG PE              N++K F+   I + R+       +R+   C  + QS   N + K   +    PL+ GK+ Y P+    R+I++ AN TF+ L+++R        +    W     +  ++ I + +    VK F            +A+         +S  D ++  F W             + + L C  LD+F   +S  D  +LT ++        F A ++F + + + T      + Y+IR+ +  ++ T K K  DR+W   PR +   DF+Y+  GF +LQ+ ++Q         E+  VG  +  MPYPC++ D F+  L    P  +V+AW  SV++ +KSIV EKE RLKE +K  G++N V W +WF+ +  ++ + + ++++ +   +I   S   ++F  +  +  + I   F++S FFSKA++A+   G++YFT Y+  ++    +  ++  +  +  LLS VAF    ++++ +E+   G+Q+SN+  +P E   F     + +M++D+ +Y L+ WY++ VFPG YG   PW FL   SYW+            ++ +E +     + ++ E  H +F E E      G+ + NLVK++     P ++ LN+ FYE+QITAFLGHNGAGKTTT+SILTG+  P+SGT  +   DI T +D++RQ +G+CPQ+N+LF  LTV +H+ FY  LK   + E +  +  +++D  L  K N  +  LSGGM+RKLS+A+AF+G+++VV LDEPT+GVDP++RR IWDLL+KYRS  RTII++THHMDEAD L DR+AII+QG+L C G+ +FLK  FG G YL+L++   N  +  +  E                                 ++  V  ++ +A+++E    +   +LP  +   R +  LF+ L++ +A++ + S+G+SDT LEE+FLKV +D  +  +        +E     + C   + K       + +     P          +       L  G  L+ Q + AL +KR+ +  R  K FLA+++LP   +   ++   +     +   + + PW+   +       TF+  +         L     +  G  G RC+      L  Y C   N     +P+   +I  +           SP C CS     T    C +  +GG P   R   S++ L +LT  NISD+L+K +P L R           + YGG        V+P T      L+G   F  +L   +N S     +     +  F+ +L+    I        ++W N+KG+ ++ ++ N+  N +LR+ L K      +YGI+V + P+ +  EQ ++   L     ++  +AI VIF +SF+PASFV++L++ERV+ SK  QF+SG++P  YWV+NFLWDIM Y +   +++ IFI F  ++Y   +N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TFIL++ E N   L+  N +L+K+ ++FP F LGRG++DL  +       +    +H  N   WD+ G+ LF++    + ++++ ++++    +++ I    K   +        ED DV  ER+R+ +     D+LR+  LTKIY                          AV+ LC GVR GECFGLLGVNGAGKTTTF
Sbjct:  319 LSDLLCGYPEGGGSRVLSFNWYEDNNYKAFLG--IDSTRKDPIYSYDRRTTSFCNALIQSLESNPLTKI-AWRAAKPLLMGKILYTPDSPAARRILKNANSTFEELEHVRKLVKAWEEVGPQIWYFFDNSTQMNMIRDTLGNPTVKDFLNRQLGEEGITAEAILNFLYKGPRESQADDMAN-FDWRDIFNITDRTLRLVNQYLECLVLDKF---ESYNDETQLTQRALSLLEENMFWAGVVFPDMYPW-TSSLPPHVKYKIRMDIDVVEKTNKIK--DRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGITRSQVQAEA-PVGIYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMSMSIFLLTIFIMHGRILHYSDPFILFLFLLAFSTATIMLCFLLSTFFSKASLAAACSGVIYFTLYLPHILCFAWQDRMTAELKKAVSLLSPVAFGFGTEYLVRFEEQGLGLQWSNIGNSPTEGDEFSFLLSMQMMLLDAAVYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEPLTEETEDPEHPEGIHDSFFEREHPGWVPGVCVKNLVKIFEPCGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLVGGRDIETSLDAVRQSLGMCPQHNILFHHLTVAEHMLFYAQLKGKSQEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLLKYRS-GRTIIMSTHHMDEADLLGDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVNPRHPCLGPREKAGQTPQDSNVCSPGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWIYGQQY------TFFSMDEPGSEQFTVLADVLLNKPG-FGNRCLKEGW--LPEYPC--GNSTPWKTPSVSPNITQLFQKQKWTQVNPSPSCRCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPVVPIT---GEALVG---FLSDLGRIMNVSGGPITREASKEIPDFLKHLETEDNI--------KVWFNNKGWHALVSFLNVAHNAILRASLPKDRSPE-EYGITVISQPLNLTKEQLSEITVLTTS--VDAVVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFENNRTLLR-FNAVLRKLLIVFPHFCLGRGLIDLALSQAVTDVYARFGEEHSANPFHWDLIGKNLFAMVVEGVVYFLLTLLVQRHFFLSQWIAEPTKEPIVD-------EDDDVAEERQRIITGGNKTDILRLHELTKIY--------------------PGTSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTF 1982          

HSP 2 Score: 189.119 bits (479), Expect = 2.941e-47
Identity = 105/310 (33.87%), Postives = 164/310 (52.90%), Query Frame = 1
Query: 1966 VGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            +G  +  M+++  +Y L+T  V+  F           FL   S W   I      P++  ++   E   +       N    + +H L K+YP    P ++ L +     +    LG NGAGKTTT  +LTG  + +SG A +  + I T +  + Q +G CPQ++ + + LT  +H+Y Y  L+ +   EIE V    IK + LT   + L+   SGG KRKLS A+A IG   +V LDEPT G+DP ARR +W++++      R ++LT+H M+E + L  R+AI+ +G  +C G++  LK KFG+GY
Sbjct: 1875 IGKNLFAMVVEGVVYFLLTLLVQRHF-----------FL---SQW---IAEPTKEPIVDEDDDVAEERQRIITGG--NKTDILRLHELTKIYPGTSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTNISEVHQNMGYCPQFDAIDELLTGREHLYLYARLRGVPAEEIEKVANWSIKSLGLTVYADCLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNVIVSIIREGRAVVLTSHSMEECEALCTRLAIMVKGAFRCMGTIQHLKSKFGDGY 2165          

HSP 3 Score: 57.3806 bits (137), Expect = 3.161e-7
Identity = 26/77 (33.77%), Postives = 42/77 (54.55%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            Q++ LLWKN+ L++R+    ++EL  PL +  +L  +R++   Y    C F  K M S G +P+L    C  N  C+
Sbjct:    6 QIQLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNANPLYSHHECHFPNKAMPSAGMLPWLQGIFCNVNNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Human
Match: ABCA12 (ATP binding cassette subfamily A member 12 [Source:HGNC Symbol;Acc:HGNC:14637])

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 494/1615 (30.59%), Postives = 813/1615 (50.34%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---------RLHFQTFLLDYISN---NVFINDVKKFCKAYYSANP-KICDAVNTL-FNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTF--------------LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP-----------LMRNNNQNCEINH---QAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLK--RMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXX--XXXILKFVKIYIADARMMEESRLQWTIVLPQNDIN-SRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-NKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLL------KGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISL-GLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVS-PECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTIS---TFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDL--------FFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVN--RIICGKLKNSYLKRIEIRNT--EDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            ++  L P++ G++ Y P   + + I+EK+N+T + L  LR  S EW           H     +  + N   N F+    KF     +    K  D ++ L   + N    ID ++ L S      +C   DR   + + K ID++  ++ R + +  +F     +  P N ++              + Y IR+ L    +T   +   + W P P  N+ +  +     FI+LQ++I++A IEL T   S E+   +  +PYPC++ D FL  ++  LP +L++AW   +   +K +VYEK+ RL EYMK+MG+N+  H+ +W I ++  L++ +VI+ + L+   I   ++  ++F     Y  S I  ++++SVFF+  N+A++ G ++Y   +  F+V + +E ELS  +     LLS  AFS A +++  +E+   G+Q+ N++ +P +      G    L++ DSFIY LI WYV  VFPG YG+A PW F    SYW      +E  P           +M+N N +    +      E EP++L +G+++H + K+Y S     ++NLNLNFYE  IT+ LG NGAGKTTTIS+LTG+F  S+GT ++  +DI+T++ ++R+ +G+C Q++VLF  LT ++H+  YG +K     K ++   + R +KD  L    +     LSGGMKRKLSI++A IG SRVV LDEP+ GVDP +RR IWD++ K ++  RTIIL+THH+DEA+ LSDR+A + QG L+CCGS  +LK  FG+GY+L+L K ++ + N+N       +   ++ ++ +A + E+   +   VLP      S  +  L + LD  M +++I  YG+SDT++EEVFL +  +   N  ++ E          L  K   N+    I    +     S F D+ D +L       GF LL ++I+A+ IKR+H+ +R++KG +A++ILP++ +   +    +         +QISP L     G      FY   + S   L++ +      D       C+N S     + QC  ++    W+ +     P+ +   C CS+   Q C       P   +R   SS  + NLTG  + +YL+    +  +K YGG+ F LP T              ++LR  +    AN                          +  ++W + +GY S+PAY N  +N LLR  ++K       +GI + + P    Q  +   + +  ++++ +A+ ++ G S   ASFV ++V E  + +K+ Q +SGI    YWV+NF++D++ Y++P+   I I   F   ++    N  A  LLL+ +G A    MY  +        AF+     NL  G  + +S    + L   + N   L+ I++ LK++FLIFPQF  G G+++L        F   +      V++     + +  G    +L S    ++ + ++I   ++   R+   K  +S+     +R T  ED DV  ER R+ S     D++++  LTK Y +  K                  + +AVNN+  G+  GECFGLLGVNGAGKTT F
Sbjct:  479 IWAFLKPMLLGRILYAPYNPVTKAIMEKSNVTLRQLAELREKSQEWMDKSPLFMNSFHLLNQAIPMLQNTLRNPFVQVFVKFSVGLDAVELLKQIDELDILRLKLENNIDIIDQLNTLSSLTVNISSCVLYDR---IQAAKTIDEMEREAKRLYKSNELFGSVI-FKLPSNRSWHRGYDSGNVFLPPVIKYTIRMSLKTAQTTRSLRT--KIWAPGPH-NSPSHNQIYGRAFIYLQDSIERAIIELQTGRNSQEIAVQVQAIPYPCFMKDNFLTSVSYSLPIVLMVAWVVFIAAFVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLIESVGFLLVTIVILIIILKFGNILPKTNGFILFLYFSDYSFSVIAMSYLISVFFNNTNIAALIGSLIYIIAFFPFIVLVTVENELSYVLKVFMSLLSPTAFSYASQYIARYEEQGIGLQWENMYTSPVQDDTTSFGWLCCLILADSFIYFLIAWYVRNVFPGTYGMAAPWYFPILPSYWKERFGCAEVKPEKSNGLMFTNIMMQNTNPSASPEYMFSSNIEPEPKDLTVGVALHGVTKIYGSKV--AVDNLNLNFYEGHITSLLGPNGAGKTTTISMLTGLFGASAGTIFVYGKDIKTDLHTVRKNMGVCMQHDVLFSYLTTKEHLLLYGSIKVPHWTKKQLHEEVKRTLKDTGLYSHRHKRVGTLSGGMKRKLSISIALIGGSRVVILDEPSTGVDPCSRRSIWDVISKNKT-ARTIILSTHHLDEAEVLSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKKKSPNLNANAVCDTMAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDNGMGDLNIGCYGISDTTVEEVFLNLTKESQKNSAMSLEH---------LTQKKIGNSNANGISTPDDLSVSSSNFTDRDDKILTRGERLDGFGLLLKKIMAILIKRFHHTRRNWKGLIAQVILPIVFVTTAMGLGTLRNSSNSYPEIQISPSLY----GTSEQTAFYANYHPSTEALVSAMW-----DFPGIDNMCLNTS-----DLQCLNKDSLEKWNTSGE---PITNFGVCSCSEN-VQECPKFNYSPP---HRRTYSSQVIYNLTGQRVENYLISTANEFVQKRYGGWSFGLPLT--------------KDLRFDITGVPANR-------------------------TLAKVWYDPEGYHSLPAYLNSLNNFLLRVNMSKYDAA--RHGIIMYSHPYPGVQDQEQATISS--LIDILVALSILMGYSVTTASFVTYVVREHQTKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAFSIGIIAIFKLPAFYSENNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELSQQQSVLDFLKAYG-----VEYPNETFEMNKLGAMFVALVSQGTMFFSLRLLINESLIKKLRLFFRKFNSSH-----VRETIDEDEDVRAERLRVESGAAEFDLVQLYCLTKTYQLIHK------------------KIIAVNNISIGIPAGECFGLLGVNGAGKTTIF 1982          

HSP 2 Score: 176.407 bits (446), Expect = 2.060e-43
Identity = 107/324 (33.02%), Postives = 177/324 (54.63%), Query Frame = 1
Query: 2212 ISIHNLVKLYP--SNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIR-TEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTE-KINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + ++ L K Y     KI  +NN+++     +    LG NGAGKTT   +LTG   PSSG   I N+      +DS    +G CPQ + L D +TVE+H+YFY  +  + + +I+  + ++++ + L   K  A SM  S G KRKLS A+A IG   ++ LDEP++G+DP ++R +W ++ +   +  ++ILT+H M+E + L  R+AI+  GK QC GSL  +K +FG G+ + +    N  +         L F K Y+ D  +   S L++ +      + +     +F  L+ +   ++I ++ +S T+LEEVF+  A D
Sbjct: 1936 VQLYCLTKTYQLIHKKIIAVNNISIGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKETVHKLLRRLHLMPFKDRATSM-CSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKRHLWKIISEEVQNKCSVILTSHSMEECEALCTRLAIMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTMETLTKFMQLHFPKTYLKDQHL---SMLEYHV-----PVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2250          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Human
Match: ABCA12 (ATP binding cassette subfamily A member 12 [Source:HGNC Symbol;Acc:HGNC:14637])

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 497/1619 (30.70%), Postives = 816/1619 (50.40%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---------RLHFQTFLLDYISN---NVFINDVKKFCKAYYSANP-KICDAVNTL-FNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTF--------------LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP-----------LMRNNNQNCEINH---QAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLK--RMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXX--XXXILKFVKIYIADARMMEESRLQWTIVLPQNDIN-SRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-NKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLL------KGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISL-GLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVS-PECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPI----EMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTIS---TFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDL--------FFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVN--RIICGKLKNSYLKRIEIRNT--EDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            ++  L P++ G++ Y P   + + I+EK+N+T + L  LR  S EW           H     +  + N   N F+    KF     +    K  D ++ L   + N    ID ++ L S      +C   DR   + + K ID++  ++ R + +  +F     +  P N ++              + Y IR+ L    +T   +   + W P P  N+ +  +     FI+LQ++I++A IEL T   S E+   +  +PYPC++ D FL  ++  LP +L++AW   +   +K +VYEK+ RL EYMK+MG+N+  H+ +W I ++  L++ +VI+ + L+   I   ++  ++F     Y  S I  ++++SVFF+  N+A++ G ++Y   +  F+V + +E ELS  +     LLS  AFS A +++  +E+   G+Q+ N++ +P +      G    L++ DSFIY LI WYV  VFPG YG+A PW F    SYW      +E  P           +M+N N +    +      E EP++L +G+++H + K+Y S     ++NLNLNFYE  IT+ LG NGAGKTTTIS+LTG+F  S+GT ++  +DI+T++ ++R+ +G+C Q++VLF  LT ++H+  YG +K     K ++   + R +KD  L    +     LSGGMKRKLSI++A IG SRVV LDEP+ GVDP +RR IWD++ K ++  RTIIL+THH+DEA+ LSDR+A + QG L+CCGS  +LK  FG+GY+L+L K ++ + N+N       +   ++ ++ +A + E+   +   VLP      S  +  L + LD  M +++I  YG+SDT++EEVFL +  +   N  ++ E          L  K   N+    I    +     S F D+ D +L       GF LL ++I+A+ IKR+H+ +R++KG +A++ILP++ +   +    +         +QISP L     G      FY   + S   L++ +      D       C+N S     + QC  ++    W+ +     P+ +   C CS+   Q C       P   +R   SS  + NLTG  + +YL+    +  +K YGG+ F LP T              ++LR  +    AN                          +  ++W + +GY S+PAY N  +N LLR  ++K       +GI + + P     + EQ+T     ++ +I ++ +A+ ++ G S   ASFV ++V E  + +K+ Q +SGI    YWV+NF++D++ Y++P+   I I   F   ++    N  A  LLL+ +G A    MY  +        AF+     NL  G  + +S    + L   + N   L+ I++ LK++FLIFPQF  G G+++L        F   +      V++     + +  G    +L S    ++ + ++I   ++   R+   K  +S+     +R T  ED DV  ER R+ S     D++++  LTK Y +  K                  + +AVNN+  G+  GECFGLLGVNGAGKTT F
Sbjct:  797 IWAFLKPMLLGRILYAPYNPVTKAIMEKSNVTLRQLAELREKSQEWMDKSPLFMNSFHLLNQAIPMLQNTLRNPFVQVFVKFSVGLDAVELLKQIDELDILRLKLENNIDIIDQLNTLSSLTVNISSCVLYDR---IQAAKTIDEMEREAKRLYKSNELFGSVI-FKLPSNRSWHRGYDSGNVFLPPVIKYTIRMSLKTAQTTRSLRT--KIWAPGPH-NSPSHNQIYGRAFIYLQDSIERAIIELQTGRNSQEIAVQVQAIPYPCFMKDNFLTSVSYSLPIVLMVAWVVFIAAFVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLIESVGFLLVTIVILIIILKFGNILPKTNGFILFLYFSDYSFSVIAMSYLISVFFNNTNIAALIGSLIYIIAFFPFIVLVTVENELSYVLKVFMSLLSPTAFSYASQYIARYEEQGIGLQWENMYTSPVQDDTTSFGWLCCLILADSFIYFLIAWYVRNVFPGTYGMAAPWYFPILPSYWKERFGCAEVKPEKSNGLMFTNIMMQNTNPSASPEYMFSSNIEPEPKDLTVGVALHGVTKIYGSKV--AVDNLNLNFYEGHITSLLGPNGAGKTTTISMLTGLFGASAGTIFVYGKDIKTDLHTVRKNMGVCMQHDVLFSYLTTKEHLLLYGSIKVPHWTKKQLHEEVKRTLKDTGLYSHRHKRVGTLSGGMKRKLSISIALIGGSRVVILDEPSTGVDPCSRRSIWDVISKNKTA-RTIILSTHHLDEAEVLSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKKKSPNLNANAVCDTMAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDNGMGDLNIGCYGISDTTVEEVFLNLTKESQKNSAMSLEH---------LTQKKIGNSNANGISTPDDLSVSSSNFTDRDDKILTRGERLDGFGLLLKKIMAILIKRFHHTRRNWKGLIAQVILPIVFVTTAMGLGTLRNSSNSYPEIQISPSLY----GTSEQTAFYANYHPSTEALVSAMW-----DFPGIDNMCLNTS-----DLQCLNKDSLEKWNTSGE---PITNFGVCSCSE-NVQECPKFNYSPP---HRRTYSSQVIYNLTGQRVENYLISTANEFVQKRYGGWSFGLPLT--------------KDLRFDITGVPANR-------------------------TLAKVWYDPEGYHSLPAYLNSLNNFLLRVNMSKYDAA--RHGIIMYSHPYPGVQDQEQAT-----ISSLI-DILVALSILMGYSVTTASFVTYVVREHQTKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAFSIGIIAIFKLPAFYSENNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELSQQQSVLDFLKAYG-----VEYPNETFEMNKLGAMFVALVSQGTMFFSLRLLINESLIKKLRLFFRKFNSSH-----VRETIDEDEDVRAERLRVESGAAEFDLVQLYCLTKTYQLIHK------------------KIIAVNNISIGIPAGECFGLLGVNGAGKTTIF 2300          

HSP 2 Score: 176.792 bits (447), Expect = 1.903e-43
Identity = 107/324 (33.02%), Postives = 177/324 (54.63%), Query Frame = 1
Query: 2212 ISIHNLVKLYP--SNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIR-TEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTE-KINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + ++ L K Y     KI  +NN+++     +    LG NGAGKTT   +LTG   PSSG   I N+      +DS    +G CPQ + L D +TVE+H+YFY  +  + + +I+  + ++++ + L   K  A SM  S G KRKLS A+A IG   ++ LDEP++G+DP ++R +W ++ +   +  ++ILT+H M+E + L  R+AI+  GK QC GSL  +K +FG G+ + +    N  +         L F K Y+ D  +   S L++ +      + +     +F  L+ +   ++I ++ +S T+LEEVF+  A D
Sbjct: 2254 VQLYCLTKTYQLIHKKIIAVNNISIGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKETVHKLLRRLHLMPFKDRATSM-CSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKRHLWKIISEEVQNKCSVILTSHSMEECEALCTRLAIMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTMETLTKFMQLHFPKTYLKDQHL---SMLEYHV-----PVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2568          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 386.726 bits (992), Expect = 7.278e-109
Identity = 233/620 (37.58%), Postives = 361/620 (58.23%), Query Frame = 1
Query: 1006 NCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLT------PKNTT----FLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQ 2835
             C  LDRF  +   K+++  TN         +   +T QY T        N T    F +Y+IR     +DST  F  +D    P+ R     D KY+  GF FLQE+ID+A +  +TN     +G      PYPC + D F   +A  +P  L++++     +L+K+IVYEKE ++KE M+ MGL + VH++SW + ++V+  I V+I+S+  +++KI   +   ++  V+  ++ S I  +   S  F+ AN+A+ +  +L+F F++ F + ++ +   S T      +L   A  +  K +  +  + E   +S+L++     L   V  C+I++++D+ ++L++ WY+ AV PG +GV +P  F     YW   +  +  +  + + + +   N  +F+SEP NL L + I+++ K+Y  N    ++ LNL  YE QIT  LGHNGAGKTTT+SIL G+++PSSGTA I   DIRT++  +R  +G+CPQ+NVLF  LTV + +  +  LK +  +E+ S +  I+  V LTEK N L+  LSGGMKR+L I +AFIG SR V LDEPTAGVD  AR+ IW LL + +   RTI+L+THHMDEAD LSDR+AI+SQ
Sbjct:  534 GCFLLDRFRFVTDEKELE--TN--------AVCLMDTHQYFTGIVFNIDSNATEFDGFTTYKIRHYPEMVDSTTSF--MDSKSNPFSRDKPLIDLKYITFGFSFLQESIDRAIMSELTNQTDANLGVYAQQEPYPCTVKDTF--NVALFMPLFLLISFIFPSALLVKNIVYEKEQKIKEQMRAMGLGDAVHFISWGLISLVLNFISVLIISIISKVAKIFDYTDYTLLLFVLILFLFSSIAMSIFFSTLFTNANIATAATCVLWFVFFIPFQL-LRTDRISSPTFNRISLILPPTAMGHCFKLLESFNAM-ERATWSDLWEMNNPVLGISVELCMIMLVVDTAVFLILAWYISAVAPGDFGVRQPLWFPFTLKYWAPGLYKNR-VEFVDDEHFDTIPNSDSFDSEPTNLTLAVHINSMSKVY-ENGTKALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQRNK-EGRTILLSTHHMDEADVLSDRIAILSQ 1134          

HSP 2 Score: 148.673 bits (374), Expect = 2.074e-35
Identity = 73/228 (32.02%), Postives = 134/228 (58.77%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRT-EMDSIR--QKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEG 2892
            + NL K Y + ++  +  ++      +    LG NGAGKTTT ++LT    P  G+  + N  I T     +R  Q++G CPQ++ L   L+  +++ FY  ++ +   +I+S++ R++  + L    N  +  LSGG +RKLS+A+A +    ++FLDEP+AG+DP +++ +W ++ +     + ++LT+H M+E + L  R+AI+ +G+++C G    LK K+G+G
Sbjct: 1804 VRNLAKAY-NPELLAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSDVRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGKAVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKG 2030          

HSP 3 Score: 124.79 bits (312), Expect = 4.574e-28
Identity = 150/532 (28.20%), Postives = 244/532 (45.86%), Query Frame = 1
Query: 3835 MTSSDKLNNLTGYNISDY-LLKNFPKLSRK----LYGGFQFVLPSTFGWSSKLIGDSP--FWEELRDFVNASQA-NHNQSNLN--SLKFIDYLQKTFKIYGIKTSF---------TRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIF----VIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIC-SKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLG----RGIM--------DLFFNYFYNSNSIVKHEYNA-LQWDIAGEKLFSLFSLSIGWWIVLI---IIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSS---DQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            + ++D++ +LTG N++ + L+  F +L+        GGF     +    S   I  S   + E ++D   + +  N N + +   + K +D   +   +  +              ++W N+K +   P  +NI SN LLR      A+   D GI   N P+    S + LD  N +    +LA+F    ++  LS IPA F ++LVE+R+  +   Q V G+    YWV+++L+D++ Y + II+I++I++ F    +        AF+LL   +G++ I + Y F    S  + +FV++   +  VG +  ++  +L+ L V    L   + +   VFL+ PQ+NLG    RG+M          F       + I +    + L +D  G  +  LF   I   I LI   + E G V R     L ++ + R E    +D DV  ER+R+ +   D   +  L V NL K YN  L                     +AV  + F V  GECFGLLG+NGAGKTTTF
Sbjct: 1341 LNTTDRIFDLTGRNLTQFRLITRFAQLANTTAPFFLGGFSLGHVNQRAQSQADIDTSKRGWLETIKDIAQSMRIINLNTTGIEPATPKVLDPFAQNITLNQVVNDLLQNLDVRENVKVWFNNKIWPGFPIASNILSNALLRQEDY--AIDPEDLGILTMNHPMNKTIS-QTLD-QNALKFTQALAVFRITILLLVLSMIPAGFTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLGIAIFRGLMIYQVRAIGSNFLQQMNRPDMINQLPLPSLLAFDQMGIHIMCLFIHVIIATICLIFSQMDEFGFV-RKRERNLTDAMMLR-EPSTCDDEDVVKERQRVDAIPMDSSDNHALIVRNLAKAYNPEL---------------------LAVKGISFAVEPGECFGLLGLNGAGKTTTF 1845          

HSP 4 Score: 60.8474 bits (146), Expect = 1.223e-8
Identity = 42/144 (29.17%), Postives = 66/144 (45.83%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITE-------IYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYI 438
            QL  LLWK   ++RR+   L +EL VP I+  I+  VR+         C +  K M+S G +PF+  F C+F+  C      N   T  +E H    +  E       I +++   +L     ++WI +NP +F  L    + I
Sbjct:   44 QLNFLLWKCVLVRRRQKFWLAVELIVPCILFIIIALVRTKDFSEASPQCHYDSKGMLSAGVLPFIHSFFCSFSNRC------NAAPTTGDEKHFLFNDDGEHTRNESIIVDAIYYSSLQ----LRWIGNNPKKFEDLTKGAAEI 177          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 386.726 bits (992), Expect = 8.630e-109
Identity = 233/620 (37.58%), Postives = 361/620 (58.23%), Query Frame = 1
Query: 1006 NCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLT------PKNTT----FLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQ 2835
             C  LDRF  +   K+++  TN         +   +T QY T        N T    F +Y+IR     +DST  F  +D    P+ R     D KY+  GF FLQE+ID+A +  +TN     +G      PYPC + D F   +A  +P  L++++     +L+K+IVYEKE ++KE M+ MGL + VH++SW + ++V+  I V+I+S+  +++KI   +   ++  V+  ++ S I  +   S  F+ AN+A+ +  +L+F F++ F + ++ +   S T      +L   A  +  K +  +  + E   +S+L++     L   V  C+I++++D+ ++L++ WY+ AV PG +GV +P  F     YW   +  +  +  + + + +   N  +F+SEP NL L + I+++ K+Y  N    ++ LNL  YE QIT  LGHNGAGKTTT+SIL G+++PSSGTA I   DIRT++  +R  +G+CPQ+NVLF  LTV + +  +  LK +  +E+ S +  I+  V LTEK N L+  LSGGMKR+L I +AFIG SR V LDEPTAGVD  AR+ IW LL + +   RTI+L+THHMDEAD LSDR+AI+SQ
Sbjct:  497 GCFLLDRFRFVTDEKELE--TN--------AVCLMDTHQYFTGIVFNIDSNATEFDGFTTYKIRHYPEMVDSTTSF--MDSKSNPFSRDKPLIDLKYITFGFSFLQESIDRAIMSELTNQTDANLGVYAQQEPYPCTVKDTF--NVALFMPLFLLISFIFPSALLVKNIVYEKEQKIKEQMRAMGLGDAVHFISWGLISLVLNFISVLIISIISKVAKIFDYTDYTLLLFVLILFLFSSIAMSIFFSTLFTNANIATAATCVLWFVFFIPFQL-LRTDRISSPTFNRISLILPPTAMGHCFKLLESFNAM-ERATWSDLWEMNNPVLGISVELCMIMLVVDTAVFLILAWYISAVAPGDFGVRQPLWFPFTLKYWAPGLYKNR-VEFVDDEHFDTIPNSDSFDSEPTNLTLAVHINSMSKVY-ENGTKALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQRNK-EGRTILLSTHHMDEADVLSDRIAILSQ 1097          

HSP 2 Score: 148.673 bits (374), Expect = 2.220e-35
Identity = 73/228 (32.02%), Postives = 134/228 (58.77%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRT-EMDSIR--QKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEG 2892
            + NL K Y + ++  +  ++      +    LG NGAGKTTT ++LT    P  G+  + N  I T     +R  Q++G CPQ++ L   L+  +++ FY  ++ +   +I+S++ R++  + L    N  +  LSGG +RKLS+A+A +    ++FLDEP+AG+DP +++ +W ++ +     + ++LT+H M+E + L  R+AI+ +G+++C G    LK K+G+G
Sbjct: 1767 VRNLAKAY-NPELLAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSDVRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGKAVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKG 1993          

HSP 3 Score: 124.405 bits (311), Expect = 5.756e-28
Identity = 150/532 (28.20%), Postives = 244/532 (45.86%), Query Frame = 1
Query: 3835 MTSSDKLNNLTGYNISDY-LLKNFPKLSRK----LYGGFQFVLPSTFGWSSKLIGDSP--FWEELRDFVNASQA-NHNQSNLN--SLKFIDYLQKTFKIYGIKTSF---------TRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIF----VIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIC-SKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLG----RGIM--------DLFFNYFYNSNSIVKHEYNA-LQWDIAGEKLFSLFSLSIGWWIVLI---IIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSS---DQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            + ++D++ +LTG N++ + L+  F +L+        GGF     +    S   I  S   + E ++D   + +  N N + +   + K +D   +   +  +              ++W N+K +   P  +NI SN LLR      A+   D GI   N P+    S + LD  N +    +LA+F    ++  LS IPA F ++LVE+R+  +   Q V G+    YWV+++L+D++ Y + II+I++I++ F    +        AF+LL   +G++ I + Y F    S  + +FV++   +  VG +  ++  +L+ L V    L   + +   VFL+ PQ+NLG    RG+M          F       + I +    + L +D  G  +  LF   I   I LI   + E G V R     L ++ + R E    +D DV  ER+R+ +   D   +  L V NL K YN  L                     +AV  + F V  GECFGLLG+NGAGKTTTF
Sbjct: 1304 LNTTDRIFDLTGRNLTQFRLITRFAQLANTTAPFFLGGFSLGHVNQRAQSQADIDTSKRGWLETIKDIAQSMRIINLNTTGIEPATPKVLDPFAQNITLNQVVNDLLQNLDVRENVKVWFNNKIWPGFPIASNILSNALLRQEDY--AIDPEDLGILTMNHPMNKTIS-QTLD-QNALKFTQALAVFRITILLLVLSMIPAGFTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLGIAIFRGLMIYQVRAIGSNFLQQMNRPDMINQLPLPSLLAFDQMGIHIMCLFIHVIIATICLIFSQMDEFGFV-RKRERNLTDAMMLR-EPSTCDDEDVVKERQRVDAIPMDSSDNHALIVRNLAKAYNPEL---------------------LAVKGISFAVEPGECFGLLGLNGAGKTTTF 1808          

HSP 4 Score: 60.4622 bits (145), Expect = 1.327e-8
Identity = 42/144 (29.17%), Postives = 66/144 (45.83%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITE-------IYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYI 438
            QL  LLWK   ++RR+   L +EL VP I+  I+  VR+         C +  K M+S G +PF+  F C+F+  C      N   T  +E H    +  E       I +++   +L     ++WI +NP +F  L    + I
Sbjct:    7 QLNFLLWKCVLVRRRQKFWLAVELIVPCILFIIIALVRTKDFSEASPQCHYDSKGMLSAGVLPFIHSFFCSFSNRC------NAAPTTGDEKHFLFNDDGEHTRNESIIVDAIYYSSLQ----LRWIGNNPKKFEDLTKGAAEI 140          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Celegans
Match: abt-4 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q9TXV8])

HSP 1 Score: 378.252 bits (970), Expect = 1.664e-106
Identity = 233/668 (34.88%), Postives = 372/668 (55.69%), Query Frame = 1
Query: 1234 PRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNES--IEVGSSMHI--MPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYY---SCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVA-KPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLY--------------PSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRM--DKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            P  N      Y   GF+ +Q A+D A  E++T  ++    +  S  +   P+P Y   K ++  A  +P +++ ++  SV  +++++V EKE RLKEYM+VMGL+ F++WV+ FI     L   V+++++ +    +   S + ++F  +  Y    +   FM+S F + A  A++   + +   Y  +  F  ++      + Y   +C +   +A +  ++ +  +E   +G+++  LF  P        GH +I +I+D  I +++TWY+EAV PG  GV  KPW F    SYW  N   S+++       Q    +H   E EP +L   I++ NL K Y               S +   ++NLNL  Y  Q T  LGHNGAGK+TT S+LTG+ SPSSG+AY+ + DIRT +  IR+++GLCPQYN LF  +TV +H+ F+  LK    D  E   +L R+  D     K + ++  LSGG KRKLS+A+A IG S VV LDEPT+G+DP AR   W  LI+     RTI+LTTH M+EAD L DR+AI++ G+L+CCGS +FLK+++G+GY+L+++ +  +  + ++        ++ YI +A +      + T +L  +  +   F +LFK L+ H  +  I S+G+S T++EEVFLKV 
Sbjct:  256 PDDNDGGSPGYWQEGFMTVQRAVDVAITEIITGEDAQLTPLLDSYQVSRFPFPGYST-KIIEIGAFFMPVIVIFSFMTSVIYIVRAVVVEKEDRLKEYMRVMGLSQFINWVAHFIINYAKLTFAVIVLTILMHF--VALKSDMTLMFVFLMIYAFDVVYFAFMISSFMNSATSATLISVVFWMLLYFWYAFFSSIDQTNPYPLGYRLINC-INPDIALNYGLQLLAAYETQADGLKWGELFTPPSPDNNLTFGHALIALIVDGIIMIILTWYIEAVIPGGEGVPQKPW-FFVLPSYWFPN-SGSKTVDSSDQFQQIQYADHVKLEKEPTDLIPTINVVNLTKTYGTSFFKKLFDCKFGKSGEKRAVSNLNLKMYPGQCTVLLGHNGAGKSTTFSMLTGVASPSSGSAYVNDFDIRTSLPKIRREMGLCPQYNTLFGFMTVMEHLEFFAKLKERTWDPEEAREILARLRIDF----KADFMAGALSGGQKRKLSLAIALIGGSEVVMLDEPTSGMDPGARHETW-TLIQREKERRTILLTTHFMEEADLLGDRIAIMAHGQLECCGSPMFLKQQYGDGYHLTIVYDTTSTPDVSKTT----DIIREYIPEAHVFSYIGQEATYLL--SATHRPIFPKLFKELEDHQTQCGITSFGVSITTMEEVFLKVG 906          

HSP 2 Score: 159.458 bits (402), Expect = 1.134e-38
Identity = 99/325 (30.46%), Postives = 166/325 (51.08%), Query Frame = 1
Query: 2197 NLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            N K  +  +NLVK Y       +  +N +         LG NGAGKT+T  +LTG  S SSG AY+    ++          G CPQY+ +   ++ E+ +Y +  ++ + + +I   +  +I  + +    +      SGG KR+LS+ +A +G   V+ LDEPT+GVDP ARR IW++L + R     ++LT+H MDE + L   +AI+  GK +C GS   +K ++G GY L +     N +   ++       +K     + + EE  LQ    +P+   +   ++ LF+ L+     ++   Y LS T+LE+VF++ + D
Sbjct: 1445 NNKTALVSNNLVKWY--GNFNAVKGVNFHVNSKDCFGLLGVNGAGKTSTFQMLTGENSISSGDAYVNGWSVKNNWREAGANTGYCPQYDAIIKEMSGEETLYMFARIRGIPEKDIPKKVNAVIHAIGIGMYASRQIKTYSGGNKRRLSLGIAIVGLPDVLLLDEPTSGVDPKARRIIWNILNRLRDLGTALVLTSHSMDECEALCTELAIMVYGKFRCYGSCQHIKSRYGSGYTLLIRLKNRNDAEKTKST------IKQTFRGSVIKEEHVLQLNFDIPR---DGDSWSRLFEKLETVSTSLNWDDYSLSQTTLEQVFIEFSRD 1758          

HSP 3 Score: 83.1889 bits (204), Expect = 1.622e-15
Identity = 98/370 (26.49%), Postives = 160/370 (43.24%), Query Frame = 1
Query: 4327 LAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILL-LIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFIL-DILEVNYEYLKEINDILKKVFL-IFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDI------------AGEKLFSLFSLSIG------------------WWIVLIIIESGIVNR----IICGKLKN-----SYLKRIEIRNTEDFDVNLER---ERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            +A  +I   +   A +  FL+ ER   SK  Q +SGI P+++W++ F+WD   ++I I+    IF  F+  +Y      +  + L  + YG   +P  Y F FF  +    F+++  Y++L G I +I+  I+     ++  YL  I      +F  +FP +N+ + I  + F      N  V+     L   I            A E+L+    L +G                  +WI + + E+    +    I C K  N     +   +++ R+ ED DV  E+   +R++++ K+   L   NL K Y             G  N         AV  + F V   +CFGLLGVNGAGKT+TF
Sbjct: 1159 IAYGLIVSFAVCVAGYSQFLITERKKKSKHMQLLSGIRPWMFWLTAFIWDAAWFVIRILCFDAIFYIFNITAYTHDFGVMLILTLSFLLYGWTALPFTYWFQFFFESAPKGFMMVTMYHILTGMIGSIAVPIISQTSSLDAGYLWSI------IFAWLFPTYNISQ-IATVTFQ-----NENVRIACKKLDCTIPMFKAVTACCGTASERLYVDNVLFVGNRKGILVYVIFLAVQGFIYWIWVFMRENDQFTKLFALIRCRKADNPIWDITDTDKVDERDVEDSDVIAEKSVVQRLANNNKT--ALVSNNLVKWY-------------GNFN---------AVKGVNFHVNSKDCFGLLGVNGAGKTSTF 1492          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 219.935 bits (559), Expect = 3.177e-57
Identity = 175/627 (27.91%), Postives = 295/627 (47.05%), Query Frame = 1
Query: 1711 VSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGEL-SLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWY-VEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQ------------------------AFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLD--------------------QHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLL---------KGFPLLQQQIIALHIKRYHYAKRDFKGFLAE 3426
            V+ FF+  N  S    IL     M+ + + KL  EL  ++  +  GL    AF+ AV+ +  + +    +  +N+F +   SL F +G  +++MI+D      I W  + A+       +  ++    R+ + +     +         QN  IN Q                          +   +  +  I + NLVK++ +     ++ L+L     Q +  LGHNGAGK+TT S + GI  P++G   I   D+  E    R+ IG+CPQYN L+D LTV +H+     LK   + + +  + R++ DV L  K N  +++LSGGMKRKL + MA IG+S VV LDEPTAG+DP AR+ +  L+ + ++ +RTI+LTTH+MDEA+ L D V I+S GKL   G+  +LK+KFG GY   L    +++ +  +    +      Y+ +A   E    Q  I+LP+     ++F  LF+ L+                      +A + + S+GLS  +LE+VF+ + D     + +++ S  S+           NA++  +       Q  +K  D    L+          G   +  Q I++  K++ Y++R++     +
Sbjct:  354 VASFFNNTN--SAIKAILVAWGAMIGISY-KLRPELDQISSCFLYGLNINGAFALAVEAISDYMRRERELNLTNMFND--SSLHFSLGWALVMMIVD------ILWMSIGALVVDHIRTSADFSL---RTLFDFEAPEDDENQTDGVTAQNTRINEQMNPMASTSLNPPNADSDSLLEGSTEADGARDTARADIIVRNLVKIWSTTGERAVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVEREKA-NRTILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYL--LTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPE--ARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSR--------NASEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEKSGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 953          

HSP 2 Score: 148.288 bits (373), Expect = 2.872e-35
Identity = 102/325 (31.38%), Postives = 170/325 (52.31%), Query Frame = 1
Query: 2209 GISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSH-DRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEES-----RLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             + I +L K +   +   +N L L   + +    LG NGAGKTTT +ILTG    SSG A I   D+ TE+ SI    G CPQ++ L   LT  + +     +   +  + ++ L  I++ V +    + L    SGG KRK+S+ +A +  ++++ LDEPTAG+DP ARR +W+LL+  R H +  ++LT+H MDE + L  R+A++++G L   GS   LK  +G  Y                  + +++ V+  + ++ +   S      L+W I   + D  S KF E+ + L +   ++ +  + L+ +SLEE FL++A
Sbjct: 1363 ALVIKDLTKTF--GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRDV-TELISI----GYCPQFDALMLDLTGRESLEILAQMHGFENYKAKAEL--ILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNY------TMTLSLYEPNQRDMVVQLVQTRLPNSVLKTTSTNKTLNLKWQIPKEKEDCWSAKF-EMVQALAK---DLGVKDFILAQSSLEETFLRLA 1668          

HSP 3 Score: 112.849 bits (281), Expect = 1.595e-24
Identity = 90/352 (25.57%), Postives = 172/352 (48.86%), Query Frame = 1
Query: 4276 QSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIF-YGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFL-IFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDF--------DVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            +ST   +L+   ++++ LA  +I   + + ++FV+FL+EER      QQF++GI+P  ++ ++ ++D + Y +  +I + +F+AF +       + LA ++L  F Y  + +P +Y  SF   +PS A V+L  + +++     ++ F++ ++    E+LK    IL  +F+ + P +  G  I+ +      N+  ++      + WD  G+  + + +  +  + + ++++   V R +    +   ++R    N +           V+ ERER+      +  L + +LTK +                       R  AVN LC  V + ECFGLLGVNGAGKTTTF
Sbjct: 1094 KSTSNSNLLPSQLIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLK---SILVNIFMFLLPSYAFGSAIITI------NTYGMILPSEELMNWDHCGKNAWLMGTFGVCSFALFVLLQFKFVRRFLS---QVWTVRRSSHNNVQPMMGDLPVCESVSEERERVHRVNSQNSALVIKDLTKTF----------------------GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTF 1406          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 219.935 bits (559), Expect = 3.377e-57
Identity = 175/627 (27.91%), Postives = 295/627 (47.05%), Query Frame = 1
Query: 1711 VSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGEL-SLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWY-VEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQ------------------------AFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLD--------------------QHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLL---------KGFPLLQQQIIALHIKRYHYAKRDFKGFLAE 3426
            V+ FF+  N  S    IL     M+ + + KL  EL  ++  +  GL    AF+ AV+ +  + +    +  +N+F +   SL F +G  +++MI+D      I W  + A+       +  ++    R+ + +     +         QN  IN Q                          +   +  +  I + NLVK++ +     ++ L+L     Q +  LGHNGAGK+TT S + GI  P++G   I   D+  E    R+ IG+CPQYN L+D LTV +H+     LK   + + +  + R++ DV L  K N  +++LSGGMKRKL + MA IG+S VV LDEPTAG+DP AR+ +  L+ + ++ +RTI+LTTH+MDEA+ L D V I+S GKL   G+  +LK+KFG GY   L    +++ +  +    +      Y+ +A   E    Q  I+LP+     ++F  LF+ L+                      +A + + S+GLS  +LE+VF+ + D     + +++ S  S+           NA++  +       Q  +K  D    L+          G   +  Q I++  K++ Y++R++     +
Sbjct:  354 VASFFNNTN--SAIKAILVAWGAMIGISY-KLRPELDQISSCFLYGLNINGAFALAVEAISDYMRRERELNLTNMFND--SSLHFSLGWALVMMIVD------ILWMSIGALVVDHIRTSADFSL---RTLFDFEAPEDDENQTDGVTAQNTRINEQMNPMASTSLNPPNADSDSLLEGSTEADGARDTARADIIVRNLVKIWSTTGERAVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVEREKA-NRTILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYL--LTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPE--ARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSR--------NASEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEKSGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 953          

HSP 2 Score: 148.288 bits (373), Expect = 2.998e-35
Identity = 102/325 (31.38%), Postives = 170/325 (52.31%), Query Frame = 1
Query: 2209 GISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSH-DRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEES-----RLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             + I +L K +   +   +N L L   + +    LG NGAGKTTT +ILTG    SSG A I   D+ TE+ SI    G CPQ++ L   LT  + +     +   +  + ++ L  I++ V +    + L    SGG KRK+S+ +A +  ++++ LDEPTAG+DP ARR +W+LL+  R H +  ++LT+H MDE + L  R+A++++G L   GS   LK  +G  Y                  + +++ V+  + ++ +   S      L+W I   + D  S KF E+ + L +   ++ +  + L+ +SLEE FL++A
Sbjct: 1365 ALVIKDLTKTF--GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRDV-TELISI----GYCPQFDALMLDLTGRESLEILAQMHGFENYKAKAEL--ILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNY------TMTLSLYEPNQRDMVVQLVQTRLPNSVLKTTSTNKTLNLKWQIPKEKEDCWSAKF-EMVQALAK---DLGVKDFILAQSSLEETFLRLA 1670          

HSP 3 Score: 112.849 bits (281), Expect = 1.556e-24
Identity = 90/352 (25.57%), Postives = 172/352 (48.86%), Query Frame = 1
Query: 4276 QSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIF-YGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFL-IFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDF--------DVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            +ST   +L+   ++++ LA  +I   + + ++FV+FL+EER      QQF++GI+P  ++ ++ ++D + Y +  +I + +F+AF +       + LA ++L  F Y  + +P +Y  SF   +PS A V+L  + +++     ++ F++ ++    E+LK    IL  +F+ + P +  G  I+ +      N+  ++      + WD  G+  + + +  +  + + ++++   V R +    +   ++R    N +           V+ ERER+      +  L + +LTK +                       R  AVN LC  V + ECFGLLGVNGAGKTTTF
Sbjct: 1096 KSTSNSNLLPSQLIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLK---SILVNIFMFLLPSYAFGSAIITI------NTYGMILPSEELMNWDHCGKNAWLMGTFGVCSFALFVLLQFKFVRRFLS---QVWTVRRSSHNNVQPMMGDLPVCESVSEERERVHRVNSQNSALVIKDLTKTF----------------------GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTF 1408          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332489)

HSP 1 Score: 421.009 bits (1081), Expect = 7.567e-121
Identity = 227/646 (35.14%), Postives = 380/646 (58.82%), Query Frame = 1
Query: 1264 YVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLS-----KITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSS--ESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMN 3180
            Y+  GF+ LQ ++  A++   +  + +     M   P+P Y+ D  L+ +++++  ++++++    T + K I  EKE +LKE MK+MGL+N++HW +WF+ + ++L I  +++++ ++++      +   ++   +   +  Y++S IC  FM++ FFS+A+ A+   G+++F  Y+ +   I    +LSL+      L+S  A    +K ++ +E   EG+Q+SN F          +G  +I+M++   IY++I  YVE V PG +GV +PWNF   R +W    + +  E IP    N    + + +AFE+EPE   +G+ + +L K +  NK+ V+  L++N +E +IT  LGHNGAGKTTTIS+LTG+F P+SGTA I   DIRT ++  R  +G+CPQ+NVLFD ++V +HI F+  +K +    +E  + + +K ++L +K N  S  LSGGMKRKLS+  A  G+++VV  DEP++G+DP ARR +WDLL + +   RT++LTTH MDEAD L DR+AI+  G+L+C G+  FLK+++G GY              +     +   +  YI   +   +   + +  LP  D  S KF E+F  L++   E+ +  YG+  TS+EEVF+KV  +  N
Sbjct:  198 YLREGFLPLQHSLSMAYLRQKSGEQDLP-NVVMKRYPFPAYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTGLIWFIAYIPYSFTINSYDDLSLSSKLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIP----NGHVEQRDPKAFETEPEGKHIGLQMRHLKKRF-GNKM-VVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQQEKV-GRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGY------RLICVKRDDCETNEVTALLNKYIPGLKPECDIGAELSYQLP--DSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDN 827          

HSP 2 Score: 176.407 bits (446), Expect = 8.360e-44
Identity = 101/324 (31.17%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGE----------------------GYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             +N ++L   E +    LG NGAGKTTT  ++TG    SSG AY+    + + M+SI + IG CPQ++ L D LT  + +  + +L+ + ++ I  +   + K     + I+  +   SGG KRKLS A+A IG+  V++LDEPT G+DP ARR +W+++ + R   ++I+LT+H M+E + L  R+AI+  G+ +C GS   LK KF +                      GY  +  +       S R+ + + +FV+    ++ + EE +   T  +P   +   K++ +F  ++ +  ++++  Y +S T+LEE+FL+ A
Sbjct: 1361 AVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGV---KWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1681          

HSP 3 Score: 106.686 bits (265), Expect = 1.759e-22
Identity = 125/471 (26.54%), Postives = 213/471 (45.22%), Query Frame = 1
Query: 4009 RDFVNASQANHNQSNLNSLKFIDY---LQKTFKI-----YGIKTSFTR----IWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEY-LKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNAL-------------------QWDIAGEKLFSLFSLSIG--WWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTE---DFDVNLERER---MSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
             D   +  +N+      +  F DY   L KT ++     Y +  + T      W N++   + P   N+  N +       S+VK     I V+N P+    ST    L     L   LA  + F + F+ + +++FL++ER S +K  QFV G+  + +W+S F+ D   YI+  +I++I  + F             + LLL+ +G A++P +Y  S F   P+T F  ++  N+  G    ++ FI+ ++  +  +  K+  DIL  +F IFP F+L   +  ++ N     N+  K    AL                    W+  G    +++    G  +++++I++E  ++N ++  K++   + +     TE   D DV  ERER   MSS++ +   L +  +TK Y  ++                      AVN +   V+E ECFGLLGVNGAGKTTTF
Sbjct:  956 EDLARSYGSNYGLELTGTQGFEDYILDLGKTIQVRINSRYLVAATITESKITAWLNNQALHTAPLTVNMVHNAIADKLF-GSSVK-----IQVTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCG----MALFIVVVVMSSELFDTKDTADILGWIFRIFPHFSLAMSLNKVYTNT-ATRNACAKA--GALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINELMF-KIRQ-LISKPPPPPTEGQLDDDVANERERILQMSSNELATKNLVLDRVTKYYGQFM----------------------AVNQVSLCVQEVECFGLLGVNGAGKTTTF 1389          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332488)

HSP 1 Score: 421.394 bits (1082), Expect = 8.258e-121
Identity = 227/646 (35.14%), Postives = 380/646 (58.82%), Query Frame = 1
Query: 1264 YVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLS-----KITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSS--ESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMN 3180
            Y+  GF+ LQ ++  A++   +  + +     M   P+P Y+ D  L+ +++++  ++++++    T + K I  EKE +LKE MK+MGL+N++HW +WF+ + ++L I  +++++ ++++      +   ++   +   +  Y++S IC  FM++ FFS+A+ A+   G+++F  Y+ +   I    +LSL+      L+S  A    +K ++ +E   EG+Q+SN F          +G  +I+M++   IY++I  YVE V PG +GV +PWNF   R +W    + +  E IP    N    + + +AFE+EPE   +G+ + +L K +  NK+ V+  L++N +E +IT  LGHNGAGKTTTIS+LTG+F P+SGTA I   DIRT ++  R  +G+CPQ+NVLFD ++V +HI F+  +K +    +E  + + +K ++L +K N  S  LSGGMKRKLS+  A  G+++VV  DEP++G+DP ARR +WDLL + +   RT++LTTH MDEAD L DR+AI+  G+L+C G+  FLK+++G GY              +     +   +  YI   +   +   + +  LP  D  S KF E+F  L++   E+ +  YG+  TS+EEVF+KV  +  N
Sbjct:  198 YLREGFLPLQHSLSMAYLRQKSGEQDLP-NVVMKRYPFPAYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTGLIWFIAYIPYSFTINSYDDLSLSSKLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIP----NGHVEQRDPKAFETEPEGKHIGLQMRHLKKRF-GNKM-VVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQQEKV-GRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGY------RLICVKRDDCETNEVTALLNKYIPGLKPECDIGAELSYQLP--DSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDN 827          

HSP 2 Score: 176.792 bits (447), Expect = 7.750e-44
Identity = 101/324 (31.17%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGE----------------------GYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             +N ++L   E +    LG NGAGKTTT  ++TG    SSG AY+    + + M+SI + IG CPQ++ L D LT  + +  + +L+ + ++ I  +   + K     + I+  +   SGG KRKLS A+A IG+  V++LDEPT G+DP ARR +W+++ + R   ++I+LT+H M+E + L  R+AI+  G+ +C GS   LK KF +                      GY  +  +       S R+ + + +FV+    ++ + EE +   T  +P   +   K++ +F  ++ +  ++++  Y +S T+LEE+FL+ A
Sbjct: 1361 AVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGV---KWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1681          

HSP 3 Score: 106.686 bits (265), Expect = 1.650e-22
Identity = 125/471 (26.54%), Postives = 213/471 (45.22%), Query Frame = 1
Query: 4009 RDFVNASQANHNQSNLNSLKFIDY---LQKTFKI-----YGIKTSFTR----IWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEY-LKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNAL-------------------QWDIAGEKLFSLFSLSIG--WWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTE---DFDVNLERER---MSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
             D   +  +N+      +  F DY   L KT ++     Y +  + T      W N++   + P   N+  N +       S+VK     I V+N P+    ST    L     L   LA  + F + F+ + +++FL++ER S +K  QFV G+  + +W+S F+ D   YI+  +I++I  + F             + LLL+ +G A++P +Y  S F   P+T F  ++  N+  G    ++ FI+ ++  +  +  K+  DIL  +F IFP F+L   +  ++ N     N+  K    AL                    W+  G    +++    G  +++++I++E  ++N ++  K++   + +     TE   D DV  ERER   MSS++ +   L +  +TK Y  ++                      AVN +   V+E ECFGLLGVNGAGKTTTF
Sbjct:  956 EDLARSYGSNYGLELTGTQGFEDYILDLGKTIQVRINSRYLVAATITESKITAWLNNQALHTAPLTVNMVHNAIADKLF-GSSVK-----IQVTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCG----MALFIVVVVMSSELFDTKDTADILGWIFRIFPHFSLAMSLNKVYTNT-ATRNACAKA--GALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINELMF-KIRQ-LISKPPPPPTEGQLDDDVANERERILQMSSNELATKNLVLDRVTKYYGQFM----------------------AVNQVSLCVQEVECFGLLGVNGAGKTTTF 1389          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0306679)

HSP 1 Score: 421.394 bits (1082), Expect = 8.628e-121
Identity = 227/646 (35.14%), Postives = 380/646 (58.82%), Query Frame = 1
Query: 1264 YVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLS-----KITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSS--ESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMN 3180
            Y+  GF+ LQ ++  A++   +  + +     M   P+P Y+ D  L+ +++++  ++++++    T + K I  EKE +LKE MK+MGL+N++HW +WF+ + ++L I  +++++ ++++      +   ++   +   +  Y++S IC  FM++ FFS+A+ A+   G+++F  Y+ +   I    +LSL+      L+S  A    +K ++ +E   EG+Q+SN F          +G  +I+M++   IY++I  YVE V PG +GV +PWNF   R +W    + +  E IP    N    + + +AFE+EPE   +G+ + +L K +  NK+ V+  L++N +E +IT  LGHNGAGKTTTIS+LTG+F P+SGTA I   DIRT ++  R  +G+CPQ+NVLFD ++V +HI F+  +K +    +E  + + +K ++L +K N  S  LSGGMKRKLS+  A  G+++VV  DEP++G+DP ARR +WDLL + +   RT++LTTH MDEAD L DR+AI+  G+L+C G+  FLK+++G GY              +     +   +  YI   +   +   + +  LP  D  S KF E+F  L++   E+ +  YG+  TS+EEVF+KV  +  N
Sbjct:  220 YLREGFLPLQHSLSMAYLRQKSGEQDLP-NVVMKRYPFPAYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTGLIWFIAYIPYSFTINSYDDLSLSSKLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIP----NGHVEQRDPKAFETEPEGKHIGLQMRHLKKRF-GNKM-VVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQQEKV-GRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGY------RLICVKRDDCETNEVTALLNKYIPGLKPECDIGAELSYQLP--DSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDN 849          

HSP 2 Score: 176.407 bits (446), Expect = 8.315e-44
Identity = 101/324 (31.17%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGE----------------------GYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             +N ++L   E +    LG NGAGKTTT  ++TG    SSG AY+    + + M+SI + IG CPQ++ L D LT  + +  + +L+ + ++ I  +   + K     + I+  +   SGG KRKLS A+A IG+  V++LDEPT G+DP ARR +W+++ + R   ++I+LT+H M+E + L  R+AI+  G+ +C GS   LK KF +                      GY  +  +       S R+ + + +FV+    ++ + EE +   T  +P   +   K++ +F  ++ +  ++++  Y +S T+LEE+FL+ A
Sbjct: 1383 AVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGV---KWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1703          

HSP 3 Score: 106.686 bits (265), Expect = 1.813e-22
Identity = 125/471 (26.54%), Postives = 213/471 (45.22%), Query Frame = 1
Query: 4009 RDFVNASQANHNQSNLNSLKFIDY---LQKTFKI-----YGIKTSFTR----IWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEY-LKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNAL-------------------QWDIAGEKLFSLFSLSIG--WWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTE---DFDVNLERER---MSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
             D   +  +N+      +  F DY   L KT ++     Y +  + T      W N++   + P   N+  N +       S+VK     I V+N P+    ST    L     L   LA  + F + F+ + +++FL++ER S +K  QFV G+  + +W+S F+ D   YI+  +I++I  + F             + LLL+ +G A++P +Y  S F   P+T F  ++  N+  G    ++ FI+ ++  +  +  K+  DIL  +F IFP F+L   +  ++ N     N+  K    AL                    W+  G    +++    G  +++++I++E  ++N ++  K++   + +     TE   D DV  ERER   MSS++ +   L +  +TK Y  ++                      AVN +   V+E ECFGLLGVNGAGKTTTF
Sbjct:  978 EDLARSYGSNYGLELTGTQGFEDYILDLGKTIQVRINSRYLVAATITESKITAWLNNQALHTAPLTVNMVHNAIADKLF-GSSVK-----IQVTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCG----MALFIVVVVMSSELFDTKDTADILGWIFRIFPHFSLAMSLNKVYTNT-ATRNACAKA--GALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINELMF-KIRQ-LISKPPPPPTEGQLDDDVANERERILQMSSNELATKNLVLDRVTKYYGQFM----------------------AVNQVSLCVQEVECFGLLGVNGAGKTTTF 1411          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Fly
Match: CG6052 (gene:FBgn0036747 transcript:FBtr0075195)

HSP 1 Score: 382.874 bits (982), Expect = 4.144e-108
Identity = 224/648 (34.57%), Postives = 369/648 (56.94%), Query Frame = 1
Query: 1264 YVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIM--PYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITA------MSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLL-SQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEP--ENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNE-IESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            Y+  GF+ +Q A+  +++ L +      +  ++H+   PY  Y  D+ L  L  LLPF++++++    + + K +  EKE +LKE MK++G++N++HWV+WF+ + ++L++ VV + ++L + K  A       SS   V   +  YV++ +C  FM++V FSKA+ AS    I +F  Y+ +         LSL       L+ S  A    +  ++ WE   EG+ + N+F          + + I+ M   S +++ I  YVE VFPG+YGV + WNF+C ++YW   + S   +P  +       I H + +++      ++GI + NL K Y   K+  +  ++L  + ++IT  LGHNGAGKTTTI+++TGI  P+SGTA +   DIRT +   R+ +G+CPQ N+LF  ++V DHI F+  LK +   + +E+ + + +  + L +K    + +LSGGMKRKLS+  A  GN++VV  DEP++G+D   RR +WDLL +     RTI+LTTH+MDEAD L DR+AI+S+GKLQC G+  +LK++FG GY             S  +   + + ++ Y+   +       + T  LP     S+KF EL ++LD+  A++ ++ YGLS  +LE+VF+ V  D
Sbjct:  196 YIREGFLPIQHALTMSWLALASGVTDTGI-PAIHLQRFPYRAYTYDQLLSGLRQLLPFVILLSFIYPASTVTKYVTSEKELQLKEIMKLIGVHNWLHWVAWFVKSYIMLML-VVFLIMSLIMVKFYASVAVLTFSSWVPVLLFLHTYVVTSVCLCFMLAVLFSKASTASAVAAIFWFLTYIPYSFGYYYYERLSLMSKLLISLIFSNSALGFGIHVIVMWEGTGEGITWRNMFHPVSTDDSLTLFYIIMTMSFGSIMFISICLYVEQVFPGEYGVPRRWNFMCHKNYWRQYVPSLNIVPSFQT------ILHGSAKAKSCRRAREVGIQLFNLQKNY--GKLKAVKGISLKMHRNEITVLLGHNGAGKTTTINMITGIVKPTSGTAIVNGYDIRTHLAKARESLGICPQNNILFKEMSVRDHIIFFSKLKGIRGTKAVENEVGKYMTMLKLQDKSYVAAKNLSGGMKRKLSLCCALCGNAKVVLCDEPSSGIDAAGRRSLWDLL-QSEKDGRTILLTTHYMDEADVLGDRIAILSEGKLQCQGTSFYLKKRFGTGY------LLVCIMQSGCDVGAVTQLIRKYVPPIKPERVLGTELTYRLPTE--YSKKFAELLQDLDEKCAQLQLVGYGLSGATLEDVFMAVNTD 824          

HSP 2 Score: 157.147 bits (396), Expect = 7.253e-38
Identity = 100/335 (29.85%), Postives = 170/335 (50.75%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------XXXXXXXXXXXXXXILK---FVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             +  ++ +   ++    LG NGAGKT+T  +L G    +SG AYI   +I T    + +KIG CPQ++ LF+ LT  + +  Y LL+ + +  +  +   +       + ++  + H SGG +RKLS A++ +GN  V++LDEPT+G+DP ARR +W ++   R+  ++I+LT+H MDE + L  R+AI+  G+ +C GS+  LK +F +G  L +                                 Q      +   + ILK   F+   I DA + EE     T  +P    +S+  +++F+ L+ +  +++I  Y +  T LEE+FL  A
Sbjct: 1350 AVKAISFHVPHAECFGLLGINGAGKTSTFKMLAGDEKITSGEAYIDGTNISTH--KVYRKIGYCPQFDALFEDLTGRETLNIYCLLRGVQRRHVTPICWGLAISFGFAKHMDKQTKHYSGGNRRKLSTAISVLGNPSVLYLDEPTSGMDPAARRQLWQIIGLIRTAGKSIVLTSHSMDECEALCSRLAIMVDGEFKCLGSVQSLKNQFSKGLILKVKVKHKKKTFQRVVEDSSSSNDKKSISETDLKFLQMASVMESSQADRILKVNRFISKEIPDAELKEEYNGLITYYIP----HSKTLSKIFQLLETNSHKLNIEDYLIMQTRLEEIFLDFA 1678          

HSP 3 Score: 100.138 bits (248), Expect = 1.502e-20
Identity = 103/414 (24.88%), Postives = 182/414 (43.96%), Query Frame = 1
Query: 4129 IWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFI--DYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYE--YLKEINDILKKVFLIFPQFNLGRGIMDLFFNY-FYNSNSI--VKHEYNALQ---------------WDIAGEKLFSLFSLSIGWWI-VLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            +W N+K   + P   N+  N L        A+K +  D    V+N P+     T+ L L    +L   ++I +   + FI A + I ++ ER + +K  QF+SG++   YW S+ +WD + +++  +  I+   AF    YI   +   +  +L+ +G   I   Y  S   S  +T F  ++  N L+GT        L  + +N+E   LK++ + L   F + P ++L      +   Y      SI  ++     L+               W   G  +   + + +G  + +LI++    V  +I  KL N + KR  +        ++E + + ++Q+   V  +IN  +     L +K +          K    ++AV  + F V   ECFGLLG+NGAGKT+TF
Sbjct:  994 VWLNNKPLHTAPLTLNLLHNAL--------AIKLLGQDASTYVTNEPLPYSDDTRTLRLNKGQVLGAEISINLSLTMCFITAFYAIPIIRERETRAKLLQFLSGVDVCAYWTSHIVWDYLVFVLSALSSILTIAAFKEIGYITPLDLSRYFYMLLIFGFPGIMLSYAASGCFSDAATGFTRISIINTLMGT-----GLFLMFMTLNFEAFQLKDVAEKLAWYFRLSPHYSLASSTHSIHIGYNIRRGCSIGGIRKLPKQLRCRNVPICCDIPGYYGWRKPGVLVEITYMIMLGSTLFLLIVMHDAKVCNLIAEKLGNCFSKRKRVEG----GTSIENDSVVAEQRV--VREMINSGRKDVPLLVYKIS----------KRYRSKLAVKAISFHVPHAECFGLLGINGAGKTSTF 1378          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Fly
Match: CG42816 (gene:FBgn0261998 transcript:FBtr0307890)

HSP 1 Score: 276.944 bits (707), Expect = 6.581e-75
Identity = 196/593 (33.05%), Postives = 316/593 (53.29%), Query Frame = 1
Query: 1468 LIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRL----SKITAM--SSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKL---EGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQN--PGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESI-PLMRNNNQNCEINHQAFESEPENLKL----------GISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMN 3180
            L KSIV EKE +LK  + +MG+ + + WV+W+I T ++ +I   I+++  +L    S+I+ M  +  ++   V+       IC +F++S   S     S+   +     Y+ F++       EG L++ +        QV     V  +  WE   EG+Q+ NLF+   PG +L   VG+ +++MI+ SF+ LL+  Y+E + PG YGV +PW+F C R        S+ES+ P  R  N+   I   A + E  +L+L          G+ I  L K +   K+ V+ N++ + +E QIT  +GHNGAGKTT IS+L G  SP+SGTA I   DIR E    ++ IGLCPQ NVLF  L+   HI  +  L+ +   E++S +   +K ++L EK    + +LSGG +R+LS+A +  G  +V+  DEP+ G+DP ARR +W L+++ +    TI+LTTH +D+ + L DRV IIS G+L+C GSL FLK++                +    + E +   +  ++   +            LP +   S+ F+ LF++L+  M  + +  + LS  SLEE+F+    + +N
Sbjct:   82 LTKSIVEEKELQLKVTLNLMGVGSCLQWVAWYIQTFIIFLIGSSIITLFWKLVLPNSEISFMPFTHWSMALFVLLVLSHCTICFSFLMSSLISTTYRISLVTFLALIATYLPFLILHSKGCSEG-LNVFLSLFLLSGLQVL----VVGICMWEDYGEGLQWGNLFETSWPGGTL--SVGYILLVMILASFLSLLLCLYLEKIRPGPYGVPQPWHFPCTRCC------STESLLPYSRLFNRIFGIYSAAPDEERPDLQLIEPDPVDKIAGVQIRGLSKTF--GKMEVVKNVSFDMFEGQITVLMGHNGAGKTTLISMLAGFISPTSGTALINGFDIRQERRQAQRCIGLCPQQNVLFKHLSSVSHIQLFSRLRGLRGAEVKSEVQNYLKKLNLQEKKRLAARNLSGGTQRRLSVACSLCGGVKVLICDEPSTGLDPSARRELWRLILEAK-EGCTILLTTHQLDDGEVLGDRVVIISDGQLRCIGSLPFLKKQV------DASCLITCEARKRCDLEKLTSLISRHVGTIQPFSIKGRDVCYKLPLS--KSKYFSSLFRDLESQMNILGVRGFSLSSVSLEEIFMSFGAEDLN 650          

HSP 2 Score: 126.331 bits (316), Expect = 1.376e-28
Identity = 84/326 (25.77%), Postives = 158/326 (48.47%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINK 3195
            ++ + K Y  +++ V NN++     S     LG NGAGKTTT  ++ G  S   G  YI    +R + +   +++G CPQ +  F+ LT    +  + L+      ++     ++       + ++    + SGG KRK++ A+A   NS ++ LDEP+AGVDP +RR +W ++ +     + ++LT+H+MDE + L  +  I+  G +   GS+  +K K  +G     L       N       I   + +   +A + E+      +    +   S  ++E+F+ ++ + +   +  Y LS  SLE+ F ++A++   K  N+
Sbjct: 1138 VNGVSKKYGCDQLAV-NNISFALKPSHCVGLLGPNGAGKTTTFKMIVGEHSIDKGNIYISGYSMRMKRNKAMKELGYCPQSDSFFEFLTGRQLLKVFLLIWGFPSKDLNKRCEKLADQFGFRKHLDKKITYYSGGTKRKINAAVACGANS-LICLDEPSAGVDPASRRHVWTIINEVAQQGKAVLLTSHNMDEINALCSKSVILVDGSIYAMGSVQHVKNKIAKG-MTLKLVVNVQPDNMVAMLTKIEDDIYMTYPNAELKEKYEFSGRLTFQISKDTS--WSEIFEYVEGNRSSWHLEDYSLSQPSLEDAFEEIAEERRKKKSNQ 1458          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 882.478 bits (2279), Expect = 0.000e+0
Identity = 596/1752 (34.02%), Postives = 950/1752 (54.22%), Query Frame = 1
Query:  481 MSENETTIES-GYNELGEIICGSPE--------------NDFKLFMRNFIKNQRRKRSLLT------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSK-------LFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXX--------------------------------------XXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD-------------PMNKLINKEKSYYSYYCNILKMKLRINATKTEIF----LNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPMV--------SPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIY--GIKT-SFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIV--NRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            ++EN T   S  Y  +  I+CG PE              ++F+    N   +  +   +        C  + ++   + I +  ++  L PL+ GK+ Y P+    ++II + N TF+ L  LR     W    +  + +++ N+  ++ ++       +AN        T +++ +V S++   S+        F+W             I R + C  LD+  P+ +    +KL N+S      R F A I+F +      P N++ L    +Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ ++ + I  VT ++  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV ++IK +VYEKE+RLKE M++MGL+N + W SWFIS+++ L+I   ++ + L++  +   S   VVF  +  + +  I Q F++S  F++AN+A+  GGI+YFT Y+ +V+ +  +  +         LLS VAF    ++   +E+   G+Q++NLF +P E   + +  C+ILM  D+F+Y ++TWY+E VFPGQYG+ +PW F   +SYW     ++ +    + +N          E EP +LKLG+ I NLVK+Y   K   ++ L L F+E QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYI+ +DIR+E+ SIRQ +G+CPQ+NVLF  LTVE+HI+FY  LK + + E+++ + +I+ D  L  K  + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP+ARRGIWDLL+KYR+  RTI+L+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+                                          ++  + +  +   I + +  ++  ARM+E+   + T VLP     +  F ELF +LD  +A++ I SYG+SDT+LEE+FLKVA+D             P+ +   +  ++ + + + LK       T+ + F       +P+ K++ +L  SD    + +KG+ L +QQ +AL  KR  YA+R  KGF A+++LP + +   ++F  I     K   + ++PW+       E    F+ ++       +KL      D G  G RCM      + +  C   +E   WS    P SI++I           SP C+CS  G +     C     G PP   +I + ++ L NLTG NISDYL+K + ++  K            YGGF     ST     +++   P  EE+ D ++  +    Q   +S    D   K+   +  G+ T +  +IW N+KG+ S+ A+ N+ +N +LR+ L        ++GI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERV+ +K  QF+SG+ PY+YW++NFLWD+  Y++P  ++I+IF+ F  ++Y+ + N     LLL+ YG +I P MYP SF    PSTA+VVL + N+L+G   +ISTF++++   N+E +  INDILK V LIFP F LGRG++D+  N    ++++ +   N     L+WD+ G+ LF++    + ++I+ ++I+       + +C KL             ED DV  ER+R+ S     D+L +  LTK+Y                     + ++ AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct:  292 LTENATGSPSLMYQAVSRIVCGHPEGGGLKIKSLNWYEDSNFQALFGNHNDSDDQPVPVYDNTTTPYCNSMMRNMEASPISRM-IWRALKPLLMGKILYTPHSPATQKIIHEVNKTFQELGILRDLGGMWE-EARPKVWNFMENSNEMDLMRTLLLNNLTANFFSAQLAGTQWSVEDVISFLSKHSEDTRPQGTAFTWRDVFNETDQAIMSISRFMECVNLDKLEPVSTE---EKLVNESMSLLDNRKFWAGIVFLDI-----PSNSSELPPNVNYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDLRYIWGGFSYLQDVVEHSIIRAVTGSKE-KTGVYIQQMPYPCYVDDIFLRIMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLISAGLLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTAFARANLAAACGGIIYFTLYLPYVLCVAWQDYVGFAAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWNNLFSSPVEEDDYNLTTCLILMYFDAFLYGVMTWYIETVFPGQYGIPRPWYFPFTKSYWFGENSTNNTAIHGKKSNAGA----VCIEEEPTHLKLGVYIENLVKVYRHGKKLAVDGLTLGFHEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSSIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLSEEEVKAEMEQILSDTGLPHKRKSRTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRA-GRTILLSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEMLSDGTLPVRR--QRRHAFGADHQSCLK-----PLTEDDSFDCNESEGDPESKETDYLSGSDGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALNPWMY------EEQFMFFSEDAPYDVSTHKLLRALFDDPG-FGTRCMKGE--SIPDAPCTMGDEE--WSTPEVPESIIEILTTRNWTMNDPSPACECSCNGKKKMLPECPAGAGGLPPPQIKI-SETETLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSLGARST-----QVL---PPAEEIDDAISRVREIF-QLGKDSGSAADRFLKSLSAFINGLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRANLPPGKDPS-EFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPYLYWLANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPSTAYVVLTSVNILIGINGSISTFVMELFG-NHE-IGGINDILKNVLLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFEPKSLCPKLSPI--------GEEDEDVARERQRIMSGAGQGDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTF 1965          

HSP 2 Score: 187.193 bits (474), Expect = 7.413e-47
Identity = 101/318 (31.76%), Postives = 176/318 (55.35%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            + +  L K+Y   + P ++ L +     +    LG NGAGKT+T  +LTG    + G A+I  + I  E+D + Q +G CPQ++ + D LT  +H+ FY +L+ + +NE+ +V    I+ + L + ++  +   SGG  RKLS A++ IG   VVFLDEPT G+DP ARR +W+ +       R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           +  + + + ++KF++  +  + + E+ R      LP +  +      +F  L ++   + I  Y +S T+L++VF+  A
Sbjct: 1921 LELRQLTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTKGEAFIAGKSILREIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPENEVCAVAEWGIRKLGLVKYVDKNAGSYSGGNMRKLSTAISLIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIILRVAGPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLPSSLTS---LAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFA 2230          

HSP 3 Score: 67.781 bits (164), Expect = 1.345e-10
Identity = 34/80 (42.50%), Postives = 44/80 (55.00%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            IS QL  LLWKNF  +RR+   LL E+  PL + FIL AVR     Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    3 ISTQLGLLLWKNFTYRRRQTLQLLTEIVWPLFIFFILIAVRLYYPPYEQHECHFPNKAMPSAGTLPWIQGIVCNANNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Zebrafish
Match: abca4a (ATP-binding cassette, sub-family A (ABC1), member 4a [Source:ZFIN;Acc:ZDB-GENE-050517-3])

HSP 1 Score: 790.801 bits (2041), Expect = 0.000e+0
Identity = 553/1714 (32.26%), Postives = 864/1714 (50.41%), Query Frame = 1
Query:  619 CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWR---LHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTL-----------------------------FNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFP--GQYGVAKPW--NFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQA---------------------------FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKL----------QCCGSLVFLK------------RKFGEG----------------YYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGES-------GIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMV------------------SPECDCSKTGNQ-----ICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLK-FIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNY-FYNSNSIVKHEY--NALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            C  + +    N + +  ++  + P + GK+ Y P+    RQII+ AN TF+ L+ LR     W        +F  D +  N+  + ++         NP + D +N                               F+  N+ +  D V +L   I R   C  LD+F    S+ D D+LT+++        F A ++F + + + T K    +  +IR+ +  ++ T K K  DR+W P PR +   D +Y+  GF +LQ+ I+   I+  T  E   +G  +  MPYPCY+ D F+  L    P  +V+AW  SV++ +KSIV EKE RLKE +K MG+ N V W +WFI T  ++     ++++ +   K+   S+  ++F  +  +  + I Q F++SVFF+KAN+A+   GI+YFT Y+  VV    +  ++  M     L+SQVAF    +++  +E+   G+Q+ N+  +  E   F   + II+M +D+ +Y ++ WY+++VFP  G+  V KP   N +        N  + E  P    + ++ +I  +                            FE EP  L  G+ + NL K++  +  P ++ L+L FYE QITAFLGHNGAGKTTT+S+LTG+F P+SGTAYI  +DIRT+MD+IR+ +G+CPQ+N++F  +TV +HI FY LLK     E +  +  +++D+ L  K N  + +LSGGM+RKLS+AMAF+G ++VVFLDEPT+GVDP++RR IWDLL+KYR   RT+IL+THHMDEAD LSDRVAIISQG+L           C G+  +L             RK G+                       K + +      N E+I   V  ++ +AR++E    + T +LP      R +  LF+ L++ +A+M + S+G+SDTSLEEVFLKV  D     IN        + N         +    +   +    +Q          +KGF L+ +Q  AL IKR+H+  R  K FLA+++LP   +   ++F  I     +   + +SPW+   +       TF+  E        +++S      GE        G RCM      L+ Y C   N    W      ++P+V                  SP C CS T N+     +C +  +GG P   RI ++ D L +LTG NISDYL+K +P L R           + YGG      LP       K I ++    ++   +N +   +++  L+    F+ Y++    +        ++W N+KG+ +M A+ N+ +N  +        V   +YGI+  N P+ + +       V    ++  +AI VIF +SF+PA FV++L++ERV+ +K  QFVSG++P VYW +NF WD++ Y +   +++ IFIAFD + Y    N  A I LL+ YG ++ P MYP S+  + PSTA+V L+  NL +G  ++  TFILD+ + + E L + N +LKK  L+FP F LGRG++D+  N    +  +    ++  +   WD  GE L  +      ++I+ I+I+     R       + + K+  I + ED DV  ERER+     S+D+L++ +L+K Y    +                     AV+ +C GV  GECFGLLGVNGAGKTTTF
Sbjct:  370 CNDLMKDLESNPVTRI-VWRSVKPFLMGKILYAPDSPAARQIIKNANTTFEELERLRNMGRAWEEVGPQIWSFFQDSVQINMLRDSIR---------NPTVMDHINKGLRNAAFTGQHILNFLYSGPEEDREQDMPNFDWRNIFNLTDQVIRL---INRYGECLVLDKF---SSISDEDQLTHRALNLLEEGKFWAGLVFVDMYSWTT-KVPPHVKVKIRMDIDVVERTNKIK--DRYWDPGPRADPMDDLRYIWGGFAYLQDMIEHGIIKTHTGKE-WPLGVYLQQMPYPCYVDDLFMLTLNRCFPIFMVLAWVYSVSMTVKSIVLEKEMRLKETLKAMGVTNRVLWCTWFIDTFFMMASSTALLTLIIMGGKVLNYSNPIILFLFLLTFTTATIMQCFLMSVFFNKANLAAACSGIIYFTLYLPHVVCFAWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIQTSLLEGDEFSFLNSIIMMAVDTVLYGVLAWYLDSVFPVPGKPTVEKPAFDNLVNNTDDQAKNHTAPEKPPEPPGSCKHGDIREKLEREKLQKRIVEEEINRSMSTDSSGKVFFEPEPSGLVAGVCVENLYKVFSGSSRPAVDGLSLTFYEGQITAFLGHNGAGKTTTMSVLTGMFPPTSGTAYIYGKDIRTDMDAIRKSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLPEAQLEVENMLEDLGLPHKRNEEAQNLSGGMQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYR---RTLILSTHHMDEADLLSDRVAIISQGRLYCCGSPLFLKNCLGAGFYLTLVRRIKEQPAPVRKEGQCDCTDDCSCKCSLCTKFKASDTEKPRVSERQMEGNIESITALVHHHVPEARLIEVIGQELTFLLPSRAFKHRSYASLFRELEETLADMGLSSFGVSDTSLEEVFLKVTADGEAAHINTASDTDRSHANG-------QSNSANVISKEGRGSQQ----------VKGFFLVVKQFFALLIKRFHHTTRSGKDFLAQIVLPASFVFISLMFTLIVPPFGEYPSLTLSPWMYGRQF------TFFSNE--------QMQSPDMRYFGEVLLNRPGFGTRCMVDE--PLEEYPC--NNITTEW------EMPLVNPMLIEMLSNSEWTDISPSPSCQCS-TPNKLTMLPVCPE-GAGGLPPPQRIQSTGDMLMDLTGRNISDYLVKTYPNLIRTSLKSKYWVNEQRYGGISVGGRLP-VLNLDPKSIQNAA--AQIGRLLNVTGGRYSKLALDEFATFLRYMETENNV--------KVWFNNKGWHAMVAFMNV-ANNAILRANLPPGVDLNEYGITAINHPLNLTKEQLSEVTVLTTSVDAVVAINVIFAMSFVPAGFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFFWDMINYSVSAAMVVGIFIAFDKKCYTSPGNLQALIALLMLYGWSVTPMMYPMSYIFNVPSTAYVSLSCINLFIGINSSAITFILDLFD-STEALYKCNQVLKKALLVFPHFCLGRGLIDMAMNQAVMDVYARFGEDFSLDPFSWDFVGENLTFMAVEGFVYFILNILIQY----RFFLDHWMSDF-KKPPITD-EDVDVAKERERIYKGGSSNDILQIKDLSKTYTGTFR--------------------PAVDRICVGVSPGECFGLLGVNGAGKTTTF 1978          

HSP 2 Score: 167.933 bits (424), Expect = 6.173e-41
Identity = 114/406 (28.08%), Postives = 193/406 (47.54%), Query Frame = 1
Query: 1966 VGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLP------QNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            VG  +  M ++ F+Y ++   ++  F           FL    +W+ + K     P+   +    +   + ++    N  L   I +L K Y     P ++ + +     +    LG NGAGKTTT  +LTG    +SG A +    I T +  + Q +G CPQ++ + D LT  +H++ Y  L+ + ++EI  V    I+ + L+E     +   SGG KRKLS A+A IG   ++ LDEPT G+DP +RR +W+ ++      R ++LT+H M+E + L  R+AI+  G  +C G++  LK KFG+GY                    +     +  A+A M  ES     I         Q +I S    ++F+ +  +   ++I  Y +S T+L++VF+  A
Sbjct: 1871 VGENLTFMAVEGFVYFILNILIQYRF-----------FL---DHWMSDFKKP---PITDEDVDVAKERERIYKGGSSNDIL--QIKDLSKTYTGTFRPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVTSGEADVAGYSILTNILDVHQNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSEYAGCTAGTYSGGNKRKLSTAIAMIGCPALLLLDEPTTGMDPHSRRFLWNSIMSVIQGGRAVVLTSHSMEECEALCTRLAIMVNGTFKCLGTIQHLKYKFGDGY----------VVTMKIRAAKVGAVPDLNPAEAFM--ESTFPGCIQREKHYNTLQYEIASSSLAKIFQVVLANKEMLNIEDYSVSQTTLDQVFVNFA 2245          

HSP 3 Score: 58.5362 bits (140), Expect = 8.746e-8
Identity = 25/82 (30.49%), Postives = 46/82 (56.10%), Query Frame = 1
Query:   22 SNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQT 267
            ++Q+R LLWKN+ +++R+   L +E+  P+++   L  +R +   Y+   C F  K M S G +P++   +C  N  C+  T
Sbjct:    4 NSQVRLLLWKNWTVRKRQKTRLFMEIMWPVVLFIGLVWLRKANPLYRQHECHFPNKAMPSSGVLPWIQGIVCNANNPCFQHT 85          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Zebrafish
Match: abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:ZFIN;Acc:ZDB-GENE-030131-9790])

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 494/1625 (30.40%), Postives = 799/1625 (49.17%), Query Frame = 1
Query:  682 LAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---------RLHFQTFLLDYISNNVFINDVKKFCKAYYSAN-PKICDAVNTLFNITNV----KSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQ--SFRNFLAVIIFN---ETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTF---TDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP-------LMRNNNQNCEINHQA---------FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLK--RMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILK-FVKIYIADARMMEESRLQWTIVLPQ-NDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNEN--------NMWSPASILDIPMVSPECDCSK----TGNQI---------------CNDLRSGGPPNSY----RIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTIST---FILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLF---FNYFYNSNSIVKHEYNALQWDIAGEKLFSLFS---LSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRN---TEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            L P++ G++ Y P+  + R+I+ K+N +     +L+L + EW           +  T  L  + N++    V+ F +     +   +   +N   N+T +    K  +D ++ L   +    +C   DR+   +S  ++DK   +    R   A IIF    E    L P     + Y IR+ +  +  T      DR   P+  ++ +   T  +    GF++LQE+I++A IE+ T N        M   PYPCY  D++L  +A   P  L+++W   +   +K +V+E+E RL EYMK+MG+N   H+ +W I +   L++ V+I+++ L+   I   S   V+F  +  Y  S +  +F+VS FF K N+A +SG ++Y   +  F+V I LE  LS ++  +  L S   FS A +++  +E+  EG+Q+SN++ +P        G    L++IDS +Y +I  Y+  VFPG+YG+A PW F   +S+W          P       L  N  Q+    +++          E +   L +G+S++ L K Y   K   ++NLNL+FYE  +T+ LGHNGAGKTTT+S+LTG+F+P+ GT  +   D++  +D +R+++G+C QY+VLFD LT ++H+  Y  +K     K E++  + +I+ + D+    +     LSGGMKRKLSI++AFIG SR+V LDEPT GVDP +RR IWD++I+++  +RTIIL+THH+DEA+ LSDR+A + +G L+CCGS  +LK K  +GY L+L K      +  +     L+ F+  ++ DAR  +         LP     N+ ++  L  +LDQ++ ++ +  YG+SDT+LEEVFL++  D +     KE   +S   ++++  +   A++  +  + N      K     +  ++GF L  Q++IA+ +KR H+++RD+KG  ++++                      +P+      +++ MG              LG I       +SDL       ++P++Y +D    F+ N+N         M S   I  + M  P     K    TG+Q                C++     P   Y    +   SS  + NLTG NI +YLL       R  YGG++F  P        ++ D P             AN                          + +++W NS+G+ SMPAY N  +N  LRS L     K   Y IS+S+ P   +   +  DL+   ++ + +A+ V+ G S + ASFVI+ V+E  +GSKR Q +SGI+   YW+ NF +D+  Y+IP+++ +++  AF   ++   +N  A  LLL+ +G +  P MY  S        AF+     NL +   T IST   + L  L  N + ++ I   +  +FL+FPQF+ G G+M+L          S   V    N    D+ G    S+F    +     ++L       V R+ C        KR  +++    ED DV  ER R+     S D+L+V +LTK+Y  + K                  R  AV +L  G+  GECFGLLGVNGAGKTTTF
Sbjct:   24 LKPMLLGQILYSPDTPMTREIMRKSNSSLHQFGDLKLYASEWIESSSYVLQSANILTQTLPILKNSLNSPFVQNFIRTQTGIDVSGMSATLNQFSNMTVLLEKNKFIMDQITTLSVLMMNLSSCVNFDRYRGFNSTDELDKQAEKLAQNRELYASIIFKLPKENSSSLPPN----IDYTIRMNIENVMRT------DRARNPFWVKDAYISATRTQRYSRGFVYLQESIERAIIEMQTGNAMDGPAVQMQAFPYPCYYKDEYLNSIAFAFPMALMISWVLFIAHFVKKLVHERELRLHEYMKMMGVNPISHFFAWLIESGAFLLVTVIILTIILKAGGILPRSDGFVLFLYLCDYGFSVLAVSFLVSSFFDKTNIAGLSGSLIYVISFFPFIVLIHLEDNLSFSVKSALSLFSPTCFSYASQYIARYEKQEEGIQWSNMYISPLAGDTSSFGWLCWLLLIDSLVYFIIGIYIRMVFPGKYGIAVPWYFPVTKSFWTDMFSCCSKTPKKIGRGLLFTNMMQDQSSMNKSKGKGSLVAKGEEDFSGLPVGVSLYGLTKTY--GKRNAVDNLNLSFYEGHVTSLLGHNGAGKTTTMSLLTGLFAPTVGTIEVYGMDMQMFIDDVRKEMGVCMQYDVLFDHLTTKEHLLLYAQIKAPHWTKQEVKEQVHKILMETDMHAHRHKRVGTLSGGMKRKLSISIAFIGGSRLVVLDEPTTGVDPCSRRSIWDIIIQHK-QERTIILSTHHLDEAEVLSDRIAFLERGGLKCCGSPFYLKDKLAKGYNLTLTKKVETADSKEKFDYEKLRDFIHSHLPDARQKDREMGDLVYALPPYTPQNASEYHSLLNSLDQNLDKLHLGCYGISDTTLEEVFLQLTRDDLEP---KESETWSVSESVIENDMF--ASRDSLSEDCNSMYLGEKASLTGNSTVRGFALGVQRVIAMLLKRVHHSRRDWKGLFSQVL----------------------LPV----LFVIAAMG--------------LGSI-------KSDLQHFPEIVLSPALYHVDEQYAFFSNQNPNTSRLVDTMMSYPGIDHVCMTDPTDPVCKGRPSTGSQTWVSGGNSSATFTTCKCSNQVQSCPAQGYDPPRKRCPSSQIVYNLTGVNIENYLLATANNFIRDRYGGWEFGKPLPIDLKMDML-DVP-------------ANR-------------------------TLSKVWYNSEGHHSMPAYLNSLNNFFLRSSLPPE--KRYQYAISISSHPYPGQVQDE--DLMVGGLVSILVALCVLTGYSIMTASFVIYEVQEHHTGSKRLQQISGISEPFYWIINFFYDMALYMIPVVLSVVMVAAFQLPAFTERQNLAAVTLLLVLFGFSTFPWMYLLSAMFKDTEMAFIGYVCINLFISVNTIISTSIIYFLGQLNQNDQSIQNIYQTMSNIFLVFPQFSFGNGLMELARVDMQVQILSGFGVDAYKNPFSMDVLGWMFISMFLQGFICFTLRLLLNKTLLRKVRRLFC-------WKRNAVQSYSPNEDEDVLDERLRVGRGDASSDILQVNHLTKVYQNFSK------------------RVQAVKSLSVGIPAGECFGLLGVNGAGKTTTF 1515          

HSP 2 Score: 169.088 bits (427), Expect = 1.980e-41
Identity = 103/338 (30.47%), Postives = 182/338 (53.85%), Query Frame = 1
Query: 2194 ENLKLG--------ISIHNLVKLYP--SNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTE--MDSIRQ--KIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            E L++G        + +++L K+Y   S ++  + +L++     +    LG NGAGKTTT  +LTG  SPS G+A I + D R    +D  R+   IG CPQ + L D LT E+H+YFY  ++ + K +I  V+  ++K + L    N  S   S G +RKLS A+A IGN +++ LDEP++G+DP ++R +W ++ +       ++LT+H M+E + L  R+AI+ +G+ +C GSL  +K +FG G+ + +     ++     +      F    + D      + +++ + +    + S     +F  L+ +   + I  + +S T+L+EVF+  A
Sbjct: 1455 ERLRVGRGDASSDILQVNHLTKVYQNFSKRVQAVKSLSVGIPAGECFGLLGVNGAGKTTTFKMLTGDISPSGGSAKIRDIDGRMVDIIDCRREGINIGYCPQVDALDDLLTGEEHLYFYARIRGISKRDISQVVNYLLKKLQLNYHRNNTSESYSCGTRRKLSTALALIGNPQILLLDEPSSGMDPRSKRHLWKIISEQVMGKCAVVLTSHSMEECEALCTRLAIMVKGQFRCLGSLQHIKNRFGSGFTVKMYLTGASYDVDMISNFMQQNFPGTCLKDN---HSNMVEYHVPVAPGGVAS-----IFSLLESNKTVLQIKHFSVSQTTLDEVFINFA 1784          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Zebrafish
Match: abca4b (ATP-binding cassette, sub-family A (ABC1), member 4b [Source:ZFIN;Acc:ZDB-GENE-050517-4])

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 404/1118 (36.14%), Postives = 613/1118 (54.83%), Query Frame = 1
Query: 2179 FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXX---------------------------------XXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD--PMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDH-----LLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDN-YQCFYRNENNMW-----SP--ASILDIPM-----VSPECDCSK----TGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKL-----------SRKLYGGFQFVLPSTFGWSSKLIGDSP-----FWEELRDFVNASQANHNQSNLNSLK-FIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNY-FYNSNSIVKHEY--NALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            FE EPE+L +G+S+ +LVK+Y     P ++ LN+NFYESQIT+FLGHNGAGKTTT+SILTG+F P+SGTAYI   DIRTEMD+IRQ +G+CPQ+N+LF  LTVE+HI FY L+K  +  E E  +  +++D+ L  K +  + +LSGGM+RKLS+AMAF+G SRVV LDEPT+GVDP++RR IWDLL+KYR+  RT+IL+THHMDEAD LSDRVAIIS+GKL C GS +FLK  FG G+YL+L++   +                                         E+I   +  ++ +A+++E    + T +LP      R +  LF+ L++ + +M + S+G+SDTSLEE+FLKV  D    N  +  E+        +L+ +   N    +  L ++ +   +     S        +KGF L+ +Q  AL +KR+H+A R  K FLA+++LP   +L  ++F  I     +   + ++PW+   +       TF   E  S   +         D G  G RCM  +   L+N + C   N ++ W     SP  ++IL  P       SP C+CS     T   +C    +GG P   R   + D L ++T  NISDYL+K + KL           + + YGG       + G    ++   P      + +L   +N     +++S ++ L+ F+ Y++  + +        ++W N+KG+ +M ++ N+ +N +LR+ L   A    DYGI+  N P+ + +       V    ++  +AI VIF +SFIPASFV++L++ERV+ +K  QFVSG++P VYW +NF WD++ Y +   +++ IF+ FD + Y    N  A I LL  YG ++ P MYP S+  + PSTA+V L+  NL +G  ++  TFIL++ E N   L   N++LKKV L+FP F LGRG++D+  N    +  +    E+  +  +W+  G+ LF +      ++I  ++I+     +       + Y   + +   ED DV  ERER+      +D+L + +L+K Y                     + +  AV+ +C GV  GECFGLLGVNGAGKTTTF
Sbjct:  969 FEPEPESLLIGVSVQDLVKMYNRYSRPAVDCLNMNFYESQITSFLGHNGAGKTTTLSILTGLFPPTSGTAYIYGRDIRTEMDAIRQSLGMCPQHNILFKHLTVEEHILFYSLMKGREHKEAEQEVENMLEDLGLPHKRDEEAQNLSGGMQRKLSVAMAFVGGSRVVILDEPTSGVDPYSRRSIWDLLLKYRT-GRTVILSTHHMDEADLLSDRVAIISKGKLHCSGSPLFLKNCFGVGFYLTLVRRMKDQRKKENECDCASECSCTCSTCTRYKEESQALQPERVLDGNVESITTLIHHHVPEAKLIEMIGQEMTYLLPNKGFKYRAYASLFRELEETLGDMGLSSFGISDTSLEEIFLKVTADGEAANSSVTPEQW-------MLQQRKNGNGFMKDTGLAEDANGVGASLESDSSEGRASRQVKGFSLVLKQFHALLVKRFHHATRSHKDFLAQIVLPASFVLIALVFTMIVPPFGEYPCLTLTPWMYGPQF------TFISNEQPSHPKMKHFIQTLLKDPG-MGTRCM--ANQPLENIFTCL--NSSSDWEVPPVSPEVSNILSSPEWDSRNPSPSCECSTDLKLTMLPMC-PAGAGGLPPRQRKEPTGDILLDMTNRNISDYLVKTYTKLIKTSLKSKYWVNEQRYGGI------SVGGRLPILDVDPEEIQNIFSQLGRMMNIRGGRYSKSAMDELETFLHYMESEYNV--------KVWYNNKGWHAMASFLNVANNAILRAYLPPHA-NPSDYGITAINHPLNLTKEQLSEVTVLTTSVDAVVAICVIFAMSFIPASFVLYLIQERVTKAKHLQFVSGVSPLVYWFANFFWDMLNYSVSTAMVVAIFVGFDKKCYTSPTNLPALIALLCLYGWSVTPMMYPLSYMFNVPSTAYVSLSCINLFIGINSSAITFILELFENNRSLLM-FNEVLKKVLLVFPHFCLGRGLIDMAMNQAVTDVYARFGEEFSMDPFRWNFVGKNLFCMAVEGFVYFIFNLLIQY----KFFLHHWISDY--GMSLGTDEDDDVAQERERIYKGGNKNDILLIRDLSKTY--------------------RRRKRPAVDKICVGVPAGECFGLLGVNGAGKTTTF 2024          

HSP 2 Score: 254.988 bits (650), Expect = 1.454e-67
Identity = 167/594 (28.11%), Postives = 301/594 (50.67%), Query Frame = 1
Query:  517 NELGEIICGSPE--------------NDFKLFMRNFIKNQRRKRSLLT-------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVN-----------------------------TLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLT--PKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSES 2127
            +++ ++ CG PE              N++K F+   I N R   S +        C  + Q+   N I K  ++N + PL+ GK+ Y P+   +R+II+ AN TF+ L+ L+     W       L D+  N++ +N ++   +     NP + D ++                             T F+ ++V    D   ++F+   R   C  LD+F+      D + +T+Q+        F A ++F + + +    P++  F   +IR+ +  ++ T K K  DR+W P PR +   D +Y+  GF +LQ+ I+   ++L T ++   +G  +  MPYPCY+ D F+  L    P  +V+AW  SV++++KSIV EKE RLKE +K MG++N V W +WFI + +++     +++  +   K+   S+  ++F  +  + ++ I Q F++SVFF+KAN+A+   GI+YFT Y+  +     +  ++  M  +  LLS VAF    +++  +E+   G+Q+ N+  +P E   +     I +M++D+ +Y ++ WY++ VFPGQYG+ +P+ F    SYW+     SE+
Sbjct:  317 SKVSDLFCGYPEGEGTRVFSFNWYEDNNYKAFLG--INNSRGHDSYIYDKTATPFCNALMQNLESNPITKI-VWNSVKPLVMGKILYTPDSPAVRKIIKSANTTFEELERLQKIGKVWE-ELGPQLWDFFQNSIQMNMIRDTLR-----NPTVMDFLDRRLRETEFSTKDILNFLHNGPEGERFMNMTSFDWSDVFRLADQAIRMFN---RYSECISLDKFV---GHMDENLMTHQALHLLGENKFWAGLVFMDMYPWTIELPRHVKF---KIRMDIDAVERTNKIK--DRYWDPGPRADPVEDHRYIWGGFAYLQDLIEHGILKLHTGHD-WPLGVYLQQMPYPCYVDDMFMLTLNRCFPIFMVLAWIYSVSMVVKSIVLEKEMRLKETLKAMGVSNGVIWYTWFIDSFIMMTASTALLTGIVMAGKVLNYSNPIILFLFLLTFTVATIMQCFLMSVFFNKANLAAACSGIIYFTLYLPHIFCFAWQDRITKDMKLAVSLLSPVAFGFGTEYLSRYEEQGLGLQWDNIGTSPLEGDEYSFFTSIRMMLLDAVLYGVLAWYLDNVFPGQYGIGRPFYFPLQSSYWLKPSPPSET 889          

HSP 3 Score: 163.696 bits (413), Expect = 1.238e-39
Identity = 83/226 (36.73%), Postives = 127/226 (56.19%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            I +L K Y   K P ++ + +     +    LG NGAGKTTT  +LTG    +SG   +    I + +  + Q +G CPQ++ + + LT  +H+Y Y  L+ + ++EI  V    I+ + L+E     +   SGG KRKLS A+A IG   +V LDEPT G+DP +RR +W  ++      R ++LT+H M+E + L  R+AI+  G  +C G++  LK KFG GY
Sbjct: 1982 IRDLSKTYRRRKRPAVDKICVGVPAGECFGLLGVNGAGKTTTFKMLTGDTDVTSGELSVAGYSILSNILDVHQNMGYCPQFDAIDELLTGREHLYLYARLRGIPESEISRVAEWGIQKLGLSEYAGNCAGTYSGGNKRKLSTAIAMIGCPPLVLLDEPTTGMDPHSRRFLWTAILSIIRDGRAVVLTSHSMEECEALCTRLAIMVNGTFKCLGTIQHLKYKFGGGY 2207          

HSP 4 Score: 53.9138 bits (128), Expect = 2.451e-6
Identity = 24/79 (30.38%), Postives = 40/79 (50.63%), Query Frame = 1
Query:   22 SNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
              Q+R LLWKN+ L++R+     +E+  P+ +   L  +R +   Y+   C F  K M S G +P++    C  N  C+
Sbjct:    4 GRQIRLLLWKNWTLRKRQKIRFFVEILWPVFLFIGLVWLRRANPLYRQHECHFPSKAMPSAGILPWIQGIFCNANNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Zebrafish
Match: abca1a (ATP-binding cassette, sub-family A (ABC1), member 1A [Source:ZFIN;Acc:ZDB-GENE-031006-12])

HSP 1 Score: 582.408 bits (1500), Expect = 8.664e-174
Identity = 321/841 (38.17%), Postives = 492/841 (58.50%), Query Frame = 1
Query:  514 YNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSK-------LFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYY 2898
            Y  +  I+CG PE              N++K LF  N   +     S+        C  + +    + I +  ++  L PL+ GK+ Y P+    ++II + N TF+ L  LR     W    +  + +++ N+  ++ V+   +   SA         T + + +V  ++   S+        ++W             I R + C  LD+  P+    + ++L N+S R      F A I+F +  Q  T      ++Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ I+   I  +T ++  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV ++IK +VYEKE+RLKE M++MGL+N + W+SWFIS+++ L+I   ++ + L++  +   S   V++  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +         LLS VAF    ++   +E+   G+Q+SNL  +P +   + +   I LM+ DS +Y ++TWY+EAVFPGQYG+ +PW F   +SYW    K   +  +  N  +N E      E EP ++  G+ I NL+K+Y + K+ V + L L FYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYI  +DIRT++++IRQ +G+CPQ+NVLF  LTVE+HI+FY  LK +   +++S + +I+ D+ L  K  + S  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP+ARRGIWDLL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYY
Sbjct:  304 YQAVSRIVCGHPEGGGLKIKSLNWFEDNNYKALFGNNGNDSDSEPASVYDNSSTPYCNNLMKGLESSPISRM-IWRALKPLLMGKILYTPDTPATQRIIHEVNKTFQELGVLRDLGGMWE-EMRPKIWNFMENSEEMDLVRTLLQNNASARFFNAKLSGTEWRVEDVSRFLSKSSEDTRPHGTAYTWREVFNETDQAIQTISRFMECVNLDKLEPV---ANEERLVNKSMRLLDDRKFWAGIVFPD-MQSNTSDLPLNVNYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDLRYIWGGFTYLQDVIEHGIIRALTGSKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLISAALLVLILKMGNLLPYSDPGVIYLFLSSFAVVTIMQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQNYVGFGAKIVVSLLSPVAFGFGCEYFALFEEQGVGIQWSNLLSSPMQEDSYNLTTSICLMLFDSVLYAVMTWYIEAVFPGQYGIPRPWYFPFTKSYWCGE-KCGWTTSVPSNRKENAEA--VCIEEEPAHIDPGVYIENLMKIYSNGKVAV-DGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIQGKDIRTDLNAIRQNLGVCPQHNVLFSMLTVEEHIWFYARLKGLSAEKVKSEMEQIVMDLGLPHKRTSRSNQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYY 1130          

HSP 2 Score: 303.523 bits (776), Expect = 1.807e-82
Identity = 256/827 (30.96%), Postives = 418/827 (50.54%), Query Frame = 1
Query: 2977 YIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD------------PMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQ---NPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKL-----ESEYRSDLGESGIRCMNPSIYRLD----------NYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDK-LNNLTGYNISDYLLKNFPK-----LSRKL------YGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHN-QSNLNSLKFIDYLQKTFKIYGIKT-SFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            ++  AR++E+   + T VLP        F ELF  +D  + ++SI SYG+SDT+LEE+FLKVA+D            P  +  N+  ++  +   +         T+ +   N    +P+ +++ +LD +D    + +KG+ L +QQ +AL  KR  YA+R  KGF A+++LP + +   ++F  I        P    P L +     E   TF   +       N+L     +S   +D    G    + S    D          + +  + N N  WS    ++ P    EC C      +       G     +I  + D+ L NL+G NISDYL+K + +     L  KL      YGGF     +T           P  +EL D ++  ++  + +S   + +F+  L  TF I G+ T +  +IW N+KG+ S+ ++ N+  N  +        +    +GI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERV+ +K  QF+SG+ P++YW++NF+WD+  YI+P  ++IIIF+ F  ++Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   ++STF+L++   N   +  INDILK VFLIFP F LGRG++D+  N    ++++ +   N     L WD+ G+ LF++    + ++ + ++I+        C K + S   +++    ED DV  ER+R+       D+L +  LTK+Y                     + ++ AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1197 HVPTARLVEDLGHEITYVLPYESAKDGAFVELFHEIDDRLTDLSISSYGISDTTLEEIFLKVAEDCGVDAETSDGTLPARR--NRRHAFGDHQSCLKPF------TEDDFDFNDSEGDPESRETDWLDGADGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVP------PFGKYPSLALEPSMYEEQFTFISNDAPEDRHTNRLLDALKDSPAYTDQCTDGKNTASRSCPIKDGEWLVPEVTESIEAIFLNGN--WS----MENPSPLCECSCEGRKKMLPECPPGAGGLPPPQIKVTHDETLQNLSGRNISDYLVKTYAQIIGKSLKNKLWVNEFRYGGFSLGARNTQAL--------PPGDELTDAISHIRSRFSLESGTAADRFLGSLS-TF-IRGLDTNNNVKIWFNNKGWHSIGSFLNVM-NNAVLRANLPPGLDRSKFGINAFNHPLNLTKEQLSHVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSN--EIGGINDILKNVFLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLAWDMVGKNLFAMAIEGVIFFSITVLIQYR-----FCIKAR-SLSTKLKPIGEEDEDVARERQRILGGGGQTDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTF 1963          

HSP 3 Score: 196.438 bits (498), Expect = 1.123e-49
Identity = 109/322 (33.85%), Postives = 181/322 (56.21%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESR--LQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + +  L K+Y   + P ++ L +     +    LG NGAGKT+T  +LTG    +SG AY+    + TE+D + Q +G CPQ++ + D LT  +H+ FY +L+ + + E+  V    I+ + L + ++  +   SGG  RKLS AMA IG   VVFLDEPT G+DP ARR +W+ ++      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK KFG+GY           + ++   E +++F++  +  + + E+ R  LQ+ +      + +R F  L KN +Q    + I  Y +S T+L++VF+  A D
Sbjct: 1919 LELRQLTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTSGEAYLAGNSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCKVADWGIRKLGLMKYVDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNKFGDGY-----TIILRVAGADPRLEPVMEFIERELPGSTLKEKHRNMLQYQLSSSLTSL-ARIFNILSKNKEQ----LHIEDYSVSQTTLDQVFVNFAKD 2230          

HSP 4 Score: 66.6254 bits (161), Expect = 3.144e-10
Identity = 32/80 (40.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            +S QL  LLWKNF  +RR+   LL+E+  PL + FIL +VR     Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    3 VSTQLGLLLWKNFTYRRRQTIQLLVEIIWPLFIFFILISVRLYYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 644/1975 (32.61%), Postives = 993/1975 (50.28%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY---------------DQTQINWL-------------GTNLNEFHVFIGNI------------------------------------TEIYNSLPSGALNVPK--------FMKWITSNPNEFIR-----LQNSFSYISKRIVPLISTV---NKVM---SENETTIESG-YNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT--------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---RLHFQTFL-----LDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKD-IDK---LTNQSFRNFLAVIIFNETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGS-------------LVFLKRK------------------------------FGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-------NKLINKEKSY-YSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPM--------VSPECDCSKTGNQ----ICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF-------YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESG--IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
             QL  LLWKNF  +RR+   L++E+  PL + FIL +VR S   Y+   C F  K M S G +P++   +C  N  C+               +++ ++ L              T++ + H F+GN+                                     +I  +LP   LN+ +         +K ITS P  F++     L +S + ++K ++ + S      +VM   S N T   S  Y  +  I+CG PE              N++K LF      N   + S +         C  + Q+   + + +  ++  L PL+ GK+ Y P+    + ++ + N TF+ L   R     W   R   + F+     +D I   +     K F     ++     + ++            +     +SW E             R + C  LD+  P+ + +  IDK   L N+  R F A I+F +      P+  T L     Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ ++QA I + T  E    G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W+SWFIS+++ L++   ++ + L+   +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+      LS VAF    +     E+   GVQ+ NL ++P E   + +     +M+ D+ +Y ++TWY+EAVFPGQYG+ +PW F   +SYW        + P      +         E EP +L LG+SI NLVK+Y + K   ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P++GTAYI+ +DIRTE++SIRQ +G+CPQ+NVLFD+LTVE+HI+FY  LK + + ++++ + +++ DV L  K    +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LLIKYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS             L  +KR                                G G              S  +   I   +  ++ +AR++E+   + T VLP        F ELF  +D  ++++ I SYG++DT+LEE+FLKVADD           L  + K Y +  + + L+     +A  T    + +P+ +++ +L   D    + LK + L++QQ  AL  KR  YAKR  KGF A+++LP + +L  ++F  I     K   +++ PW     M  E    F        G    L++    D    G  CM    + +    C    E   WS      S++D+ +         SP C+CS    +    IC     G PP   R   +SD L NLTG NISDYL+K + ++  K YGGF                           + AS +     N   +  I++++K  ++  ++  ++ +W N+KG+ ++ A+ N+ +N +LRS+L +       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L  IN+ILK V LIFP F LGRG++D+  N         +  N  V    + + WD+ G  LF++    + ++ + ++I+    I  R +  KL             ED DV  ER+R++   + +D+L +  LTKIY +                     R+ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct:    5 TQLGLLLWKNFTYRRRQTLQLVVEVAWPLFIFFILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCFRYPTPGESPGVVGNFNRSIVSRLFTDARKLLLYSHKDTSVKDMHKFLGNLHNYRGTGFQIHLKDLCNSTRLAEYVTIHNEVVANLSQKIICALPEEKLNLLEQEFRSNVDLLKPITSFP--FLKDITDSLLHSLADLAKEVMTMKSWAEMRQEVMFLTSGNATASPSTLYQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGGEGDNSTDEDSQVAYDNSTTPYCNDLMQNLESSPLYRM-IWRALKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWEEVRPQIKNFMESSQEMDLIRTLLTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETEN-GPFYSWREALNETDRVVLTLSRFMECVNLDKLEPVATEEMLIDKSMELLNE--RKFWAGIVFMDM-----PEEETELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIRVQTGVEK-RTGIYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPLEENGYNITTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWCGEECKEYNQP--HTVQKGSSEGMFCMEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLKGLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIGKYKSLTDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDS-DMDPESRETDYLSGIDGKGSYQLKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPW-----MYDEQYTFFSNDAPDDQGTQALLKALI--DKPGFGTACMEG--HSVMKVSC--SGEEEEWSTQFVSQSVMDLFLNGNWTMENPSPSCECSSDKRKKMLPICPPGAGGLPPFQRR-QNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFS--------------------------LGASNSPALPPNEEVVASINHIKKRLELPQVEYLYSVVWFNNKGWHAVGAFLNVMNNAILRSKL-REGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNN--KLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFV----SPMSWDLVGRNLFAMAVEGVVFFAITLMIQYRFFIKPRPVNAKLPPVV--------DEDEDVARERQRINEGGR-NDILELKGLTKIYRM--------------------KRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1887          

HSP 2 Score: 174.481 bits (441), Expect = 7.871e-43
Identity = 104/319 (32.60%), Postives = 172/319 (53.92%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADA------RMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEV 3150
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    ++G A++ N  I   +  + Q +G CPQ++ + + LT  +H+  Y LL+ + + E+  V    I+ + L +     + + SGG KRKLS A+A IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY + +    +N           LK V+ + + A      +    S LQ+ +   Q+ + +R F+ L KN  +    + I  Y +S T+L++V
Sbjct: 1843 LELKGLTKIYRMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEWAIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRIAGSNPD---------LKPVEEFFSHAFPGSVLKEKHRSMLQYQLRSSQSSL-ARIFSILSKNKKR----LHIEDYSVSQTTLDQV 2147          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 870.537 bits (2248), Expect = 0.000e+0
Identity = 593/1726 (34.36%), Postives = 911/1726 (52.78%), Query Frame = 1
Query:  514 YNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT--------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---RLHFQTFL-----LDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKD-IDK---LTNQSFRNFLAVIIFNETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP--LMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-------NKLINKEKSY-YSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPM--------VSPECDCSKTGNQ----ICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLN------SLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESG--IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            Y  +  I+CG PE              N++K LF      N   + S +         C  + Q+   + + +  ++  L PL+ GK+ Y P+    + ++ + N TF+ L   R     W   R   + F+     +D I   +     K F     ++     + ++            +     +SW E             R + C  LD+  P+ + +  IDK   L N+  R F A I+F +      P+  T L     Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ ++QA I + T  E    G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W+SWFIS+++ L++   ++ + L+   +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+      LS VAF    +     E+   GVQ+ NL ++P E   + +     +M+ D+ +Y ++TWY+EAVFPGQYG+ +PW F   +SYW        + P  + + +++ C       E EP +L LG+SI NLVK+Y + K   ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P++GTAYI+ +DIRTE++SIRQ +G+CPQ+NVLFD+LTVE+HI+FY  LK + + ++++ + +++ DV L  K    +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LLIKYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   +  ++ +AR++E+   + T VLP        F ELF  +D  ++++ I SYG++DT+LEE+FLKVADD           L  + K Y +  + + L+     +A  T    + +P+ +++ +L   D    + LK + L++QQ  AL  KR  YAKR  KGF A+++LP + +L  ++F  I     K   +++ PW     M  E    F        G    L++    D    G  CM    + +    C    E   WS      S++D+ +         SP C+CS    +    IC     G PP   R   +SD L NLTG NISDYL+K + ++  K YGGF      + G S     +SP      + V  +  NH +  L       + +F+D      K    K +  ++W N+KG+ ++ A+ N+  N  +     +       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L  IN+ILK V LIFP F LGRG++D+  N    ++++ +   N     + WD+ G  LF++    + ++ + ++I+    I  R +  KL             ED DV  ER+R++   + +D+L +  LTKIY +                     R+ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct:  297 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGGEGDNSTDEDSQVAYDNSTTPYCNDLMQNLESSPLYRM-IWRALKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWEEVRPQIKNFMESSQEMDLIRTLLTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETEN-GPFYSWREALNETDRVVLTLSRFMECVNLDKLEPVATEEMLIDKSMELLNE--RKFWAGIVFMDM-----PEEETELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIRVQTGVEK-RTGIYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPLEENGYNITTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWCGEECKEYNQPHTVQKGSSEVC------MEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLKGLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDS-DMDPESRETDYLSGIDGKGSYQLKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPW-----MYDEQYTFFSNDAPDDQGTQALLKALI--DKPGFGTACMEG--HSVMKVSC--SGEEEEWSTQFVSQSVMDLFLNGNWTMENPSPSCECSSDKRKKMLPICPPGAGGLPPFQRR-QNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGF------SLGAS-----NSPALPPNEEVV--ASINHIKKRLELPQNGAANRFLDSFGAFMKGLDTKDN-VKVWFNNKGWHAVGAFLNVM-NNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNN--KLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFVSPMSWDLVGRNLFAMAVEGVVFFAITLMIQYRFFIKPRPVNAKLPPVV--------DEDEDVARERQRINEGGR-NDILELKGLTKIYRM--------------------KRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1943          

HSP 2 Score: 177.948 bits (450), Expect = 7.018e-44
Identity = 106/324 (32.72%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADA------RMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    ++G A++ N  I   +  + Q +G CPQ++ + + LT  +H+  Y LL+ + + E+  V    I+ + L +     + + SGG KRKLS A+A IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY + +    +N           LK V+ + + A      +    S LQ+ +   Q+ + +R F+ L KN  +    + I  Y +S T+L++VF+  A
Sbjct: 1899 LELKGLTKIYRMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEWAIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRIAGSNPD---------LKPVEEFFSHAFPGSVLKEKHRSMLQYQLRSSQSSL-ARIFSILSKNKKR----LHIEDYSVSQTTLDQVFVNFA 2208          

HSP 3 Score: 65.855 bits (159), Expect = 7.351e-10
Identity = 31/77 (40.26%), Postives = 44/77 (57.14%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            QL  LLWKNF  +RR+   L++E+  PL + FIL +VR S   Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    6 QLGLLLWKNFTYRRRQTLQLVVEVAWPLFIFFILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 862.448 bits (2227), Expect = 0.000e+0
Identity = 582/1728 (33.68%), Postives = 900/1728 (52.08%), Query Frame = 1
Query:  514 YNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT--------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---RLHFQTFL-----LDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKD-IDK---LTNQSFRNFLAVIIFNETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP--LMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-------NKLINKEKSY-YSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFY--RNENNMWS----PASILDIPM--------VSPECDCSKTGNQ----ICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQF------VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESG--IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            Y  +  I+CG PE              N++K LF      N   + S +         C  + Q+   + + +  ++  L PL+ GK+ Y P+    + ++ + N TF+ L   R     W   R   + F+     +D I   +     K F     ++     + ++            +     +SW E             R + C  LD+  P+ + +  IDK   L N+  R F A I+F +      P+  T L     Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ ++QA I + T  E    G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W+SWFIS+++ L++   ++ + L+   +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+      LS VAF    +     E+   GVQ+ NL ++P E   + +     +M+ D+ +Y ++TWY+EAVFPGQYG+ +PW F   +SYW        + P  + + +++ C       E EP +L LG+SI NLVK+Y + K   ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P++GTAYI+ +DIRTE++SIRQ +G+CPQ+NVLFD+LTVE+HI+FY  LK + + ++++ + +++ DV L  K    +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LLIKYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   +  ++ +AR++E+   + T VLP        F ELF  +D  ++++ I SYG++DT+LEE+FLKVADD           L  + K Y +  + + L+     +A  T    + +P+ +++ +L   D    + LK + L++QQ  AL  KR  YAKR  KGF A+++LP + +L  ++F  I     K   +++ PW+       +   TF+  +                   + G + +  ++     +   +    E   WS      S++D+ +         SP C+CS    +    IC     G PP   R   +SD L NLTG NISDYL+K + ++  K YGGF         LPS  G   K+ G          F+       N                           ++W N+KG+ ++ A+ N+  N  +     +       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L  IN+ILK V LIFP F LGRG++D+  N    ++++ +   N     + WD+ G  LF++    + ++ + ++I+    I  R +  KL             ED DV  ER+R++   + +D+L +  LTKIY +                     R+ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct:  264 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGGEGDNSTDEDSQVAYDNSTTPYCNDLMQNLESSPLYRM-IWRALKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWEEVRPQIKNFMESSQEMDLIRTLLTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETEN-GPFYSWREALNETDRVVLTLSRFMECVNLDKLEPVATEEMLIDKSMELLNE--RKFWAGIVFMDM-----PEEETELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIRVQTGVEK-RTGIYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPLEENGYNITTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWCGEECKEYNQPHTVQKGSSEVC------MEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLKGLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDS-DMDPESRETDYLSGIDGKGSYQLKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMY------DEQYTFFSNDAPD----------------DQGTQALLKALIDKPGFGTAFSCSGEEEEWSTQFVSQSVMDLFLNGNWTMENPSPSCECSSDKRKKMLPICPPGAGGLPPFQRR-QNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFSLGASNSPALPSVVGKLLKIFG---------AFMKGLDTKDN--------------------------VKVWFNNKGWHAVGAFLNVM-NNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNN--KLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFVSPMSWDLVGRNLFAMAVEGVVFFAITLMIQYRFFIKPRPVNAKLPPVV--------DEDEDVARERQRINEGGR-NDILELKGLTKIYRM--------------------KRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1880          

HSP 2 Score: 174.481 bits (441), Expect = 8.621e-43
Identity = 84/228 (36.84%), Postives = 133/228 (58.33%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    ++G A++ N  I   +  + Q +G CPQ++ + + LT  +H+  Y LL+ + + E+  V    I+ + L +     + + SGG KRKLS A+A IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY
Sbjct: 1836 LELKGLTKIYRMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEWAIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGY 2063          

HSP 3 Score: 65.855 bits (159), Expect = 7.748e-10
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
             QL  LLWKNF  +RR+   L++E+  PL + FIL +VR S   Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    5 TQLGLLLWKNFTYRRRQTLQLVVEVAWPLFIFFILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 841.262 bits (2172), Expect = 0.000e+0
Identity = 577/1727 (33.41%), Postives = 897/1727 (51.94%), Query Frame = 1
Query:  478 VMSENETTIESGYNELGEIICGSPE--------------NDFKLFMR-NFIKNQR----RKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKIC---------------DAVNTLFNIT--------------NVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXX------------------XXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKL-----INKEKSYY--SYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKM--------GKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS-PA---SILDIPMV--------SPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLK-FIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYN---SNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            V     TT     N L ++ CG PE              N++K+F+  N  K +      K +   C  + QS   N   K   ++ + PL+ GKV Y P+   +R+I++KAN TF+ L+ +R     W       L ++  ++V +N V+   K     NP +                D +N L+N                N+ +  D   +LF+   + + C  LD+F   +   D   LT+ +        F A ++F + F + T    + + Y+IR+ +  ++ T K K  DR+W P PR +   D +Y+  GF +LQ+ ID   I+  T+ E +  G  +  MPYPC++ D F+  L    P  +V+AW  S+++L+K IV EKE RLKE MK MG+ N V W++ FI +  V+    ++++V + +  +   S+  ++F  +  + I+ I Q F++SVFFSKAN+A+   G++YFT Y+  ++    +  +++ +      LS VAF    +++  +E+   G+Q+ N+ ++P E   +     I +M++D+FIY  + WY++ VFPG+YG+ KPW F    +YW                       +  FE EP  +  G+ I +LVK+Y +   P ++ +N+ FYE QITAFLGHNGAGKTTT+SI+TG+F P+SGT ++   DI+T MDSIRQ +G+CPQ+N+LF  LTVE+HI FY  LK   + + E     +++D+ +  K N  + +LSGGM+RKLS+A+AF+G S+VV LDEPT+GVDP++RR IWDLL+KYRS  RTIIL+THHMDEAD L DR+AI+SQGKL C GS +FLK  FG G+YL+L++   N  ++                    +   + + +  ++ +A+++E    +   +LP  D   R +  LF+ L++ + ++ + S+G+SDT LEEV   +  +  N +      N + + Y  S++C   K    IN        ++  D + S+        +KG  LLQQQ  AL IKR+ +A R  K F A+++LP   +L  ++F  I     +   + + PW+   +         G E + TF      S GL               G RCM         YQC   N +N W+ PA   S+ ++ +         SP C CS     +    C +  +GG P   RI  SS+ + +LT  NISD+LLK +P L R           + YGG      LP        ++    F+ ++    N +     ++    L+ F+  L+    I        ++W N+KG+ SM  + N+ +N  +      +     ++GI+  N P+ + +       V    +++ +AI VIF +SFIPASFV++L++ERVS +K  QFVSG+ P +YW++NF WDI+ Y I + +++IIFIAFD ++Y  S N  A I LL FYG A+IP MYP S+  + PSTA+V L+  NL +G  ++  TFILD+ E N   LK  N+ LK + LIFP F LGRG++DL  N       +    +H  N  QW+  G  +F++    + ++ + ++I+    +R       +   K   +   ED DV  ER+R+      +D+L++  LTK Y             GK        +  AV+ LC GVR GECFGLLGVNGAGKTTTF
Sbjct:  304 VQDGGPTTFTQLINSLSDLFCGYPEGGGARVFSFNWYEDNNYKVFLGVNSTKKETYYLYDKTTTPFCNALIQSMESNPATKIA-WSAMKPLLMGKVLYSPDSPAVREILKKANSTFEQLERVRQMGKAWE-EVGPQLWNFFHSSVQMNLVRDTIK-----NPTVKEFLTRQLGDEGLTADDVINFLYNGNQDERPEGQVNYDWRNIFNITDHAIRLFN---QYMGCLTLDKF---EGHDDESHLTHHALYLLEENKFWAGLVFLDMFPW-TNTLPSHVKYKIRMDIDAVEKTKKIK--DRYWDPGPRADPVEDMRYIWGGFAYLQDMIDHGIIKSQTSTE-VPAGIYLQQMPYPCFVDDVFMITLNRCFPIFMVLAWIYSISMLVKDIVLEKELRLKETMKNMGVTNDVIWLTRFIDSFTVMTTSTILLTVVIVVGGVLHYSNPIILFCFLMAFTIATIMQAFLMSVFFSKANLAAACSGVIYFTLYLPHILCFAWQDRMTIKLKTLASFLSPVAFGFGTEYLSRYEEQGLGLQWGNIRKSPMEGDEYSFLFSIFMMLLDAFIYWTLAWYIDHVFPGEYGIPKPWYFPFLATYWC----------------------NPFFEPEPPGMVPGVYIQDLVKVYENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKKDSISALNGSVFNPMYTGDVSGLTELIHHHVPEAKLLESIGQELIYLLPSKDFKFRAYASLFRELEETLGDLGLSSFGISDTPLEEVVYHIPVNSGNNIGPCMYRNSQCTLYFDSHHCKAEKNPPNIN--------DREADGRGSR-------QIKGTELLQQQFNALIIKRFKHATRSHKDFFAQIVLPASFVLLALVFTLIVPPFGEYPSLTLHPWIYGQQFVFFSNEQPGNEQMATFSNAFLNSPGL---------------GTRCMKDQPLS-KKYQC--TNTSNEWTMPAVSPSVTNMLLSQEWTRDNPSPSCTCSSRSKLMMLPECPE-GAGGRPPPQRIQPSSEIIQDLTERNISDFLLKTYPDLIRSSMKSKYWVNEQRYGGISVGGKLPVLHVKGGDIVS---FFSQVGQMTNVTAGTTTKAISQELQTFLQNLETEDNI--------KVWFNNKGWHSMVIFINV-ANNAILRANLGADKDPEEFGITTMNHPLNLTKDQLSEVTVLTTSVDVVVAICVIFAMSFIPASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFENNRSLLK-FNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARFGEEHVSNPFQWEFLGRNIFAMAVEGVVYFTLNLLIQ----HRFFFSTWFSEPPK--GLVEGEDEDVAQERQRVIKGGGKNDILKLKELTKTY------------PGK--------QSPAVDRLCVGVRPGECFGLLGVNGAGKTTTF 1917          

HSP 2 Score: 179.489 bits (454), Expect = 2.397e-44
Identity = 102/318 (32.08%), Postives = 174/318 (54.72%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            + +  L K YP  + P ++ L +     +    LG NGAGKTTT  +LTG    +SG A +    I  ++  + Q  G CPQ++ + D LT  +H+  YG L+ + ++EI+ V    I+ + L +  + L+   SGG KRKLS A+A IG   VV LDEPT G+DP +RR +W+ ++      R ++LT+H M+E + L  R+AI+ +G  +C G++  LK KFG+G Y+  +K + +      +   + KF++     +   E+    + ++  Q  ++S     +F+ L  +   ++I  Y +S T+L++VF+  A
Sbjct: 1873 LKLKELTKTYPGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGRAVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDG-YIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQREK---HYNML--QYQLSSSSLARVFQLLISNKDSLNIEEYSVSQTTLDQVFVNFA 2184          

HSP 3 Score: 59.3066 bits (142), Expect = 8.363e-8
Identity = 28/79 (35.44%), Postives = 44/79 (55.70%), Query Frame = 1
Query:   22 SNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            S +++ LLWKN+ L++R+   + +EL  PL + FIL  +R++   Y    C F  K M S G +P+L    C  N  C+
Sbjct:    4 SAKVKLLLWKNWTLRKRQKLRIFVELVWPLSLFFILVWLRNANPLYGQHECHFPNKAMPSAGLLPWLHGIFCNTNNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 841.262 bits (2172), Expect = 0.000e+0
Identity = 578/1720 (33.60%), Postives = 890/1720 (51.74%), Query Frame = 1
Query:  514 YNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT--------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---RLHFQTFL-----LDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKD-IDK---LTNQSFRNFLAVIIFNETFQYLTPKNTTFL----SYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIP--LMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXX---------------------------XXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-------NKLINKEKSY-YSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPM--------VSPECDCSKTGNQ----ICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLN------SLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF-------YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESG--IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            Y  +  I+CG PE              N++K LF      N   + S +         C  + Q+   + + +  ++  L PL+ GK+ Y P+    + ++ + N TF+ L   R     W   R   + F+     +D I   +     K F     ++     + ++            +     +SW E             R + C  LD+  P+ + +  IDK   L N+  R F A I+F +      P+  T L     Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ ++QA I + T  E    G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W+SWFIS+++ L++   ++ + L+   +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+      LS VAF    +     E+   GVQ+ NL ++P E   + +     +M+ D+ +Y ++TWY+EAVFPGQYG+ +PW F   +SYW        + P  + + +++ C       E EP +L LG+SI NLVK+Y + K   ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P++GTAYI+ +DIRTE++SIRQ +G+CPQ+NVLFD+LTVE+HI+FY  LK + + ++++ + +++ DV L  K    +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LLIKYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K  N+ S                               +   I   +  ++ +AR++E+   + T VLP        F ELF  +D  ++++ I SYG++DT+LEE+FLKVADD           L  + K Y +  + + L+     +A  T    + +P+ +++ +L   D    + LK + L++QQ  AL  KR  YAKR  KGF A+++LP + +L  ++F  I     K   +++ PW     M  E    F        G    L++    D    G  CM    + +    C    E   WS      S++D+ +         SP C+CS    +    IC     G PP   R   +SD L NLTG NISDYL+K + ++  K      +V    +G  S    +SP      + V  +  NH +  L       + +F+D      K    K +  ++W N+KG+ ++ A+ N+  N  +     +       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  Q +SG+ P +YW++NF+WD++             +          +N L           +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L  IN+ILK V LIFP F LGRG++D+  N         +  N  V    + + WD+ G  LF++    + ++ + ++I+    I  R +  KL             ED DV  ER+R++   + +D+L +  LTKIY +                     R+ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct:  292 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGGEGDNSTDEDSQVAYDNSTTPYCNDLMQNLESSPLYRM-IWRALKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWEEVRPQIKNFMESSQEMDLIRTLLTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETEN-GPFYSWREALNETDRVVLTLSRFMECVNLDKLEPVATEEMLIDKSMELLNE--RKFWAGIVFMDM-----PEEETELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIRVQTGVEK-RTGIYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPLEENGYNITTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWCGEECKEYNQPHTVQKGSSEVC------MEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLKGLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKKFMTGFLLLCFAGLTDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDS-DMDPESRETDYLSGIDGKGSYQLKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPW-----MYDEQYTFFSNDAPDDQGTQALLKALI--DKPGFGTACMEG--HSVMKVSC--SGEEEEWSTQFVSQSVMDLFLNGNWTMENPSPSCECSSDKRKKMLPICPPGAGGLPPFQRR-QNTSDILQNLTGRNISDYLVKTYSQIIEKSLKNKIWVNEFRYGGFSLGASNSPALPPNEEVV--ASINHIKKRLELPQNGAANRFLDSFGAFMKGLDTKDN-VKVWFNNKGWHAVGAFLNVM-NNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMVSLSNIKNTKQPHRL----------QNKL----------WSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNN--KLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFV----SPMSWDLVGRNLFAMAVEGVVFFAITLMIQYRFFIKPRPVNAKLPPVV--------DEDEDVARERQRINEGGR-NDILELKGLTKIYRM--------------------KRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1920          

HSP 2 Score: 177.948 bits (450), Expect = 6.803e-44
Identity = 106/324 (32.72%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADA------RMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    ++G A++ N  I   +  + Q +G CPQ++ + + LT  +H+  Y LL+ + + E+  V    I+ + L +     + + SGG KRKLS A+A IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY + +    +N           LK V+ + + A      +    S LQ+ +   Q+ + +R F+ L KN  +    + I  Y +S T+L++VF+  A
Sbjct: 1876 LELKGLTKIYRMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEWAIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRIAGSNPD---------LKPVEEFFSHAFPGSVLKEKHRSMLQYQLRSSQSSL-ARIFSILSKNKKR----LHIEDYSVSQTTLDQVFVNFA 2185          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Mouse
Match: Abca1 (ATP-binding cassette, sub-family A (ABC1), member 1 [Source:MGI Symbol;Acc:MGI:99607])

HSP 1 Score: 885.174 bits (2286), Expect = 0.000e+0
Identity = 595/1730 (34.39%), Postives = 930/1730 (53.76%), Query Frame = 1
Query:  514 YNELGEIICGSPEND-FKLFMRNFIKNQRRKRSLL--TCQLIFQSFFQNSIVKFE---------------MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFK---ILDNLRLASVEWRLHFQTF------------LLDYISNNVF-------INDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTF---LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDL-TEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQ----------NPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWS----PASILDI--------PMVSPECDCS----KTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGW-SSKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            Y  +  I+CG PE    K+   N+ ++   K        +    +F+ NS   +                ++  L PL+ GK+ Y P+    RQ++ + N TF+   +  +L     E      TF            LLD   N+ F       ++   +   A+ + NP+   + N   ++   +   +  ++    I R + C  L++  P+ +     +L N+S      R F A I+F      +TP +      + Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ ++QA I ++T +E  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IKSIVYEKE+RLKE M++MGL+N + W SWF+S+++ L++   ++ V L+L  +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  ++     LLS VAF    ++   +E+   GVQ+ NLF++P E   F +   + +M+ D+F+Y ++TWY+EAVFPGQYG+ +PW F C +SYW       +S P     +    ++    E EP +L+LG+SI NLVK+Y       ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYIL +DIR+EM SIRQ +G+CPQ+NVLFD LTVE+HI+FY  LK + +  +++ + ++  DV L   K+ + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   ++ ++++AR++E+   + T VLP        F ELF  +D  ++++ I SYG+S+T+LEE+FLKVA++     ++ E S  +      +       +    F             +P+ +++  L   D    + LKG+ L QQQ +AL  KR   A+R  KGF A+++LP + +   ++F  I     K   +++ PW+   +       TF   +        +L +    D G  G RCM  NP    + +  C    E+  W+    P SI+D+           SP C CS    K    +C     G  P   R   ++D L NLTG NISDYL+K + ++  K            YGGF   + ++     S  + D+   ++++  +  ++ +     L+SL +F+  L     +        ++W N+KG+ ++ ++ N+ +N +LR+ L K       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L +INDILK VFLIFP F LGRG++D+  N    ++++ +   N     L WD+ G  LF++    + ++++ ++I+     R    K K   L      N ED DV  ER+R+      +D+L +  LTKIY                     + R+ AV+ +C G+  GECFGLLGVNGAGK+TTF
Sbjct:  301 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNNTEEDVDTFYDNSTTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPQIWTFMENSQEMDLVRTLLDSRGNDQFWEQKLDGLDWTAQDIMAFLAKNPEDVQSPNG--SVYTWREAFNETNQAIQTISRFMECVNLNKLEPIPTEV---RLINKSMELLDERKFWAGIVFTG----ITPDSVELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGSEK-KTGVYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKSIVYEKEARLKETMRIMGLDNGILWFSWFVSSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAMVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFSIKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTAVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWFGEEIDEKSHP----GSSQKGVSEICMEEEPTHLRLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE---SGVDAETSDGTLPARRNRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQY------TFVSNDAPEDMGTQELLNALTKDPG-FGTRCMEGNP----IPDTPCLAGEED--WTISPVPQSIVDLFQNGNWTMKNPSPACQCSSDKIKKMLPVCPPGAGGL-PPPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNSQALPPSHEVNDA--IKQMKKLLKLTKDSSADRFLSSLGRFMAGLDTKNNV--------KVWFNNKGWHAISSFLNVINNAILRANLQKGE-NPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNN--KLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVKAKLPPL------NDEDEDVRRERQRILDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTF 1956          

HSP 2 Score: 181.415 bits (459), Expect = 4.091e-45
Identity = 102/320 (31.87%), Postives = 169/320 (52.81%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + I  L K+Y   + P ++ + +     +    LG NGAGK+TT  +LTG    + G A++    I + +  + Q +G CPQ++ + + LT  +H+ F+ LL+ + + E+  V    I+ + L +     + + SGG KRKLS AMA IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           + SN + + + +F  +    + + E+ R      LP    +      +F  L Q    + I  Y +S T+L++VF+  A D
Sbjct: 1912 LEIKELTKIYRRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIVVRIAGSNPDLKPVQEFFGLAFPGSVLKEKHRNMLQYQLPS---SLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKD 2223          

HSP 3 Score: 65.855 bits (159), Expect = 5.861e-10
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            QLR LLWKN   +RR+   LL+E+  PL +  IL +VR S   Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    6 QLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Mouse
Match: Abca4 (ATP-binding cassette, sub-family A (ABC1), member 4 [Source:MGI Symbol;Acc:MGI:109424])

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 543/1727 (31.44%), Postives = 888/1727 (51.42%), Query Frame = 1
Query:  523 LGEIICGSPE--------------NDFKLFMRNFIKNQRR-------KRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLR--------LASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSS--------ESIPL---MRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXX--------------------------------XXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLI-------NKEKSYYSYYCNILKMKLRINA----TKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWL--------MMSKMGKENLNTFYRKENISLGLINK-LESEYRSDLGESGIRCMNPSIYRLDNYQCFYRN--ENNMWSPASILDIPMVSPECDCSK----TGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQAN-HNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNY-FYNSNSIVKHEY--NALQWDIAGEKLFSLFSLSIGWWIVLIIIESG-IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            L +++CG PE              N++K F+   I + R+       KR+   C  + QS   N + K   +    PL+ GK+ + P+    R+I++ AN TF+ LD +R        +    W    ++  +  I + +    VK F            +AV   F+    +   D ++  F W +             + L C  LD+F   +S  D  +LT ++        F A ++F   + + +      + Y+IR+ +  ++ T K K  DR+W   PR +   DF+Y+  GF +LQ+ ++Q  ++     E   +G  +  MPYPC++ D F+  L    P  +V+AW  SV++ +K IV EKE RLKE +K  G++N V W +WF+ +  ++ + + ++++ +   +I   S   ++F  +  +  + I Q+F++S  FSKA++A+   G++YFT Y+  V+    +  ++  +  +  LLS VAF    ++++ +E+   G+Q+SN+ ++P E   F     + +M++D+ +Y L+ WY++ VFPG YG   PW FL   SYW+     S        ++ PL   M +      +N   FE E   L  G+ + NLVK++  +  P ++ LN+ FYE+QITAFLGHNGAGKTTT+SILTG+  P+SGT  I  +DI T +D +RQ +G+CPQ+N+LF  LTV +HI FY  LK     E +  +  +++D  L  K N  +  LSGGM+RKLS+A+AF+G+S+VV LDEPT+GVDP++RR IWDLL+KYRS  RTII++THHMDEAD L DR+AIISQG+L C G+ +FLK  FG G+YL+L++                                        + + + ++  V  ++ +A+++E    +   +LP  +   R +  LF+ L++ +A++ + S+G+SDT LEE+FLKV +D     +        +E++   + C+    KLR  A    T +   ++    Q   +  D       G  L+ Q + AL +KR+H+  R  K F+A+++LP   +   ++   I     +   + + PW+         M +   E+L           G  N+ L+ E+  +       C+N + ++  +      +  +   W+ A        SP C CS     T    C +  +GG P   R   S++ L +LT  NISDYL+K +P L R           + YGG      LP+       L+G   F   L   +N S      +++   L F+ +L+ T  I        ++W N+KG+ ++ ++ N+  N +LR+ L +      +YGI+V + P+ + +       V    ++  +AI VIF +SF+PASFV++L++ERV+ +K  QF+SG++P  YW++NFLWDIM Y +   +++ IFI F  ++Y    N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TF+L++ E N   L+  N +L+K+ ++FP F LGRG++DL  +    +  +    EY  N  QWD+ G+ L ++    + ++++ ++I+    + R I    +            ED DV  ER+R+ S     D+L++  LTK+Y                    + +   AV+ LC GVR GECFGLLGVNGAGKTTTF
Sbjct:  319 LSDLLCGYPEGGGSRVFSFNWYEDNNYKAFLG--IDSTRKDPAYSYDKRTTSFCNSLIQSLESNPLTKI-AWRAAKPLLMGKILFTPDSPAARRIMKNANSTFEELDRVRKLVKAWEEVGPQIWYFFEKSTQMTVIRDTLQHPTVKDFINRQLGEEGITTEAVLNFFSNGPQEKQADDMTS-FDWRDIFNITDRFLRLANQYLECLVLDKF---ESYDDEVQLTQRALSLLEENRFWAGVVFPGMYPWAS-SLPPHVKYKIRMDIDVVEKTNKIK--DRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGIVKSQMQAEP-PIGVYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKGIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMALSIFLLTLFIMHGRILHYSDPFILFLFLLAFATATIMQSFLLSTLFSKASLAAACSGVIYFTLYLPHVLCFAWQDRMTADLKTTVSLLSSVAFGFGTEYLVRFEEQGLGLQWSNIGKSPLEGDEFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEPLTEEMEDPEHPEGMNDSFFERELPGLVPGVCVKNLVKVFEPSGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLIGGKDIETNLDVVRQSLGMCPQHNILFHHLTVAEHILFYAQLKGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDSKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDPPKGQPSPEPEDPGVPFNTGARLILQHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMYGHQYTFFSMDEPNNEHLEVLADVLLNRPGFGNRCLKEEWLPE-----YPCINATSWKTPSVSPNITHLFQKQKWTAAH------PSPSCKCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPISGEALVG---FLSGLGQMMNVSGGPVTREASKEMLDFLKHLETTDNI--------KVWFNNKGWHALVSFLNVAHNAILRASLPRDRDP-EEYGITVISQPLNLTKEQLSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFENNRTLLR-FNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAIEGVVYFLLTLLIQHHFFLTRWIAEPAREPVFD-------EDDDVAEERQRVMSGGNKTDILKLNELTKVY--------------------SGSSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTF 1981          

HSP 2 Score: 180.259 bits (456), Expect = 1.170e-44
Identity = 116/401 (28.93%), Postives = 193/401 (48.13%), Query Frame = 1
Query: 1966 VGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADA-RMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            +G  ++ M I+  +Y L+T  ++  F     +A+P     AR             P+   ++   E   +       N    + ++ L K+Y  +  P ++ L +     +    LG NGAGKTTT  +LTG  + +SG A +  + I T +  + Q +G CPQ++ + D LT  +H+Y Y  L+ +   EIE V    I+ + L+   + L+   SGG KRKLS A+A  G   ++ LDEPT G+DP ARR +W+ ++      R ++LT+H M+E + L  R+AI+ +G  QC G++  LK KFG+GY +++                   F   +     R    S LQ+        + S     +F+ L  H   + I  Y ++ T+L++VF+  A
Sbjct: 1874 IGKNLVAMAIEGVVYFLLTLLIQHHFFLTRWIAEP-----ARE------------PVFDEDDDVAEERQRVMSGG--NKTDILKLNELTKVYSGSSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTSISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKLSTAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGRAVVLTSHSMEECEALCTRLAIMVKGTFQCLGTIQHLKYKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQRERHHSMLQF-------QVPSSSLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVNFA 2248          

HSP 3 Score: 57.7658 bits (138), Expect = 1.732e-7
Identity = 26/77 (33.77%), Postives = 42/77 (54.55%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            Q++ LLWKN+ L++R+    ++EL  PL +  +L  +R++   Y    C F  K M S G +P+L    C  N  C+
Sbjct:    6 QIQLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNANPLYSQHECHFPNKAMPSAGLLPWLQGIFCNMNNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Mouse
Match: Abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:MGI Symbol;Acc:MGI:2676312])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 500/1617 (30.92%), Postives = 815/1617 (50.40%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW-----------RLHFQTF-LLDYISNNVFINDVKKFCKAYYSANP-KICDAVNTL-FNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRN--FLAVIIF-----NETFQYLTPKNTTF---LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYW-----VYNIKSSESIPLMRNNNQNCEINHQA------------FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLK--RMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXX--XXXXILKFVKIYIADARMMEESRLQWTIVLPQNDIN-SRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKL---RINATKTEIFLNQNPDQ---KQSKFLDQSDHL------LKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISL-GLINKLESEYRSDLGESGIR--CMNPSIYRLDNYQCFYRNENNMW-SPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTIS---TFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDL--------FFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            ++  L P++ GK+ Y P     + I+EK+N+T + L  LR  S EW            L  QT  +L     N F+    KF     +    K  D ++ L   + N    ID ++ L S      +C   DR    D++++++ +  Q +++      +IF         +   P+  +    + Y IR+ L    +T   +   + W P P  N+ +  +     FI+LQ++I++A IEL T   S EV   +  +PYPC++ D FL  ++  LP +L++AW   +   +K +VYEK+ RL EYMK+MG+N+  H+ +W I +I  L++ + I+ V L+   I   ++  ++F     Y  S I  ++++SVFF+  N+A++ G ++Y   +  F+V + +E ELS  +     LLS  AFS A +++  +E+   G+Q+ N++++P +      G    L++ DSFIY  I WYV  VFPG YG+A PW F    SYW        +K  +S  LM  N      N  A             E EP++L++G+++H + K+Y S     + NLNLNFYE  IT+ LG NGAGKTTTIS+LTG+F  ++GT ++  +DI+T+++++R+ +G+C Q++VLF  LT ++H+  YG +K     K ++   + R +KD  L    +     LSGGMKRKLSI++A IG SRVV LDEP+ GVDP +RR IWD++ K ++  RTIIL+THH+DEA+ LSDR+A + QG L+CCGS  +LK  FG+GY+L+L K ++ + ++N   +   +   ++ ++ +A + E+   +   VLP      S  +  L + LD+ M +++I  YG+SDT++EEVFL +  D        +KS      ++ + K+     N T T       PD      S F D+ D +      L+GF LL ++I+A+ IKR+H+ +R++KG +A++ILP++ +   +    +         + ISP    S  G      FY   + S  GL++ L           GI   C+N S     + QC  +++   W +    +D   V   C CS    Q C       P   +R   SS  + NLTG ++ +YL+       +K YGG+ F +        KL  D      LR  V A   N                          +  ++W + +GY S+PAY N  +N LLR  +  S      +GI + + P    Q  +   + +  ++++ +A+ ++ G S   ASFV ++V E  + +K+ Q +SGI    YWV+NF++D++ Y++P+   I +   F   ++    N  A  LLL+ +G A    MY  +        AF+     NL  G  + +S    + L   + N   L+ I++ LK++FLIFPQF  G G+++L        F   +      V++     + D  G    +L S    ++++ ++I   ++ ++     K +    +E  + ED DV  ER R+ S     D++++  LTK Y +  K                  + +AVNN+  G+  GECFGLLGVNGAGKTT F
Sbjct:  794 IWAFLKPMLLGKILYSPYNPTTKAIMEKSNVTLRQLAELREKSQEWMDKSPIFMNSFHLLNQTIPMLQNTLRNPFVQVFVKFSVGLDAVELLKQIDDLDVLRLKLVNNIDIIDQLNTLSSLTVNISSCVLYDRIQASDTVEEMETVAEQLYKSNELFGSVIFKLPSNGSLHRGFDPEKVSLPPIVRYTIRMSLKTAQTTRSIRT--KIWAPGPH-NSPSHNQIYGRAFIYLQDSIERAIIELQTGRNSQEVAVQVQAVPYPCFMKDNFLTSVSYSLPIVLMVAWVVFIAAFVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLIESIGFLLVTIAILIVILKFGNILPKTNGFILFLYFSDYSFSVIAMSYLISVFFNNTNIAALIGSLIYVIAFFPFIVLVTVEDELSYVIKVFMSLLSPTAFSYASQYIARYEEQGVGLQWENMYKSPVQDDTTSFGWLCCLILADSFIYFFIAWYVRNVFPGTYGMAAPWYFPILPSYWKERFGCAEVKHEKSNGLMFTNIMMQNTNPSASKTSPDCAFPSNIEPEPKDLQVGVALHGVTKIYGSKT--AVENLNLNFYEGHITSLLGPNGAGKTTTISMLTGLFGATAGTIFVYGKDIKTDLNTVRKNMGVCMQHDVLFSYLTTKEHLLLYGSIKVPHWTKTQLHEEVKRTLKDTGLYSHRHKRVGTLSGGMKRKLSISIALIGGSRVVILDEPSTGVDPCSRRSIWDVISKNKTA-RTIILSTHHLDEAEVLSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKKKSPNLDTNAICDTVAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDKGMGKLNIGCYGISDTTVEEVFLNLTKD-------SQKSSNMSLEHLTQRKVGNPSANGTST-------PDDLSVSSSNFTDRDDKVLTRSEKLEGFGLLLKKIMAILIKRFHHTRRNWKGLIAQVILPIVFVATAMGLGTLRDSSNSYPEIMISP----SIYGTSEQTAFYANFDPSTSGLVSAL-------WNFPGIDNVCLNTS-----DLQCLKKDDLGKWNTSGEAIDNFGV---CSCSD-NVQECPKFNYHPP---HRRTYSSQVIYNLTGKHMENYLITTANHFVQKRYGGWSFGM--------KLTND------LRFDVTAVPDNR-------------------------TLAKVWYDPEGYHSLPAYLNSLNNFLLRVNM--SEYDAARHGIIMYSHPYPGVQDQEQATISS--LIDILVALSILMGYSVTTASFVTYIVREHQTKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAFSIGVIAIFKLPAFYSGNNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELSQQQAVLDFLKAYG-----VEYPSETFEMDKLGAMFVALVSQGTMFFLLRLLINEWLIKKLRLFFRKFTSSPIMETVD-EDEDVRAERFRVESGAAEFDLVQLHRLTKTYQLIHK------------------KIIAVNNISLGIPAGECFGLLGVNGAGKTTIF 2300          

HSP 2 Score: 184.111 bits (466), Expect = 8.122e-46
Identity = 110/353 (31.16%), Postives = 188/353 (53.26%), Query Frame = 1
Query: 2125 SIPLMRNNNQNCEINHQAFESEPENLKLG-ISIHNLVKLYP--SNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIR-TEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            S P+M   +++ ++  + F  E    +   + +H L K Y     KI  +NN++L     +    LG NGAGKTT   +LTG   PSSG   I N+      +DS    +G CPQ + L D +TVE+H+YFY  +  + + +I+  + ++++ + L    +  +   S G KRKLS A+A IG   ++ LDEP++G+DP ++R +W ++ +   +  ++ILT+H M+E + L  R+AI+  G+ QC GSL  +K +FG G+ + +    N  S         L F K Y+ D  +   S L++ +      + +     +F  L+ +   ++I ++ +S T+LEEVF+  A D
Sbjct: 2224 SSPIMETVDEDEDVRAERFRVESGAAEFDLVQLHRLTKTYQLIHKKIIAVNNISLGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRNKSGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKDTVHKLLRRLHLMAYKDRSTSMCSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKRHLWRIISEEVQNKCSVILTSHSMEECEALCTRLAIMVNGRFQCIGSLQHIKSRFGRGFTVKVHLKNNKVSMETLTKFMQLHFPKTYLKDQHL---SMLEYHV-----PVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2568          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Mouse
Match: Abca13 (ATP-binding cassette, sub-family A (ABC1), member 13 [Source:MGI Symbol;Acc:MGI:2388707])

HSP 1 Score: 573.548 bits (1477), Expect = 5.904e-169
Identity = 462/1617 (28.57%), Postives = 796/1617 (49.23%), Query Frame = 1
Query:  619 CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFL-----LDYISNNVFINDVK-----KFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGL------------NCTELDRFIPLDSLKDIDKLTNQSFR--NFLAVIIFNETFQYLTPKNTTF-----LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIF--LQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYW------VYNIKSSESIPLMRNNNQ--NCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKR--MDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXX-XXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNT-FYRKENISLGLINKLESEYRSD--LGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEV--NYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLS-IGWWIVLIIIESGIVNRIIC---GKL-----KNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            C  ++Q   Q+      +++ L P++ GK+ Y PN   I ++I+KAN TF  +D +++ S       +TFL          N    N ++     KF + +  +   I   ++ L    ++++Y   + K+F+ +E G             +C  LDRF  ++++  ++   ++  +  +FLA IIFN + ++   ++        ++Y IR  +  + S     + +  W  +P+      FKY    +IF  LQ+ I++A I + T  ES+E  +     PYPC+  D FL  +    P ++++ W  +V  +++ +VYE+E +++EYM++MGL+  +H++SWF+  +  L +    ++V L++S I   S   ++F  +  + +S +  ++ +SVFF++AN A++   + Y   ++ +VV + L  +LS  +     LLS  AF   V F+ + E   EG+Q+ N+++ P E      G    +++ D+ +Y L  WY   + PG +G+ KPW F    SYW      +   + S S  L   N    N  ++ Q    E E    G+++ ++ K Y  +K+ V   L L F+  QITA LG NGAGKTT IS+L G+F P+SGT  I  ++++T++  +R+++G+CPQ +VL D+LTV +H+  +  +K       E++  + + + +V+LT+  +  +  LSGGMKRKLSI +AF+G S+ V LDEP++GVDP +RR +WD+L+KYR   RTII TTHH+DEA+ LSD VA++ QG+L+C      LK  +G+G  L+L K      +   ++   +   ++IYI  A + +    + T  +P+ D +   F  L + LDQ++  + +  YG+SDT+LEEVFL +  D        +KSY +    +     R     +   ++      +    +     + G  LL  Q +AL  KR  +  R +K   ++L+LPVL +   +    +  L     P++++P         E   T F+   N    L + L  ++R    +     R MN S +  D Y                   P     C C K  N      +S G P+    +  +  L NL+GY++ +YLL    K             P   GWS    G  P         +A     N S   +L                    ++W N KG+ S+P+Y N  +NL+L   L  +AV +  YGI++ + P       +  D + + I +  +A+ ++ G S + AS    +V +RV+G+KR Q +SG+    YW+ NFL+D++ Y++ + + + +  AF   ++   +N  A  LLL  +G A+IP MY  S   S+   AF+   + N + G  T + T +  +L +    + L++I ++LK  F IFPQF LG+G+++L +N        +K++   L  +   +   S F ++ +GW  V + ++   +  +     G L      +S L+ I ++  +D DV  E+ R+   +   D++ + NL+K Y                       +  AV+ +  G+  GECFGLLGVNGAGK+TTF
Sbjct: 3258 CLKLYQEILQSPNGAL-VWSFLKPVLHGKILYTPNSPEINEVIQKANYTFYFVDKIKVLS-------ETFLKISKLFQGSGNGQMFNQLQDALRNKFIRNFVESQLHI--DMDKL--TEDLQTYGRMLDKMFNHVEAGHFRFLGGMLANLSSCVVLDRFQAVETVDTLETKAHELMQQNSFLASIIFNSSLRHRHIRSAPHKLPPHVTYTIRTNV--LYSMRTDMIKNPSWKFHPQNLPAGGFKY---NYIFVPLQDMIERAIIVVQTGQESLEPTTQAQAAPYPCHTSDLFLNNVGFFFPLIMMLTWMVAVASMVRKLVYEREIQIEEYMRMMGLHPTIHFLSWFLENMATLALSSAALAVILKMSGIFMHSDAFIIFLYLLDFGVSAVMMSYFLSVFFNQANTAALCTSLGYMISFLPYVVLLVLHNQLSFAIQTLLCLLSTTAFGQGVFFITFLEGQEEGIQWGNMYRAP-EPGGMTFGWVCWMILFDAILYFLGGWYFSNLVPGTFGLGKPWYFPFTASYWKSICGLMERRRCSLSSGLFFFNEDFGNKGLSQQNGPGEMEGGNPGVALISVTKEYEDHKVAV-QELTLTFHRDQITALLGTNGAGKTTIISMLMGLFPPTSGTITINGKNLQTDLSKVREELGVCPQQDVLLDNLTVREHLMLFASIKAPWWTTKELQQQVNKTLDEVELTQHQHKPAGVLSGGMKRKLSIGIAFMGMSKTVVLDEPSSGVDPCSRRSLWDILLKYRE-GRTIIFTTHHLDEAEMLSDHVAVLQQGRLRCYAPPADLKETYGQGLTLTLSKQPSILETQEPKDVARVTSLIQIYIPQAFLKDSCGGELTYTIPK-DADRTCFKGLCQALDQNLQHLHLTGYGISDTTLEEVFLMLLQD------TNKKSYITPDNKVEPQNERPVGPLSPHNVSPLSTPPEGALPEP----IGGCQLLLGQAVALLRKRLLHTLRAWKSTTSDLLLPVLFVALAMGLFMVQPLAITYPPLKLTPG------HYETAETYFFSSGNHGPDLTHVLLRKFRDQDPVCADAFR-MNSSSWHRDPYSG-----------------PESQDSCGCLKCPN------KSAGAPSLTNCLGHT--LLNLSGYDVEEYLLVPSAK-------------PRLGGWS--FGGQIP--------NDAEDVKTNTSKPRTL-------------------AKVWYNQKGFHSLPSYLNHLNNLILWHHLPANAVDWRQYGITLYSHPYGGALLNE--DRILESIRQCGVALCIVLGFSILSASIGSSVVRDRVTGAKRLQHISGLGHRTYWLINFLYDMLFYLVSVCLCVAVIGAFQLTAFTFRENLAATALLLALFGYAMIPWMYLMSRIFSSSDVAFISYISLNFIFGLCTMLMTTMPRLLAIISKAQNLQKIYNVLKWAFTIFPQFCLGQGLIELCYNQ-------IKYD---LTHNFGIDSYVSPFEMNFLGWIFVELTLQGTFLLLLRLMLHGDLLRWPRDHSVLQDI-VKPAKDIDVETEQMRVLEGRTGGDMMVLCNLSKSYRSVF-----------------GGKTTAVHGISLGIPRGECFGLLGVNGAGKSTTF 4739          

HSP 2 Score: 146.362 bits (368), Expect = 2.667e-34
Identity = 97/329 (29.48%), Postives = 164/329 (49.85%), Query Frame = 1
Query: 2224 NLVKLYPS---NKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILN-EDIRTEMDSIRQK---IGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARM-MEESRLQ--WTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMN 3180
            NL K Y S    K   ++ ++L     +    LG NGAGK+TT  IL G   PSSG   I   +    ++ S  +    IG CPQ + L + LT  +H+ +Y  L+ + K  I  V   +++ + L   ++      SGG +RKLS A+A +G   ++ LDEP++G+DP ++R +W  + +        +LT+H M+E + L  R+AI+  G  +C G    +K +FG+GY + +  ++     S  +    L F  I     R+ + E  +Q  W  +            +LFK L+ + + ++I  Y +S T+LE+VF+  A + + 
Sbjct: 4696 NLSKSYRSVFGGKTTAVHGISLGIPRGECFGLLGVNGAGKSTTFKILNGETPPSSGYTVIRTPQGDMVDLASAGKAGILIGYCPQQDALDELLTGWEHLQYYCRLRGIPKQYIPEVAADLVRRLHLESHVDKPVATYSGGTRRKLSTALALVGKPDILLLDEPSSGMDPCSKRYLWQTITQEVRDGCAAVLTSHSMEECEALCTRLAIMVDGSFRCLGPPQHIKNRFGDGYTVKVWLHKEGSQPSAVSDCLKLHFPGIQFKGQRLNLLEYHVQKSWECL-----------ADLFKVLENNKSLLNIEHYSISQTTLEQVFVNFATEQLQ 5013          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 544.658 bits (1402), Expect = 3.927e-161
Identity = 344/1046 (32.89%), Postives = 538/1046 (51.43%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMG-------------------PIP-----FLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALN---------------VPKFMKWITSNP------NEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNEL-GEIICG-----SP---------ENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWR-LHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTT-------FLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYY 2898
            +  QL  LLWKN+  +RR+   LL+EL  PL + FIL AVR S    +   C F  K + S G                   P P      L++F  +  +     T+    G ++ +    +G +  +  ++  GA                 + K ++  + +P      +   +  ++   +++ ++ L S +            +G  EL  E +C      SP          N    FM   +       SL      F     +  V   ++  L PLI GK+ + P+    R+++ + N TF+ L  LR     W  L  Q F  ++++++  +  +++      +   +          +  +K ++D     +SW E             + + C  LD+   L+++   + L +++      R   A I+F      L P   +        L ++IR+ +   D T   K+ D+FW P P  + F D +YV  GF++LQ+ ++QA + ++    S   G  +  MP+PCY+ D FL+ L+  LP  L +AW  SV + +K++V EKE+RL+E M+ MGL+  V W+ WF+S +   ++   ++ + L+L  I   S   V+F  +  + ++ + Q+F++S FFS+AN+A+  GG+ YF  Y+ +V+ +     L L    +  LLS VAF    + +   E+  +G Q+ NL   P E + F +      +++D+ IY L  WY+EAV PGQYG+ +PWNF   RSYW        S+  +    Q+ ++     E  P  L  G+SI  L K +     P +  LNL+FYE  ITAFLGHNGAGKTTT+SIL+G+F PSSG+A IL  D++T M +IR  +G+CPQYNVLFD LTVE+H++FYG LK +    +     R+I+DV LT K +  + HLSGGM+RKLS+A+AF+G SRVV +DEPTAGVDP +RRGIW+LL+KYR   RT+IL+THH+DEA+ L DRVA+++ G L CCGS +FL+R  G GYY
Sbjct:    3 LGTQLMLLLWKNYTYRRRQPIQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSLISRLLADTRTVLGGHSIQDMLDALGKLIPVLRAVGGGARPQESDQPTSQGSVTKLLEKILQRASLDPVLGQAQDSMRKFSDAIRDLAQELLTLPSLMELRALLRRPRGSAGSLELVSEALCSTKGPSSPGGLSLNWYEANQLNEFMGPEVAPALPDNSLSPACSEFVGTLDDHPVSRLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGVLGPQIF--NFMNDSTNVAMLQRLLDVGGTGQRQQTPRAQK--KLEAIKDFLDPSRGGYSWREAHADMGRLAGILGQMMECVSLDK---LEAVPSEEALVSRALELLGERRLWAGIVFLSPEHPLDPSELSSPALSPGHLRFKIRMDID--DVTRTNKIRDKFWDPGPSADPFMDLRYVWGGFVYLQDLLEQAAVRVLGGGNS-RTGLYLQQMPHPCYVDDVFLRVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMGLSRAVLWLGWFLSCLGPFLVSAALLVLVLKLGNILPYSHPVVIFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLAYFALYLPYVLCVAWRERLHLGGLLAASLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGPAEDV-FSLAQVSAFLLLDAVIYGLALWYLEAVCPGQYGIPEPWNFPFRRSYWCGPGPPKSSV--LAPAPQDPKV---LVEEPPLGLVPGVSIRGLKKHFRGCPQPALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYR-EGRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYY 1031          

HSP 2 Score: 293.508 bits (750), Expect = 1.936e-79
Identity = 249/824 (30.22%), Postives = 418/824 (50.73%), Query Frame = 1
Query: 2956 ILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLD--------NYQCFYRNE-----------NNMWSPASILDIPMVSPECDCSKTG-NQICNDLRSGGPPNSYRIMTSS--DKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFV-----LPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFT-RIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNS--NSIVKHEYNA-LQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            IL+ V+ ++  A+++E+   +  +VLP        F  +F+ LDQ +  + +  YG+SDT+LEE+FLKV +D   +  +     +   C           T  E  + +N  +   + L  +   ++G+ L  QQ+ AL  KR+  A+R  +G  A+++LP L +   + F  I     +  P+Q+SP +   ++      +F+ ++  + G  N+++    + LGE+G++   PS+   D        +  C++              +  W+P S       SP C CS+ G  ++  D  +G          +   + + NLTG N+SD+L+K +P L R+            YGGF        LP+       L        E+R  ++    N     LN+L        T    G+    + +IW N+KG+ +M A+ N  +N LL + L    V+   + I+  N P+ + +       +    +++ ++I V+F +SF+PASF + L+EER++ +K  Q VSG+   +YW+ NFLWD+  Y++ + I++ IF+AF  ++Y+  +N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G  ++++TF+L++L  + + L+E++ ILK+VFLIFP F LGRG++D+  N         +   ++ + L+WDI G+ L ++  ++ G   +LI +     NR+    L  S  + +     ED DV  ERER++      DVL + +LTK+Y            +G+        R  AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1096 ILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVEDAHREGGDSRPQLHLRTCTPQP------PTGPEASVLEN-GELAPQGLAPNAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQVVLPALFVGLALFFSLIVPPFGQYPPLQLSPAMYGPQV------SFFSED--APGDPNRMKL-LEALLGEAGLQ--EPSMQDKDARGSECTHSLACYFTVPEVPPDVASILASGNWTPES------PSPACQCSQPGARRLLPDCPAGAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGFSLGGRDPDLPTGHEVVRTLA-------EIRALLSPQPGNALDRILNNL--------TQWALGLDARNSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHA-HSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELL--SDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDKQFQSPLRWDIIGKNLLAM--MAQGPLFLLITLLLQHRNRL----LPQSKPRLLPPLGEEDEDVAQERERVTKGATQGDVLVLRDLTKVY------------RGQ--------RNPAVDRLCLGIPPGECFGLLGVNGAGKTSTF 1851          

HSP 3 Score: 177.948 bits (450), Expect = 5.651e-44
Identity = 102/320 (31.87%), Postives = 164/320 (51.25%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMME--ESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + +L K+Y   + P ++ L L     +    LG NGAGKT+T  ++TG   PSSG A +   ++  E  +  + +G CPQ + +FD LT  +H+  +  L+ + + ++       +  + L    +  +   SGG KRKL+ A+A +G+  VVFLDEPT G+DP ARR +W+ L+      R+++LT+H M+E + L  R+AI+  G+ +C GS   LK +FG G+                  E  + F++I    A + E   SRL++ +        +R F EL      H  E     + +S T+LEEVFL  + D
Sbjct: 1809 LRDLTKVYRGQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGRSVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGH-------TLTLRVPPDQPEPAIAFIRITFPGAELREVHGSRLRFQLPPGGRCTLTRVFRELAAQGRAHGVE----DFSVSQTTLEEVFLYFSKD 2117          
BLAST of ATP binding cassette subfamily A member 1 vs. UniProt/SwissProt
Match: sp|P41233|ABCA1_MOUSE (Phospholipid-transporting ATPase ABCA1 OS=Mus musculus OX=10090 GN=Abca1 PE=1 SV=4)

HSP 1 Score: 885.174 bits (2286), Expect = 0.000e+0
Identity = 595/1730 (34.39%), Postives = 930/1730 (53.76%), Query Frame = 1
Query:  514 YNELGEIICGSPEND-FKLFMRNFIKNQRRKRSLL--TCQLIFQSFFQNSIVKFE---------------MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFK---ILDNLRLASVEWRLHFQTF------------LLDYISNNVF-------INDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTF---LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDL-TEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQ----------NPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWS----PASILDI--------PMVSPECDCS----KTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGW-SSKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            Y  +  I+CG PE    K+   N+ ++   K        +    +F+ NS   +                ++  L PL+ GK+ Y P+    RQ++ + N TF+   +  +L     E      TF            LLD   N+ F       ++   +   A+ + NP+   + N   ++   +   +  ++    I R + C  L++  P+ +     +L N+S      R F A I+F      +TP +      + Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ ++QA I ++T +E  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IKSIVYEKE+RLKE M++MGL+N + W SWF+S+++ L++   ++ V L+L  +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  ++     LLS VAF    ++   +E+   GVQ+ NLF++P E   F +   + +M+ D+F+Y ++TWY+EAVFPGQYG+ +PW F C +SYW       +S P     +    ++    E EP +L+LG+SI NLVK+Y       ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYIL +DIR+EM SIRQ +G+CPQ+NVLFD LTVE+HI+FY  LK + +  +++ + ++  DV L   K+ + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   ++ ++++AR++E+   + T VLP        F ELF  +D  ++++ I SYG+S+T+LEE+FLKVA++     ++ E S  +      +       +    F             +P+ +++  L   D    + LKG+ L QQQ +AL  KR   A+R  KGF A+++LP + +   ++F  I     K   +++ PW+   +       TF   +        +L +    D G  G RCM  NP    + +  C    E+  W+    P SI+D+           SP C CS    K    +C     G  P   R   ++D L NLTG NISDYL+K + ++  K            YGGF   + ++     S  + D+   ++++  +  ++ +     L+SL +F+  L     +        ++W N+KG+ ++ ++ N+ +N +LR+ L K       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L +INDILK VFLIFP F LGRG++D+  N    ++++ +   N     L WD+ G  LF++    + ++++ ++I+     R    K K   L      N ED DV  ER+R+      +D+L +  LTKIY                     + R+ AV+ +C G+  GECFGLLGVNGAGK+TTF
Sbjct:  301 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNNTEEDVDTFYDNSTTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPQIWTFMENSQEMDLVRTLLDSRGNDQFWEQKLDGLDWTAQDIMAFLAKNPEDVQSPNG--SVYTWREAFNETNQAIQTISRFMECVNLNKLEPIPTEV---RLINKSMELLDERKFWAGIVFTG----ITPDSVELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGSEK-KTGVYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKSIVYEKEARLKETMRIMGLDNGILWFSWFVSSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAMVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFSIKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTAVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWFGEEIDEKSHP----GSSQKGVSEICMEEEPTHLRLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE---SGVDAETSDGTLPARRNRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQY------TFVSNDAPEDMGTQELLNALTKDPG-FGTRCMEGNP----IPDTPCLAGEED--WTISPVPQSIVDLFQNGNWTMKNPSPACQCSSDKIKKMLPVCPPGAGGL-PPPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNSQALPPSHEVNDA--IKQMKKLLKLTKDSSADRFLSSLGRFMAGLDTKNNV--------KVWFNNKGWHAISSFLNVINNAILRANLQKGE-NPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNN--KLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVKAKLPPL------NDEDEDVRRERQRILDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTF 1956          

HSP 2 Score: 181.415 bits (459), Expect = 2.862e-44
Identity = 102/320 (31.87%), Postives = 169/320 (52.81%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + I  L K+Y   + P ++ + +     +    LG NGAGK+TT  +LTG    + G A++    I + +  + Q +G CPQ++ + + LT  +H+ F+ LL+ + + E+  V    I+ + L +     + + SGG KRKLS AMA IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           + SN + + + +F  +    + + E+ R      LP    +      +F  L Q    + I  Y +S T+L++VF+  A D
Sbjct: 1912 LEIKELTKIYRRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIVVRIAGSNPDLKPVQEFFGLAFPGSVLKEKHRNMLQYQLPS---SLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKD 2223          

HSP 3 Score: 65.855 bits (159), Expect = 4.099e-9
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            QLR LLWKN   +RR+   LL+E+  PL +  IL +VR S   Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    6 QLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. UniProt/SwissProt
Match: sp|O95477|ABCA1_HUMAN (Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3)

HSP 1 Score: 881.708 bits (2277), Expect = 0.000e+0
Identity = 598/1739 (34.39%), Postives = 931/1739 (53.54%), Query Frame = 1
Query:  514 YNELGEIICGSPEND-FKLFMRNFIKNQRRKRSLLT--CQLIFQSFFQNSIVKFE---------------MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWR---------------LHFQTFLLDYISNNVF-------INDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPL--------DSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTF---LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDL-TEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXX------------------------------------XXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQ----------NPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWL------MMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWS----PASILDI--------PMVSPECDCS----KTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGW-SSKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            Y  +  I+CG PE    K+   N+ ++   K        +   ++F+ NS   +                ++  L PL+ GK+ Y P+    RQ++ + N TF+ L         W                +     LLD   N+ F       ++   +   A+ + +P+   + N   ++   +   +  ++    I R + C  L++  P+         S++ +D+      R F A I+F      +TP +      + Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ ++QA I ++T  E  + G  M  MPYPCY+ D FL+ ++  +P  + +AW  SV V+IK IVYEKE+RLKE M++MGL+N + W SWFIS+++ L++   ++ V L+L  +   S  +VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +  T+     LLS VAF    ++   +E+   GVQ+ NLF++P E   F +   + +M+ D+F+Y ++TWY+EAVFPGQYG+ +PW F C +SYW       +S P    +NQ   I+    E EP +LKLG+SI NLVK+Y       ++ L LNFYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYIL +DIR+EM +IRQ +G+CPQ+NVLFD LTVE+HI+FY  LK + +  +++ + ++  DV L + K+ + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIW+LL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK + G GYYL+L+K                                    + +       +   I   ++ ++++AR++E+   + T VLP        F ELF  +D  ++++ I SYG+S+T+LEE+FLKVA++     ++ E S  +      +       +    F             +P+ +++  L   D    + +KG+ L QQQ +AL  KR   A+R  KGF A+++LP + +   ++F  I     K   +++ PW+       +S    E+  T        L L+N L      D G  G RCM  NP    + +  C    E   W+    P +I+D+           SP C CS    K    +C     G  P   R   ++D L +LTG NISDYL+K + ++  K            YGGF   + +T     S+ + D+   ++++  +  ++ +     LNSL +F+  L     +        ++W N+KG+ ++ ++ N+ +N +LR+ L K       YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L  INDILK VFLIFP F LGRG++D+  N    ++++ +   N     L WD+ G  LF++    + ++++ ++I+     R      K S L      N ED DV  ER+R+      +D+L +  LTKIY                     + R+ AV+ +C G+  GECFGLLGVNGAGK++TF
Sbjct:  301 YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNGTEEDAETFYDNSTTPYCNDLMKNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPKIWTFMENSQEMDLVRMLLDSRDNDHFWEQQLDGLDWTAQDIVAFLAKHPEDVQSSNG--SVYTWREAFNETNQAIRTISRFMECVNLNKLEPIATEVWLINKSMELLDE------RKFWAGIVFTG----ITPGSIELPHHVKYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGTEK-KTGVYMQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFTLKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWFGEESDEKSHP---GSNQK-RISEICMEEEPTHLKLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYR-QGRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE---SGVDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQYTFVSNDAPEDTGT--------LELLNALT----KDPG-FGTRCMEGNP----IPDTPCQAGEEE--WTTAPVPQTIMDLFQNGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGL-PPPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNTQALPPSQEVNDA--IKQMKKHLKLAKDSSADRFLNSLGRFMTGLDTKNNV--------KVWFNNKGWHAISSFLNVINNAILRANLQKGE-NPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTDN--KLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVNAKLSPL------NDEDEDVRRERQRILDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTF 1956          

HSP 2 Score: 179.874 bits (455), Expect = 8.727e-44
Identity = 101/320 (31.56%), Postives = 169/320 (52.81%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + I  L K+Y   + P ++ + +     +    LG NGAGK++T  +LTG  + + G A++    I + +  + Q +G CPQ++ + + LT  +H+ F+ LL+ + + E+  V    I+ + L +     + + SGG KRKLS AMA IG   VVFLDEPT G+DP ARR +W+  +      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           + SN + + +  F  +    + + E+ R      LP    +      +F  L Q    + I  Y +S T+L++VF+  A D
Sbjct: 1912 LEIKELTKIYRRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIVVRIAGSNPDLKPVQDFFGLAFPGSVLKEKHRNMLQYQLPS---SLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKD 2223          

HSP 3 Score: 65.855 bits (159), Expect = 4.497e-9
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            QLR LLWKN   +RR+   LL+E+  PL +  IL +VR S   Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    6 QLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. UniProt/SwissProt
Match: sp|Q7TNJ2|ABCA7_RAT (ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus OX=10116 GN=Abca7 PE=1 SV=1)

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 598/1937 (30.87%), Postives = 960/1937 (49.56%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSC---------------YDQTQINWL---------GTNLNEFHVFIGNITEIYNSLPSGAL----NVPKFMKWITS-----------------NPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNEL-GEIICG-----SP---------ENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCK----AYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERG-------------LNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYL------TPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFG---------------------------------------------EGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVAD---------DPMNK---LINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYR--------LDNYQCFYRNENNMWSPASIL-------DIPMVSPECDCSKTG-NQICNDLRSGGPPNSYRIMTSS--DKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNS--NSIVKHEYNA-LQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
             QL  LLWKN+  +RR+   L++EL  PL + FIL AVR S    +   C F  K + S G +P+L   +C  N SC               +  + I+ L         G +  +    +G +  +  ++ SGA     N P     +T                    +   +  ++   +++ ++ L S V            +G  EL  E +C      SP          N    FM   +       SL      F     +  V   ++  L PLI GK+ + P+    R+++ + N TF+ L  LR     W +     + ++++++  +  ++K        +    PK          +  ++ ++D     ++W E               L C  LD+   L+++   + L +++      R   A I+F      L      +P  T     +++I +   D T   K+ D+FW P P  +   D +YV  GF++LQ+ ++QA + +++  +S   G  +  MP+PCY+ D FL+ L+  LP  L +AW  SV + +K++V EKE+RL+E M+ MGL+  V W+ WF+S +   ++   ++ + L+L  I   S   VVF  +  + ++ + Q+F++S FFS+AN+A+  GG+ YF  Y+ +V+ +     L L    +  LLS VAF    + +   E+  +G Q+ NL   P E + F +      +++D+ IY L  WY+EAV PGQYG+ +PWNF   RSYW        S+  +    Q+ ++     E  P  L  G+SI  L K +  +  P +  LNL+FYE  ITAFLGHNGAGKTTT+SIL+G+F PSSG+A IL  D++T M +IR  +G+CPQYNVLFD LTVE+H++FYG LK +    I+S    +I+DV L  K +  + HLSGGM+RKLS+A+AF+G SRVV +DEPTAGVDP +RRGIW+LL+KYR   RT+IL+THH+DEA+ L DRVA+++ G L CCGS +FL+R  G                                             +G + S      +      +   IL+ V+ ++  A+++EE   +  + LP        F  +F+ LDQ +  + +  YG+SDT+LEE+FLKV +         DP  +   L    + +     ++L+     N    ++ L+    +  +    Q    ++G+ L  QQ+ AL  KR+  A+R  +G  A+++LP L +   + F  I     +  P+Q+SP      M    ++ F          +  LE+     LGE+G++  +PS+            +  C++         ASIL       D P  SP C CS+ G  ++  D  +G          +   + + NLTG N+SD+L+K +P L R+            YGGF      + G       D P   E+   V   +A  +    N+L + ++ L +       + S  +IW N+KG+ +M A+ N  +N LLR+ L   +V+   + I+  N P+ + +       +    +++ ++I V+F +SF+PASF + L+EER++ +K  Q VSG+   +YW+ NFLWD+  Y++ + I+++IF+AF  ++Y+  +N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G  ++++TF+L++L  + + L+E++ ILK+VFLIFP F LGRG++D+  N         +   ++ + L+WDI G+ L ++  ++ G   +LI +     NR+    L     +       ED DV  ERER++      DVL + +LTK+Y            +G+        R  AV++LC G+  GECFGLLGVNGAGKT+TF
Sbjct:    5 TQLMLLLWKNYTYRRRQPIQLVVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSLISRLLADAHTVLGGHSTQDMLAALGKLIPVLRAVGSGAWPQESNQPAKQGSVTELLEKILQRASLETVLGQAQDSMRKFSDATRTVAQELLTLPSLVELRALLRRPRGSAGSLELISEALCSTKGPSSPGGLSLNWYEANQINEFMGPELAPTLPDSSLSPACSEFVGALDDHPVSRLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGV-LGPQIFNFMNDSTNVAMLQKLLDVEGTGWQQQTPK------GQKQLEAIRDFLDPSRGRYNWQEAHADMGRLAEILGQILECVSLDK---LEAVPSEEALVSRALELLGERRLWAGIVFLSPEHPLDSSEPPSPTTTGPGHLRVKIRMDIDDVTRTNKIRDKFWDPGPSADPLMDLRYVWGGFVYLQDLLEQAAVRVLSGRDS-RAGLYLQQMPHPCYVDDVFLRVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMGLSRAVLWLGWFLSCLGPFLVSAALLVLVLKLGNILPYSHPVVVFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLAYFALYLPYVLCVAWRERLPLGGLLAVSLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGPAEDV-FSLAQVSAFLLLDAVIYGLALWYLEAVCPGQYGIPEPWNFPFRRSYWCGPGPPKSSV--LAPAPQDPKV---LVEEPPPGLVPGVSIRGLKKHFRGSPQPALRGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAIDSEQEHLIRDVGLIPKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYR-EGRTLILSTHHLDEAELLGDRVAMVASGSLCCCGSPLFLRRHLGCGYYLTLVKSSQSLVTHDLKGDTEDPRREKKSGSEGKTADTVLTRDGPHRSSQVPAPDAVPVTPSAALILELVQRHVPGAQLVEELPHELVLALPYAGALDGSFATVFQELDQQLERLGLTGYGISDTNLEEIFLKVVEEAHAHGEGGDPRQQQHLLTATPQPHTGPEASVLE-----NGELAKLVLDPQAPKGSAPTTAQ----VQGWTLTCQQLRALLHKRFLLARRSRRGLFAQIVLPALFVGLALFFTLIVPPFGQYPPLQLSP-----AMYGPQVSFFSEDAPADPNRMKLLEAL----LGEAGLQ--DPSVQGKGSRGSECTHSLACYFTVPEVPPDVASILASGNWTPDSP--SPACQCSQPGARRLLPDCPAGAGGPPPPQAMAGFGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGF------SLGGRDP---DLPSGREVVRTVAEMRALLSPQPGNTLDRILNNLTQWALGLDARNSL-KIWFNNKGWHAMVAFVNRANNGLLRAFLPSGSVRHA-HSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVLIFLAFQQKAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELL--SDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDKQFQSPLRWDIIGKNLLAM--VAQGPLFLLITLLLQHRNRL----LPQPKSRLPPPLGEEDEDVVRERERVTKGATQGDVLVLRDLTKVY------------RGQ--------RSPAVDHLCLGIPPGECFGLLGVNGAGKTSTF 1862          

HSP 2 Score: 178.718 bits (452), Expect = 2.309e-43
Identity = 102/320 (31.87%), Postives = 164/320 (51.25%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMME--ESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + +L K+Y   + P +++L L     +    LG NGAGKT+T  ++TG   PSSG A +   ++  E  +  + +G CPQ + +FD LT  +H+  +  L+ + + ++       +  + L    +  +   SGG KRKL+ A+A +G+  VVFLDEPT G+DP ARR +W+ L+      R+++LT+H M+E + L  R+AI+  G+ +C GS   LK +FG G+                  E  + F+     DA + E   SRL++ +        +R F EL      H  E     + +S T+LEEVFL  + D
Sbjct: 1820 LRDLTKVYRGQRSPAVDHLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQEPSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNNLLSVVREGRSVVLTSHSMEECEALCTRLAIMVNGRFRCLGSAQHLKSRFGAGH-------TLTLRVPPDQPEPAIAFIVTTFPDAELREVHGSRLRFQLPPGGGCTLARVFRELAAQGKAHGVE----DFSVSQTTLEEVFLYFSKD 2128          
BLAST of ATP binding cassette subfamily A member 1 vs. UniProt/SwissProt
Match: sp|O35600|ABCA4_MOUSE (Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=2 SV=1)

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 543/1727 (31.44%), Postives = 888/1727 (51.42%), Query Frame = 1
Query:  523 LGEIICGSPE--------------NDFKLFMRNFIKNQRR-------KRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLR--------LASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE-------------RGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSS--------ESIPL---MRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXX--------------------------------XXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLI-------NKEKSYYSYYCNILKMKLRINA----TKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWL--------MMSKMGKENLNTFYRKENISLGLINK-LESEYRSDLGESGIRCMNPSIYRLDNYQCFYRN--ENNMWSPASILDIPMVSPECDCSK----TGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQAN-HNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNY-FYNSNSIVKHEY--NALQWDIAGEKLFSLFSLSIGWWIVLIIIESG-IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            L +++CG PE              N++K F+   I + R+       KR+   C  + QS   N + K   +    PL+ GK+ + P+    R+I++ AN TF+ LD +R        +    W    ++  +  I + +    VK F            +AV   F+    +   D ++  F W +             + L C  LD+F   +S  D  +LT ++        F A ++F   + + +      + Y+IR+ +  ++ T K K  DR+W   PR +   DF+Y+  GF +LQ+ ++Q  ++     E   +G  +  MPYPC++ D F+  L    P  +V+AW  SV++ +K IV EKE RLKE +K  G++N V W +WF+ +  ++ + + ++++ +   +I   S   ++F  +  +  + I Q+F++S  FSKA++A+   G++YFT Y+  V+    +  ++  +  +  LLS VAF    ++++ +E+   G+Q+SN+ ++P E   F     + +M++D+ +Y L+ WY++ VFPG YG   PW FL   SYW+     S        ++ PL   M +      +N   FE E   L  G+ + NLVK++  +  P ++ LN+ FYE+QITAFLGHNGAGKTTT+SILTG+  P+SGT  I  +DI T +D +RQ +G+CPQ+N+LF  LTV +HI FY  LK     E +  +  +++D  L  K N  +  LSGGM+RKLS+A+AF+G+S+VV LDEPT+GVDP++RR IWDLL+KYRS  RTII++THHMDEAD L DR+AIISQG+L C G+ +FLK  FG G+YL+L++                                        + + + ++  V  ++ +A+++E    +   +LP  +   R +  LF+ L++ +A++ + S+G+SDT LEE+FLKV +D     +        +E++   + C+    KLR  A    T +   ++    Q   +  D       G  L+ Q + AL +KR+H+  R  K F+A+++LP   +   ++   I     +   + + PW+         M +   E+L           G  N+ L+ E+  +       C+N + ++  +      +  +   W+ A        SP C CS     T    C +  +GG P   R   S++ L +LT  NISDYL+K +P L R           + YGG      LP+       L+G   F   L   +N S      +++   L F+ +L+ T  I        ++W N+KG+ ++ ++ N+  N +LR+ L +      +YGI+V + P+ + +       V    ++  +AI VIF +SF+PASFV++L++ERV+ +K  QF+SG++P  YW++NFLWDIM Y +   +++ IFI F  ++Y    N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TF+L++ E N   L+  N +L+K+ ++FP F LGRG++DL  +    +  +    EY  N  QWD+ G+ L ++    + ++++ ++I+    + R I    +            ED DV  ER+R+ S     D+L++  LTK+Y                    + +   AV+ LC GVR GECFGLLGVNGAGKTTTF
Sbjct:  319 LSDLLCGYPEGGGSRVFSFNWYEDNNYKAFLG--IDSTRKDPAYSYDKRTTSFCNSLIQSLESNPLTKI-AWRAAKPLLMGKILFTPDSPAARRIMKNANSTFEELDRVRKLVKAWEEVGPQIWYFFEKSTQMTVIRDTLQHPTVKDFINRQLGEEGITTEAVLNFFSNGPQEKQADDMTS-FDWRDIFNITDRFLRLANQYLECLVLDKF---ESYDDEVQLTQRALSLLEENRFWAGVVFPGMYPWAS-SLPPHVKYKIRMDIDVVEKTNKIK--DRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGIVKSQMQAEP-PIGVYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKGIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMALSIFLLTLFIMHGRILHYSDPFILFLFLLAFATATIMQSFLLSTLFSKASLAAACSGVIYFTLYLPHVLCFAWQDRMTADLKTTVSLLSSVAFGFGTEYLVRFEEQGLGLQWSNIGKSPLEGDEFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEPLTEEMEDPEHPEGMNDSFFERELPGLVPGVCVKNLVKVFEPSGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLIGGKDIETNLDVVRQSLGMCPQHNILFHHLTVAEHILFYAQLKGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDSKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDPPKGQPSPEPEDPGVPFNTGARLILQHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMYGHQYTFFSMDEPNNEHLEVLADVLLNRPGFGNRCLKEEWLPE-----YPCINATSWKTPSVSPNITHLFQKQKWTAAH------PSPSCKCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPISGEALVG---FLSGLGQMMNVSGGPVTREASKEMLDFLKHLETTDNI--------KVWFNNKGWHALVSFLNVAHNAILRASLPRDRDP-EEYGITVISQPLNLTKEQLSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFENNRTLLR-FNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAIEGVVYFLLTLLIQHHFFLTRWIAEPAREPVFD-------EDDDVAEERQRVMSGGNKTDILKLNELTKVY--------------------SGSSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTF 1981          

HSP 2 Score: 180.259 bits (456), Expect = 8.185e-44
Identity = 116/401 (28.93%), Postives = 193/401 (48.13%), Query Frame = 1
Query: 1966 VGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADA-RMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            +G  ++ M I+  +Y L+T  ++  F     +A+P     AR             P+   ++   E   +       N    + ++ L K+Y  +  P ++ L +     +    LG NGAGKTTT  +LTG  + +SG A +  + I T +  + Q +G CPQ++ + D LT  +H+Y Y  L+ +   EIE V    I+ + L+   + L+   SGG KRKLS A+A  G   ++ LDEPT G+DP ARR +W+ ++      R ++LT+H M+E + L  R+AI+ +G  QC G++  LK KFG+GY +++                   F   +     R    S LQ+        + S     +F+ L  H   + I  Y ++ T+L++VF+  A
Sbjct: 1874 IGKNLVAMAIEGVVYFLLTLLIQHHFFLTRWIAEP-----ARE------------PVFDEDDDVAEERQRVMSGG--NKTDILKLNELTKVYSGSSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTSISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKLSTAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGRAVVLTSHSMEECEALCTRLAIMVKGTFQCLGTIQHLKYKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQRERHHSMLQF-------QVPSSSLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVNFA 2248          

HSP 3 Score: 57.7658 bits (138), Expect = 1.212e-6
Identity = 26/77 (33.77%), Postives = 42/77 (54.55%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            Q++ LLWKN+ L++R+    ++EL  PL +  +L  +R++   Y    C F  K M S G +P+L    C  N  C+
Sbjct:    6 QIQLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNANPLYSQHECHFPNKAMPSAGLLPWLQGIFCNMNNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. UniProt/SwissProt
Match: sp|Q8IZY2|ABCA7_HUMAN (Phospholipid-transporting ATPase ABCA7 OS=Homo sapiens OX=9606 GN=ABCA7 PE=1 SV=3)

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 536/1634 (32.80%), Postives = 855/1634 (52.33%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRL---HFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIF------NETFQYLTPK-NTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXX------------------------XXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCN---ILKMKLRINATKTEIFLNQNPDQKQSKFLDQSD-----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIR--CMNPSIYRLDNYQCFYRNENNM----WSPASILDIPMVSPECDCSKTG-NQICNDLRSGGPPNSY--RIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDS--PFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNS--NSIVKHEYNA-LQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRN-----TEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            ++  L PLI GK+ + P+    R+++ + N TF+ L  LR     W +      TF+ D  +  +    ++   +      P   D +  L      +S++D  S  +SW             + R   C  LD+   L++      L +++ +      F A ++F      ++  ++ TP      +  +IR+ +  +  T K +  DRFW P P  +  TD +YV  GF++LQ+ +++A +  V +  +   G  +  MPYPCY+ D FL+ L+  LP  L +AW  SVT+ +K++V EKE+RL++ M+ MGL+  V W+ WF+S +   ++   ++ + L+L  I   S   VVF  +  + ++ + Q+F++S FFS+AN+A+  GG+ YF+ Y+ +V+ +     L      +  LLS VAF    + +   E+  EG Q+ N+   P   + F +     L+++D+ +Y L TWY+EAV PGQYG+ +PWNF   RSYW          P     +    +     E  P  L  G+S+ +L K +P +  P +  L+L+FY+  ITAFLGHNGAGKTTT+SIL+G+F PS G+A+IL  D+R+ M +IR  +G+CPQYNVLFD LTV++H++FYG LK +    +     R+++DV L  K +  + HLSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP +RRGIW+LL+KYR   RT+IL+THH+DEA+ L DRVA+++ G+L CCGS +FL+R  G GYYL+L+K +   +                         S      +L  V+ ++  AR++EE   +  +VLP    +   F  LF+ LD  +AE+ +  YG+SDTSLEE+FLKV ++       ++ S   + C     L + LR+     E  L        +   DQ         ++G+ L +QQ+ AL +KR+  A+R  +G  A+++LP L +   ++F  I         +++SP      M    ++ F        G    LE+     L E+G+    +  S +R    +        +    W+P S       SP C CS+ G  ++  D  +          +  S + + NLTG N+SD+L+K +P+L R+            YGGF          S + +G S    W  L      +  +    NL +       Q + K          IW N+KG+ SM A+ N  SN +LR+ L     +   + I+  N P+ + +       +    +++ ++I V+F +SF+PASF + L+EERV+ +K  Q + G++P +YW+ NFLWD+  Y++P  I+++IF+AF  ++Y+   N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G   +++TF+L++   + + L+E++ ILK+VFLIFP F LGRG++D+  N         +   ++ + L+W++ G+ L           + ++I     +   +  + ++  L +  +R+      ED DV  ERER+       DVL + NLTK+Y            +G+        R  AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct:  283 LWRRLKPLILGKLLFAPDTPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEAL------RSFLDPGSGGYSWQDAHADVGHLVGTLGRVTECLSLDK---LEAAPSEAALVSRALQLLAEHRFWAGVVFLGPEDSSDPTEHPTPDLGPGHVRIKIRMDIDVVTRTNKIR--DRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVR-VLSGANPRAGLYLQQMPYPCYVDDVFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCLGPFLLSAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACGGLAYFSLYLPYVLCVAWRDRLPAGGRVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVGTRPTADV-FSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPPKSPAPCPTPLDPKVLV-----EEAPPGLSPGVSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLKYR-EGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGSCGQHLCTGIAGLDVTLRLKMPPQETALENGEPAGSAPETDQGSGPDAVGRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSP-----TMYGAQVSFFSEDAPGDPGRARLLEAL----LQEAGLEEPPVQHSSHRFSAPEVPAEVAKVLASGNWTPES------PSPACQCSRPGARRLLPDCPAAAGGPPPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELWALLSPLPGGA-LDRVLKNLTAWAHSLDAQDSLK----------IWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHA-HSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELF--SDQKLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDRQFQSPLRWEVVGKNL-----------LAMVIQGPLFLLFTLLLQHRSQLLPQPRVRSLPLLGEEDEDVARERERVVQGATQGDVLVLRNLTKVY------------RGQ--------RMPAVDRLCLGIPPGECFGLLGVNGAGKTSTF 1837          

HSP 2 Score: 169.088 bits (427), Expect = 1.941e-40
Identity = 98/318 (30.82%), Postives = 157/318 (49.37%), Query Frame = 1
Query: 2218 IHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + NL K+Y   ++P ++ L L     +    LG NGAGKT+T  ++TG    S G A +    +  E  +    +G CPQ + +F+ LT  +H+     L+ + + ++       +  + L+   +  +   SGG KRKL+ A+A +G+  VVFLDEPT G+DP ARR +W+ L+      R+++LT+H M+E + L  R+AI+  G+ +C GS   LK +F  G+ L+L         +         FV      A + E    +    LP     +     +F  L  H AE  +  + +S T LEEVFL  + D
Sbjct: 1795 LRNLTKVYRGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQPAA-------AFVAAEFPGAELREAHGGRLRFQLPPGGRCA--LARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKD 2103          

HSP 3 Score: 70.8626 bits (172), Expect = 1.516e-10
Identity = 34/80 (42.50%), Postives = 45/80 (56.25%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQ 264
             QL  LLWKNF  +RR+   LL+EL  PL + FIL AVR S    +   C F  K + S G +P+L   +C  N +C+ Q
Sbjct:    5 TQLMLLLWKNFMYRRRQPVQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLICNVNNTCFPQ 84          
BLAST of ATP binding cassette subfamily A member 1 vs. TrEMBL
Match: N1PB02 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226736 PE=4 SV=1)

HSP 1 Score: 956.822 bits (2472), Expect = 0.000e+0
Identity = 596/1616 (36.88%), Postives = 905/1616 (56.00%), Query Frame = 1
Query:  619 CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANP---KICDAVNTLFNITNVKSY------IDGVSKLFSWIERGLNCTELDRFIPLDSLKDI--DKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIE-VGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXI--------------LKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDP--MNKLINKEKSYYS--------YYCNILKMKLRIN---ATKTE-----IFLNQNPDQKQSKFL----DQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMM-SKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPA-SILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNS---NSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESG--IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            C  +F+      + +   +  + P++ GK+ Y P+  ++R++I +AN TF  L  ++  + +W L     + +++SN+    +++ F   Y  +NP   +I      LFN    +S       I+    + + I + +NC E D+F P  + +D+    LT        A +IF+       P   T + Y+IR+   R+DST K +VLDRFWTP PR     D KYV+ GF ++Q+ ++ A I   T +   E +G ++   PYPCY+ DKF   ++  LP  ++++W  +V++L+K+IVYEKE RLKE MK MGL N VHW +WFI+  V++++ V ++ + L++  +   S  +V+F  +  + I+ I Q FM+SVFF +AN+A+   GILYF  ++ +    + E  +         LLS V+F     ++  +E+   G+Q+SN+ Q+  +   F +  CI +M++D+ IY++I WYVEAVFPGQ+G+ + W F   +SYW      ++ +P  R   +  +   Q  E EP++L LG+SI  L K+Y   +   ++ LNLNFYE QIT+FLGHNGAGKTTT+SILTG+F P+ GTA I  +DIRT+++ IR+ +G+CPQ+NVLFD LTVE+HI+FY  LK M + +I   +  +I D+ L  K N  S  LSGGMKRKLS+A+AF   S+VV LDEPTAGVDP+ARR IWDLL+KYR+  RTIIL+TH MDEAD L DR+AII+QGKL C GS +FLK  FG GYYL+L+K++    +++ +   +                F+   + +A ++E   ++ T  LP +  ++  F +LF++LD H++ + ++SYG+SDT+LEEVFLKVA++    N L  ++    +        Y   + ++  R     A+K       +  + NPD   S           + + G  L+ +Q +A+ IKR++Y +R  K F+++                       +  M+I PWLM  SK+   +L TF+  +  S      +E       G  G+RCM+P +Y L  ++C    E++ WS      D P    EC C ++G Q C    +G   + Y ++ ++D++ N+TG NISD++LK   +  ++ YGG  F   +    ++    DS F +     +  + A  + +N+     I  L+   K    K +  +IW N+KGYVSM AY NI +NL+LR+ L         YGIS+ N P+    S  +   +   I+++ +++ VIF +  IPASFV+FL+EERVSGSK  QFVSG+NP VYWV+NF WD++ Y++  I+ I+IF+AF   +Y+   NA   + LL+ YG A  P MYP S F + PS+AFV+L   N+ +G I+T+STFIL+      + L EIN I+ KVFL+ P + LGRG++D+  N        N       +   WDI G  L SL  L + ++ + I IE    I +       K      +E  + ED DV  ERER++    S D+L +  LTK+Y   L               KNK    AV+ L  GV  GECFGLLGVNGAGKTTTF
Sbjct:  358 CNDLFEQIESQQLTRI-FWRQIKPMVRGKIPYAPDTPVVRRLIREANQTFVTLVQVKQLAEDW-LKASPGISEFLSNSDQARNIRDFIDLYMMSNPGDAQIALVQRWLFNGPRDQSAYDWRDSIEYTDYVMTMIVQYMNCFEFDKFEPHKTEEDVVNTGLTYIGDNKLWAGLIFDIDSSENLP---THIKYKIRMDTDRVDSTSKSRVLDRFWTPGPRAKPLPDMKYVVYGFSYIQDMVEHAIIREHTGDSLDEDIGMTVQQFPYPCYINDKFTMAISRSLPLFMILSWIYAVSILVKAIVYEKEQRLKEVMKTMGLTNAVHWCAWFITAFVMMLLSVFLLLIVLKVGTVLEHSDGSVIFVFLLAFTIATIMQCFMISVFFQRANLAAACAGILYFIGHIPYTFCTQWEEYMRTWQKALASLLSSVSFGFGCSYIARYEEQGIGIQWSNIHQSVLQEDDFSMLACIFMMLVDALIYMIIAWYVEAVFPGQFGMPRSWYFFVTKSYWCGYEPGTDGMPNGRAGYE-MDSGQQGQEDEPKHLPLGVSIQKLCKVYKRGQKVAVDGLNLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTEGTAVIYGQDIRTDINEIRKSLGMCPQHNVLFDHLTVEEHIWFYSSLKGMPEEDIRKEMNAMIMDIGLPHKRNEYSAKLSGGMKRKLSVAIAFTAGSKVVILDEPTAGVDPYARRSIWDLLLKYRA-GRTIILSTHFMDEADILGDRIAIINQGKLCCVGSSLFLKSNFGGGYYLTLVKDERKGDSASTSDVKVENATEDGNAGEISTTAFIMERVPEAVLVESIGIEMTYQLPNDKSHTASFEKLFRDLDAHLSSLGLLSYGVSDTTLEEVFLKVANESEEANHLSEEDVRQGTERLTDGGMYARPVTRLSFRKRNFFASKDRESNELLDADGNPDSAVSTASISCNGTGSYKVTGLSLIPRQFLAIFIKRFNYLRRSKKAFISQ-----------------------EPAMEIHPWLMSPSKLQDSHLFTFFSNDLPSEAWTQAIEDLLTQKPG-LGVRCMDPDVYSLKGFRCV-DAEDSQWSNVEEDFDEP---EECSC-ESGYQRCPKGAAGAEASKY-LLPTTDEMYNMTGRNISDWILKTSQEYIKRRYGGLTFGERNDLLRANDTEVDSIFAQ-----LATAAAGDDTNNVTLPGLILDLENLIKNIATKRN-AKIWFNNKGYVSMVAYMNIMNNLVLRAHLPPD-TDPSRYGISLINHPMNRTSSQLYAYTLKASIVDVMISVSVIFAMCLIPASFVLFLIEERVSGSKHLQFVSGVNPVVYWVANFTWDMLNYLVSGILCILIFVAFQQNAYVSQTNAPCLVSLLLLYGWAATPMMYPASHFFNVPSSAFVILGCMNIFLGIISTLSTFILEAF--MEQELDEINAIIMKVFLVLPHYCLGRGLIDMTRNQLVADIFENLGETFFQSPFTWDIVGRNLLSLSILGVFFFFLNICIEYKFWIYSMKCISPCKEQIPVNVEETDEEDIDVVRERERVTLGAASGDILTLEGLTKVYKSPL---------------KNKGHR-AVDRLSVGVHSGECFGLLGVNGAGKTTTF 1911          

HSP 2 Score: 192.2 bits (487), Expect = 4.826e-45
Identity = 117/372 (31.45%), Postives = 199/372 (53.49%), Query Frame = 1
Query: 2095 YWVYNIKS----SESIPLMRNNNQNCEINHQAFESEPENLKLG------ISIHNLVKLYPS---NKIP-VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADA-RMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            +W+Y++K      E IP+        +I+      E E + LG      +++  L K+Y S   NK    ++ L++  +  +    LG NGAGKTTT  +LTG    + G A++    IR+EM +I Q +G CPQ++ L   LT  +H+  Y  L+ +   ++++V    I+ + L      LS  LSGG KRKLS A+A +GN  V+FLDEPT G+DP ARR +W+ +       R+++LT+H M+E + L +R+ I+  G+ +C GS+  LK +FG+GY ++L    ++ ++  +           +     +    + LQ+ +  P +   S    ++F ++++   EMSI  Y +S T+L++VF+  A
Sbjct: 1817 FWIYSMKCISPCKEQIPVNVEETDEEDID---VVRERERVTLGAASGDILTLEGLTKVYKSPLKNKGHRAVDRLSVGVHSGECFGLLGVNGAGKTTTFKMLTGNIKSTDGDAHLAGHSIRSEMTAIHQNLGYCPQFDALCPLLTPREHLQMYARLRGVPAEDVDTVAEWGIEKLGLVNHAAKLSHQLSGGNKRKLSTAIALVGNPPVIFLDEPTTGMDPKARRFLWNCISGIIKDGRSVVLTSHSMEECEALCNRIVIMVNGQFKCIGSIQHLKNRFGDGYMITLKVTSSSDASQCQIQAVASNMESTFPGIVLKEQHHNMLQYQV--PSSVHTS--LADIFGHIERVREEMSIEDYSVSQTTLDQVFINFA 2181          

HSP 3 Score: 72.7886 bits (177), Expect = 9.624e-9
Identity = 53/184 (28.80%), Postives = 84/184 (45.65%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQA-KYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFI----------------------------GNITEIYNSLPSGALNVPKFMKWITSNPNEFI-RLQNSFSYISKRIVPLISTVNKVMSE 489
            QLR LLWKN +L+ R+   L+ EL  PL++  IL  V+  +  KY +  C F  K M S GP+PFL   +CT N +C+D  + +     LN ++  I                            G + E+ +   +G+L+    +  I  +P+E   R+Q+    +S  +V  I  +N   SE
Sbjct:    7 QLRLLLWKNTKLRLRQPARLVTELVWPLLLFLILAWVKLDRGLKYPIHECHFDGKSMPSAGPLPFLQSLVCTANNTCHDHGRPDEEPGVLNTYNTSILSELFLDLETLLGDQTSSDALVRLVRDFGTLRELNDLSNAGSLSCAFELGTILIDPDELTERIQSQNITLSDDVVAEIGNLNVNTSE 190          
BLAST of ATP binding cassette subfamily A member 1 vs. TrEMBL
Match: W5LAQ7 (ATP binding cassette subfamily A member 1 OS=Astyanax mexicanus OX=7994 GN=ABCA1 PE=4 SV=2)

HSP 1 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 644/1932 (33.33%), Postives = 1021/1932 (52.85%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITE-IYNSLPSGALNVPKF----------------MKWITSNPNEFIRLQNSFSYISKRI-VPLISTV--------------NKVM--SENETTIESG-YNELGEIICGSPE--------------NDFKLFMRNFIKNQRRKRSLLT------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSK-------LFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEG-YYXXXXXXXXXXXXXXXXXXXILKFVKI------------------------------------YIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD-------------PMNKLINKEKSYYSYYCNILK---MKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPMV--------SPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKT-SFTRIWANSKGYVSMPAYANIF--XXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            IS QLR LLWKNF  +RR+   LLIE+  PL + FIL AVR +   Y+   C F  K M S G +P++   +C  N  C+             E    +GN  + I + L S A  +  +                +K + +N +    +  +F  + K + +PL S +              N+++  + N T   S  Y  +  I+CG PE              +++K    N+  +     S+        C  + ++   N I +  ++  L PL+ GK+ Y P+     +II++ N TF+ L  LR     W    +    +++ ++  ++ ++   +   +A         T +++ +V S++   S+        F+W             I R + C  LD+  P+ +    +KL N S      R F A IIF +  Q  + +    ++Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ I+Q+ I  VT  +  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV ++IK +VYEKE+RLKE M++MGL+N + W SWFIS+++ L++   ++ + L++  +   S   VVF  +  + +  I Q F++S  F++AN+A+  GGI+YFT Y+ +V+ +  +  + L       LLS VAF    ++   +E+   G+Q+ NLF +P E   + +   II+M +D+FIY ++TWY+EAVFPGQYG+ +PW F   +SYW +        P+++    N        E EP +L +G+ I NLVK+Y   K   +++L L FYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYI+ +DIR+E+ +IRQ +G+CPQ+NVLF  LTVE+H++FY  LK + + E+++ + +I+ D  L  K  + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP+ARRGIWDLL+KYR+  RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK   G G Y   + K      +S RN  + + +VK                                     ++ +ARM+E+   + T +LP        F ELF ++D H+A++ I SYG+SDT+LEE+FLKVA+D             P+ +   +  ++ + + + LK      R +  ++E+    +P+ +++ +L  SD    + ++G+ L +QQ +AL  KR+ YA+R  KGF A+++LP + +   ++F  I     K   + + PW+       E+  TF   +        +L +      G  G RCM      + +  C   +++  WS    P S+L++ M         SP C+CS  G +     C     G PP   +I +  D L NLTG NISDYL+K + ++  K            YGGF     ST     +++   P  EE+ D +   +   N   + + +F+  L     I G+ T +  +IW N+KG+ S+ A+ N+     L       K   K   YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERV+ +K  QF+SG+ P++YW++NF+WD+  Y++P  ++I+IF+ F  ++Y+ + N     LLL+ YG +I P MYP SF    PSTA+VVL + N+L+G   ++STF+L++   N   +  INDILK V LIFP F LGRG++D+  N    ++++ +   N      +WD+ G+ LF++    + ++I+ ++I+     +       N+ L  I     ED DV  ER+R+ S     D+L +  LTK+Y                     + ++ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct:    3 ISTQLRLLLWKNFTYRRRQTLQLLIEIVWPLFIFFILIAVRLNYPPYEQHECHFPNKAMPSAGTLPWIQGIVCNANNPCFRHP-------TPGESPGVVGNFNDSIISRLFSDAKKILLYSQNDKSLDGFKELIHAVKALQNNTSGKQAVGVTFKSLGKLLEMPLTSLMFPQLASMRSWSDLRNEILFLTRNATGSPSQMYQAVSRIVCGHPEGGGLKIKSLNWYEDSNYKALFGNYNSSDEEPVSVYDNTSTPFCNNLMKNMETNPISRM-IWRALKPLLMGKILYTPHTPATHKIIKEVNRTFQELGVLRDLGGMWE-ETRPKAWNFMEHSEEMDLLRTLLQNNVTAAFFSAQLTGTQWSVQDVISFLTKQSEDTRPHGTAFTWRDVFNETDQAIMSISRFMECVNLDKLEPVSTE---EKLINDSLGLLDNRKFWAGIIFPD-IQSNSSELPPHVNYKIRMDIDNVERTNKIK--DAYWDPGPRADPFEDLRYVWGGFSYLQDVIEQSIIRAVTGTKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLMSAGLLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTVFARANLAAACGGIIYFTLYLPYVLCVAWQDYIGLPAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWKNLFSSPMEKDDYSLTTSIIIMYVDAFIYGVMTWYIEAVFPGQYGIPRPWYFPFTKSYW-FGEGDQRPTPILKGRKANS--GAVCIEEEPTHLDMGVYIENLVKVYRHGKKLAVDDLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSAIRQSLGVCPQHNVLFSMLTVEEHVWFYARLKGLSEEEVKAEIDQILYDTGLPHKRKSRTCELSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRT-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTLVKKEPEASLSSCRNSSSTVSYVKKDDEASESSSDAGLGSDHESDAATAIDISLISGLIIKHVPNARMVEDLGHEITYILPYESAKDGAFVELFHDMDDHLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEILSDGTFPIRR--RRRHAFGADHQSCLKPLTEDDRYDGNESEV----DPESRETDYLSGSDGKGSYQIQGWSLKRQQFLALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALQPWMY------EDQVTFISDDAPEDASTQRLLAALMEGPG-FGTRCMEGE--PIPDAPCTIGDDD--WSIPEVPESVLEVLMSQNWTMDNPSPACECSSDGKKKMLPECPASAGGLPPPQIKI-SERDTLQNLTGRNISDYLVKTYAQIIGKSLKNKVWVNEFRYGGFSLGARST-----QVL---PPAEEIDDAIARVRVIFNLEKVTADRFLKSLSAF--INGLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRANLPPEKDPSK---YGITAFNHPLNLTKEQLSQVALVTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFIWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFEIPSTAYVVLTSVNILIGINGSVSTFVLELFGNN--EIGGINDILKNVLLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPFEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFK------PNAKLSPI---GEEDEDVARERQRIVSGAGQGDILELRELTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1851          

HSP 2 Score: 194.126 bits (492), Expect = 1.364e-45
Identity = 105/320 (32.81%), Postives = 174/320 (54.37%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    +SG A++  + I  E+D + Q +G CPQ++ + D LT  +H+ FY +L+ + + E+  V    I+ + L +  +  +   SGG  RKLS AMA IG   VVFLDEPT G+DP ARR +W+ +       R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           +  + + + ++KF++  +  + + E+ R      LP    +      +F  L +H   + I  Y +S T+L++VF+  A D
Sbjct: 1807 LELRELTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTVVTSGEAFLARKSILREIDQVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEREVCEVAEWGIRKLGLVKYSDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIILRVAGPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLPS---SVSSLAHIFSILAKHKDFLRIEDYSVSQTTLDQVFVNFAKD 2118          
BLAST of ATP binding cassette subfamily A member 1 vs. TrEMBL
Match: A0A3Q2D7H1 (Zgc:172302 OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 934.865 bits (2415), Expect = 0.000e+0
Identity = 650/1875 (34.67%), Postives = 985/1875 (52.53%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTI-ESGYNELGEIICGSP--------------ENDFKLFM-RNFIKNQRRKRSLLT---CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTF---KILDNLRLASVEWRLHFQTF-----LLDYISNNVFIN-----------DVKKFCKAYYSANPKICDAVNTLFNI-TNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKD-IDK-LTNQSFRNFLAVIIF---NETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPL---MRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXX-----------------------------XXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQ---------NPDQKQSKFL----DQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASIL-------------DIPMVSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFT-RIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEM--EQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSN------SIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIR--NTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            QL  LLWKN   +RR    L+IEL  PL +  IL +VR S   YK   C F  K + S+G +P++   +C  N  C+           +  F         I + L   A  V  +      + + F  L  S   + +R   L  T++ +  EN T +    +     I+CG P              +N+ K F+ RN  ++        T   C+ + QS   N + +  ++  + PL  GK+ Y P+   +RQ+I++ N TF   +I  +L  A +E     + +     LL      V IN            + +F        P+   A  T  ++  NV+S I             + C  LD+   LD+    ID+ L     R F A ++F   N +   L P     ++Y+IR+ +  +  T K K  DRFW P P  + F D +Y+  GF+++Q+ +++A   ++T  +    G  +  MPYPCY+ D FL+ L   LP  + +AW  SV ++IK +VYEKE+RLKE M++MGL+    W+SW IS+++  +I  V++   L+   I   S   VVF  +  +  + I Q F++S FFSKAN+A+  GG++YF+ Y+ +V+ +     L+ T       LS VAF    ++   +E+   G+Q+ NL  +P E   +     I ++ +D+FIY L  WY+EAVFPGQYG+ +PW F+   +YW         IPL   M       E +    E++P  + LG++I NLVK+Y       +N+LNL FYE QIT+FLGHNGAGKTTTIS+LTG+F P++GT Y+   DIR +MD IR+ +G+CPQ+NVLFD LTVE+H++FYG LK + +  + + +  +++DV L+ K +  + +LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIWDLL+KYR  DRTIIL+TH+MDEA+ L DR+AIIS+GKL CCGS +FLK K G GYYL+++K +   +++                                   +L  V+ +I  AR++E+SR +  I LPQ              LDQ + E+ I SYGLSD++LEE+FL+VA++      ++  S  S   ++ + + +    ++ IF++           P + Q   L     Q    L G+ L  QQ+ AL +KR+ YA+R  +G LA+++LP + +L  +LF  I     K   +++ PW     M  E    F      +  + N LE+    D    G +CM+        +QC      N   P                 D P  SPEC CS    +     C D   G PP   +  T  D L NLT YNISDYL+K +P++ +K YGGF     S  G +++ I +    + L+D V A +  +     N     D   ++F ++     FT ++W N+KG+ +M ++ N+ +N LLR+ L   A +   +GI+  N P+ +  EQ T+   +     +++ ++I VIF +SF+PASFV+FL+EERVS +K  QFVSG+ P +YW++NF+WD++ Y +P +++++IFI F  QSY+   N  A ILLL+ YG +I P MYP SF  S PSTA+VVL + NL +G   +I+TF+L++  +N     E+N ILKKVFLIFP F LGRG++D+  N            + +K   + LQWD  G+ LF++ +  + ++I  I+++               Y  R  +     ED DV  ERER+ S +   D+L +I+L+K+Y                       R+ AV+ LC G+   ECFGLLGVNGAGKT+TF
Sbjct:    6 QLYLLLWKNITYRRRNKIQLIIELLWPLFLFVILISVRHSHPPYKQGQCHFPNKALPSVGTVPWIQSIICNINNPCFHSPTPGETPGQVGNFD------NSILSRLFVDAQTVLSYSG--NRSFSTFQDLMGSVRLLGERFGSL-PTLSLLSPENRTALPRESFRAFSRIMCGHPKVGGERIPSLNWYEDNNIKSFLGRNGTEDVVPDGDNTTTPFCKGLIQSLESNPLSRI-VWRGIKPLFIGKLLYTPDTPAVRQVIKEVNKTFEDLQIFQDLNDAWMEVGPQIKNYMETSDLLRRPEIAVLINMRLENTTWTASRIARFLSTPSPDVPRKPGAPPTWLDLYNNVESSI------------AMLCFSLDKMEGLDTEGQLIDRALQLLEDRQFWAGVVFLLPNTSSSQLPPH----VTYKIRMDIDDVTRTNKIK--DRFWDPGPAADPFNDMRYIWGGFVYIQDLVEKAVSYVLTGVKQ-NTGIYIQQMPYPCYVDDVFLRVLNRSLPLFMTLAWIYSVAMIIKGVVYEKEARLKETMRIMGLSTGTLWLSWLISSLIPFLISAVLLIALLKWGDILPYSDPTVVFFFLMAFATATIMQCFLISTFFSKANLAAACGGLIYFSLYLPYVLCVAWRDHLTSTHRVFASFLSPVAFGFGCEYFSQYEEQGVGIQWFNLRASPVEGDTYSFTTSITMLYVDAFIYALAAWYIEAVFPGQYGIPRPWYFIFQLNYW-------GGIPLEVGMPIPPAPAEQDEDYIETDPSTMNLGVNIRNLVKIYKKGGKVAVNHLNLKFYEGQITSFLGHNGAGKTTTISVLTGLFPPTAGTVYVKGMDIRYDMDIIRKTLGVCPQHNVLFDMLTVEEHVWFYGCLKGLSEENVMAEISALLEDVGLSHKRHDQTKNLSGGMQRKLSVAIAFVGGSKVVVLDEPTAGVDPYSRRGIWDLLLKYRK-DRTIILSTHYMDEAELLGDRIAIISKGKLCCCGSPLFLKSKLGSGYYLTVVKREELSTSTPSNSSICTSASTSTNKLPSLSSLSEDTGLGSEETTLLALVQQHIPGARLVEDSRRETMINLPQAAAKDGSLAVFLSKLDQKLVELGISSYGLSDSTLEEIFLRVAEETGVDAASEPPS--SVQPSVTRAEDQPEEPESIIFISGLTLIISNLFLPAEPQETDLLSGNGQGGVPLTGWWLTWQQLRALFVKRWLYARRSRRGILAQIVLPAVFVLIALLFSLIVPPFGKYPELELQPW-----MYGEQYTFFSNDAPGNPAMENLLEALL--DQPGFGTKCMDKEEELNSTHQCEAERGGNFTRPQISYSTWQKLKRGNWSRDRP--SPECQCSTEDTRRMLPDCPDGAGGFPPPQMKKAT-GDILQNLTTYNISDYLVKTYPQILKKRYGGF-----SLGGSTTQNISEV---QHLQDSVMAIRTRYQVKQKN-----DKFCRSFNLF-----FTSQVWYNNKGWHAMVSFVNVMNNGLLRASLPPGAERR-RHGITAYNHPLNLTKEQLTEIAMMTTS--VDVLVSICVIFAMSFVPASFVLFLIEERVSKAKHLQFVSGVQPILYWLANFVWDMLNYSVPAMMVVLIFICFQQQSYVSETNLPALILLLLLYGWSITPLMYPASFVFSIPSTAYVVLTSVNLFIGINGSIATFVLELFHLN-----EVNRILKKVFLIFPHFCLGRGLIDMAKNQALADAFQRLGMNTIKQTLDPLQWDFVGKNLFAMAAEGVIFFIFTILLQYKFF----------IYYSRPSLPPLGPEDEDVARERERVKSGKAHSDILTMIDLSKVYKA--------------------GRKPAVDRLCLGIPRSECFGLLGVNGAGKTSTF 1775          

HSP 2 Score: 177.178 bits (448), Expect = 1.609e-40
Identity = 101/345 (29.28%), Postives = 183/345 (53.04%), Query Frame = 1
Query: 2116 SSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEV 3150
            S  S+P +   +++     +  +S   +  + +++ +L K+Y + + P ++ L L    S+    LG NGAGKT+T  +LTG    + G A++    +  EM+ + Q +G CPQ++ + D LT  +H+  Y  L+ + +  +  V    ++ + LT+     +   SGG KRKLS A++ IG   V+FLDEPT G+DP A+R +W+ ++      R ++LT+H M+E + L  R+AI+  G+ QC GS+  LK +FG+GY + L          +   +  L+     I + +   ++ LQ+   LP +        ++F  L  +  E+ I+ + +S T+L++V
Sbjct: 1700 SRPSLPPLGPEDEDVARERERVKSGKAHSDI-LTMIDLSKVYKAGRKPAVDRLCLGIPRSECFGLLGVNGAGKTSTFRMLTGDTQITHGEAFLSQHSVLREMERVHQLMGYCPQFDAISDLLTGREHLELYARLRGVPEESVTKVAQWGVRKLGLTQYAEQEAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCILSVTKEGRAVVLTSHSMEECEALCTRMAIMVNGRFQCLGSVQHLKNRFGDGYTIILRLADIKADPESCPIDTHLR-KSFPIIELKERHQNVLQYQ--LPSHACC---LADVFDVLGNNSEELGIVDFSVSQTTLDQV 2037          
BLAST of ATP binding cassette subfamily A member 1 vs. TrEMBL
Match: A0A3B4Y390 (Uncharacterized protein OS=Seriola lalandi dorsalis OX=1841481 PE=4 SV=1)

HSP 1 Score: 928.702 bits (2399), Expect = 0.000e+0
Identity = 645/1906 (33.84%), Postives = 1006/1906 (52.78%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITE-IYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTV------------NKV--MSENETTIESG-YNELGEIICGSPE--------------NDFKLFMRNFIKNQRRKRSLLT------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSA---NPKICDAVNTLFNITNVKSYIDGVSKL----FSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTF---LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSES--IPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYY-------------------------------XXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD-------PMNKL--INKEKSYYSYYCNILKMKLRINATKTEIFLNQ---NPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMV---------------SPECDCSKTGNQI----CNDLRSGGPPNSYRI-MTSSDKLNNLTGYNISDYLLKNFPKLSRKLY--------GGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHN-QSNLNSLKFIDYLQKTFKIYGIKT-SFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
             QL  LLWKNF  +RR+   LL+E+  PL++ FIL AVR +   Y+   C F  K M S G +P++   LC  N  C+             E    +GN  + I + L S A  +  + +    N + F  L  ++S  S + + L+S +            N++  +++N T+  S  Y  +  I+CG PE              +++K    N   ++    SL        C  + ++   N + +  ++  L PL+ GK+ Y P+    +++I + N TF+ L   R     W    +  + +++ N+  ++ ++   K   +A   + ++ D   T+ +++N  S      +L     +W             I R + C  LD+  P+ S    ++L NQS      R F A I+F +    + P  T     L+Y+IR+ +  ++ T K K  D +W P PR + F D +Y+  GF +LQ+ I+Q  I  VT  +  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV +++KS+VYEKE+RLKE M++MGL+N + W SWFIS+++ L+I   ++ + L+   +   S   VVF  +  + +  I Q F++S  F++AN+A+  GGI+YFT Y+ +V+ +  +  +         LLS VAF    ++   +E+   G+Q+ NL  +P E   F +   IILM  DSF+Y ++TWY+EAVFPGQYG+ +PW F   +SYW +  K  +S  +PL R  N          E EP +L+ G+ I NLVK+Y   K   ++ L L FYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYIL  DIRTE+ +IRQ +G+CPQ+NVLF  LTVE+HI+FY  LK + + +++  + +I++D  L  K  + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP+ARRGIWDLL+ YR   RTIIL+THHMDEAD L DR+AIIS GKL C GS ++LK + G GYY                                    +    S        I   +  ++  ARM+E+   + T VLP        F ELFK+LD  + ++ I SYG+SDT+LEE+FLKVA+D       P +    + + +  +++     +  LR          N+   +P+ +++ +L+ +D    + + G+ L +QQ +AL  KR+  A+R  KGF A+++LP + +   ++F  I     K   +++ PW+       E+  TF   +      + KL        G  G RCM+   + +    C   +E+  W    I D+P                 SP C CS  G +     C     G PP   R+ ++++D L NLTG NISDYL+K + ++  K           GF F     F   ++     P   E+ D +   +     Q    + +F+D L     I G+ T +  +IW N+KG+ S+ A+ N+ +N +LR+ L        +YGIS  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERVS +K  QF+SG+ P +YWV+NF+WD+  Y++P  ++++IFI F  ++Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   +ISTF++++   N   +  INDILK V LIFP F LGRG++D+  N    ++++ +   N     L+WD+ G+ LF++    + ++I+ ++I+     R        S L ++     ED DV  ER+R+ +     D+L +  LTK++                     + ++ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct:    5 TQLGLLLWKNFTYRRRQTLQLLVEIVWPLLIFFILIAVRLNYPPYEQHECHFPNKAMPSAGTLPWIQGILCNANNPCFRNP-------TPGESPGVVGNFNDSIISRLFSDAKKILLYSQ-NDKNLDGFKELAQTWSK-SNQTLSLVSGLQLAGMKSWIDLRNEIIFLTQNATSSPSTMYQAVSRIVCGHPEGGGLQIKSLNWYEDSNYKALFGNHNSSEDEPTSLYDNSSTPYCNSLVKNMDSNPMSRM-IWQALKPLLMGKILYTPHNPATQRVIHEVNRTFQELGVFRDLGGMWE-EMRPKVWNFMENSQQMDLIRTLLKNNVTATFFHAQLSDTDWTVADVSNFLSKKVDDPRLPGSTVTWREVFNETDQAIMSISRFMECVNLDKLEPVSSE---ERLVNQSMVLLEDRKFWAGIVFPD----IAPNATELPSKLNYKIRMDIDNVERTNKIK--DAYWDPGPRADPFEDMRYIWGGFSYLQDVIEQGIIRAVTGTKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIILKSVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLISAGLLVLLLKKGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTAFARANLAAACGGIIYFTLYLPYVLCVAWQDYIGFGAKVFASLLSPVAFGFGCEYFALFEEQGVGIQWKNLVSSPLEEDDFSLRTAIILMYFDSFLYGVLTWYIEAVFPGQYGIPRPWYFPFTKSYW-FGEKDGKSNKVPLTRRGNSGA----VCMEEEPAHLEPGVYIENLVKVYRHGKKLAVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGRDIRTELSTIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLSEEQVKGEIEQILQDTGLPHKRTSRTSTLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLNYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLYLKNQLGTGYYLTLVKKEPEPSLSSCRNSSSTVSFTKKEECASVSSSDAGLGSEHESEAATIGDLILRHVPAARMVEDLGHELTYVLPYRAAKDGAFVELFKDLDVKLPDLGISSYGVSDTTLEEIFLKVAEDNGVDTEVPSDGTLPVRRRRRTHAFGGGDHQSCLRPLTEDDNNDCNESDGDPECRETDWLNCTDGKGSYQVGGWSLKKQQFVALMWKRFLNARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMY------EDQVTFISDDAPGDANMQKLLDALMDAPG-FGTRCMDG--HPIPEAPCTMGDED--W---HIPDVPESVQQLFSSRNWTMEDPSPPCFCSCDGKKKMLPDCPAGAGGLPPPEVRMNLSATDTLQNLTGRNISDYLVKTYAQIIGKSVWFYFSYSERGFSFCRYGGFSLGARSTQVLPPANEIDDAIERVRKIFELQKGAAADRFLDSLSGF--INGLDTKNNVKIWFNNKGWHSIGAFINVMNNGILRANLPDDKDPR-EYGISAFNHPLNLTKEQLSQVALVTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQFISGVQPLLYWVANFIWDMCNYVVPATLVVLIFICFQQKAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSISTFVMELFGNN--EIGGINDILKNVLLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITVLIQY----RFCIKPRAVSKLTKLGALGEEDEDVARERQRIVNGLGHGDILELRQLTKVF--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1839          

HSP 2 Score: 190.66 bits (483), Expect = 1.246e-44
Identity = 104/331 (31.42%), Postives = 181/331 (54.68%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKS 3204
            + +  L K++   + P ++ L +     +    LG NGAGKTTT  +LTG    +SG A++  + I  E+D + Q +G CPQ++ + + LT  +H+  Y +L+ + + E+  V    I+ + L +  +  +   SGG  RKLS AMA IG   VVFLDEPT G+DP ARR +W+ +       R+I+LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           +  + +   ++KF++  ++ + + E+ R      LP +  +    T +F  L ++   + I  Y ++ T+L++VF+  A D  ++  +K+ S
Sbjct: 1795 LELRQLTKVFKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTVVTSGEAFLAGKSILREIDQVHQNMGYCPQFDAINELLTGREHLELYAVLRGIPEKEVCDVAEWGIRKLGLVKYADKAAGSYSGGNMRKLSTAMALIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRSIVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIILRVAGPDPDLLPVMKFIESELSGSTLKEKHRNMLQYQLPSSLTS---LTHIFSILAKNKETLRIEDYSVTQTTLDQVFVNFAKDQSDEYHSKDTS 2117          
BLAST of ATP binding cassette subfamily A member 1 vs. TrEMBL
Match: A0A3Q3L3K9 (Zgc:172302 OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 928.317 bits (2398), Expect = 0.000e+0
Identity = 649/1877 (34.58%), Postives = 989/1877 (52.69%), Query Frame = 1
Query:   28 QLRTLLWKNFRLKRRKWKI-LLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYD------------QTQINWLGTNLNEFHVF--IGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRL---QNSFSYISKRIVPL---ISTVNKVMSENETTIES-GYNELGEIICGSPE--------------NDFKLFMRNFIKNQRRKRSLLT-----CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNV---FINDVKKFCKAYYSANPKICDAVNTLFNITNVKS---------------YIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIF--NETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXX---------------------------------XXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDP-------MNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHL-LKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMG--KENLNTFYRKENISLGLINKLESEYRSDL-GESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTG-NQICND--LRSGG-PPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEM--EQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYN---SNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            QL  LLWKN   +RR   I L+IEL  PL +  IL +VR S   YK   C F  K + S G +P++   +C  N  C+             Q Q+  L  N +    F  +     + N L +   ++P      T    E  RL   Q +F+      +P+   ++ +  + +EN T + +  +     I+CG PE              ND K F+    KN      L       C+ +      N + +  ++  + PL  GK+ Y PN   ++Q++++ N TF+ L  L   +  W +     + +Y+ ++V    + D+ +  +     N ++ D   T+  IT+  S               ++D  + +   I      TE      L+ L+   +L +++      R   A ++F    T     P + T   Y+IR+ +  +  T K K  DRFW P P  + F D +Y+  GF+++Q+ +++A   ++T  +    G  +  MPYPCY+ D FL+ L   LP  + +AW  SV ++IK +VYEKE+RLKE M++MGL     W+SW IS++V  ++  V++   L+   I   S   VVF  +  +  + I Q F++S FFSKAN+A+  GG++YF  Y+ +V+ +     L+ T       LS VAF    ++   +E+   G+Q+ NL  +P E   +     II++ +D+FIY +  WY+EAVFPG+YG+ +PW F+   +YW   +     +P+    ++  E +H   E EP NL LG+SI NLVK+Y       +N+LNL FYE QIT+FLGHNGAGKTTTIS+LTG+F P+SGT YI   DIR +MD IR+ +G+CPQ+NVLFD LTVE+H++FYG LK M   E++  L  ++ DV L  K +  + +LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIWDLL+KYR  DRTIIL+TH+MDEA+ L DR+AIISQGKL CCGS +FLK + G GYYL+                                    +Q+    S  N   +L   + +I  AR++EES  +  + LPQ             +LDQ + E+ I SYGLSD++LEE+FLKVA++        +  ++++E+      C    +      + T I L   P +      D    + L G+ L  QQ+ AL IKR+ YA+R  +GF A+++LP L +L  +LF  I     K   +++ PW+   +      +       EN+   L+++           E G   M P +     +Q FY+     WS     D P  SPEC CS     ++  D  L +GG PP   + +T  D L NLTGYNISDYL+K + K+ +K YGGF     S  G +++ +   P   ++++ V   +A +          +  ++ +    G    FT++W N+KG+ +M ++ N+ +N LLR+ L     + + +GI+  N P+ +  EQ T+   +     +++ ++I VIF +SF+PASFV+FL+EERVS +K  QFVSG+ P +YW++NF WD++ Y +P  ++++IFI+F  QSY+   N  A ILLL+ YG +I P MYP SF  + PSTA+VVL + NL +G   +I+TF+L++  +N     E+N ILKKVFLIFP F LGRG++D+  N            K   + LQWD  G+ LF++ +  + ++I  I+++     R        S L         D DV  ERER+ S +   D+L +I+L+K+Y                       R+ AV+ LC G+  G+CFGLLGVNGAGKT+TF
Sbjct:    6 QLTLLLWKNITYRRRNKVIQLIIELLWPLFLFVILISVRHSHPPYKQSQCHFPNKALPSAGTLPWIQGIICNINNPCFHSPTPGETPGQVAQMQLKDLVCNASMLGQFLTVDEGEAVMNDLQTQLCDLP------TDVLREAERLFVSQLNFTKFFTVGIPVQGYLAALRLLSTENRTALPTESFRAFSRIMCGHPEVGGERIPSLNWYEDNDIKSFLG---KNGTEDTDLDHDNTPFCKSLIHGLESNPLSRI-VWRGIKPLFIGKLLYTPNTPAVQQVMKEVNKTFEDLQILLELNEAW-IEVGPRIKNYMESSVEIQLLQDLLRRPEVAVLVNLRLQDTSWTVSRITHFLSTPSPDAPRLPGEPPTWLDIYNDINHTITTLAQITECFSLNKLEGLETEGQLIDRALVLLEDRQLWAGVVFLLPNTSSLRVPPHVT---YKIRMDIDDVTRTNKIK--DRFWDPGPAADPFNDMRYIWGGFVYIQDLVERAVSRVLTGVQQT-TGIYVQQMPYPCYVDDVFLRVLNRSLPLFMTLAWIYSVAMIIKGVVYEKEARLKETMRIMGLGTGTLWLSWLISSMVPFLVSAVLLIALLKWGDILPYSDATVVFFFLMAFATATIMQCFLISTFFSKANLAAACGGLIYFGLYLPYVLCVAWRDHLNTTHRVLASFLSPVAFGFGCEYFSQYEEQGVGIQWYNLRSSPVEGDSYSFTLSIIMLYVDAFIYAIAAWYIEAVFPGEYGIPRPWYFIFQLNYW-GGVPLEAGMPIPPAPSEQDE-DH--IEPEPTNLILGVSIRNLVKIYKKGAKLAVNHLNLKFYEGQITSFLGHNGAGKTTTISVLTGLFPPTSGTIYIKGMDIRYDMDIIRRTLGVCPQHNVLFDILTVEEHVWFYGCLKGMSGAEVKDELDTLLDDVGLLHKRHEQTKNLSGGMQRKLSVAIAFVGGSKVVVLDEPTAGVDPYSRRGIWDLLLKYRK-DRTIILSTHYMDEAELLGDRIAIISQGKLCCCGSPLFLKSRLGSGYYLTVVKREGLDTSTPSSTSICTSISTNKLPPLKDSDSSMSQDTGLGSEENLAALLSLAQHHIPGARLVEESGREAVMNLPQTAAKDGSLAIFLLDLDQRLGELGISSYGLSDSTLEEIFLKVAEETGVDAEPDIGSIMSEEEGCGRSLCIYHPI-----TSHTVILLFSEPQETDLLSGDGRGGVPLTGWWLTWQQLRALFIKRWLYARRSRRGFFAQIVLPALFVLVALLFSLIVPPFGKYPALKLQPWMYGEQYTFFSNDAPGNSEMENLLEALLDQPGFGTNPQCEAERGGLFMRPQV-SYSTWQMFYKGN---WSS----DRP--SPECQCSTEDVRRMLPDCPLGAGGLPPPQIKRLT-GDILQNLTGYNISDYLVKTYSKILKKRYGGF-----SLGGSATQTLSQVP---QVQNSVMEVRARYR---------VPQVEGSVSFKGTNV-FTQVWYNNKGWHAMVSFVNVMNNGLLRANLPPGPER-MKHGITAYNHPLNLTKEQLTEMAMMTTS--VDVLVSICVIFAMSFVPASFVLFLIEERVSKAKHLQFVSGVKPILYWLANFTWDMLNYAVPATMVVLIFISFQQQSYVSETNLPALILLLLLYGWSITPLMYPASFVFTVPSTAYVVLTSINLFIGINGSIATFVLELFHLN-----EVNRILKKVFLIFPHFCLGRGLIDMAKNQAMADAFQRLGTKQTLDPLQWDFVGKNLFAMAAEGVVFFIFTILLQYKFFIRFRYFFFLISPLPM-------DEDVARERERVKSGKAQSDILTMIDLSKVYKA--------------------GRKPAVDRLCLGIPRGDCFGLLGVNGAGKTSTF 1791          

HSP 2 Score: 177.948 bits (450), Expect = 9.427e-41
Identity = 109/341 (31.96%), Postives = 182/341 (53.37%), Query Frame = 1
Query: 2188 EPENLKLG------ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRK--FTELFKNLDQHMAEMSIISYGLSDTSLEEVF----LKVADDP 3174
            E E +K G      +++ +L K+Y + + P ++ L L          LG NGAGKT+T  +LTG  + + G A++ +  + T+M+ + Q +G CPQ++ L D LT  +H+  Y  L+ + +  +  V    +K + LT+     +   SGG KRKLS A++ IG + V+FLDEPT G+DP A+R +W+ ++      R ++LT+H M+E + L  R+AI+  G+ QC GS+  LK +FG+GY + L       +  +         V  Y+ D+    E + +   VL Q  + SR      +F  L  +  E+ II + +S T+L++V     L++  DP
Sbjct: 1733 ERERVKSGKAQSDILTMIDLSKVYKAGRKPAVDRLCLGIPRGDCFGLLGVNGAGKTSTFRMLTGDTAVTYGEAFLNHYSVLTKMERVHQLMGYCPQFDALSDLLTGREHLELYARLRGVQEGSVAKVAQWGVKKLGLTQYAEREAGGYSGGNKRKLSTAISLIGAAPVIFLDEPTTGMDPKAKRFLWNCILSVTKEGRAVVLTSHSMEECEALCTRMAIMVNGRFQCLGSVQHLKNRFGDGYTIILRLADTKSNPDSCP-------VSTYMKDSFPSIELKERHQNVL-QYQLPSRSCCLARVFDVLANNYEELGIIDFSVSQTTLDQVRATIKLRIKVDP 2065          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Cavefish
Match: ENSAMXT00000016919.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:9912642:9956080:1 gene:ENSAMXG00000016432.2 transcript:ENSAMXT00000016919.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 644/1932 (33.33%), Postives = 1021/1932 (52.85%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITE-IYNSLPSGALNVPKF----------------MKWITSNPNEFIRLQNSFSYISKRI-VPLISTV--------------NKVM--SENETTIESG-YNELGEIICGSPE--------------NDFKLFMRNFIKNQRRKRSLLT------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSK-------LFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEG-YYXXXXXXXXXXXXXXXXXXXILKFVKI------------------------------------YIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD-------------PMNKLINKEKSYYSYYCNILK---MKLRINATKTEIFLNQNPDQKQSKFLDQSD----HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDIPMV--------SPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKT-SFTRIWANSKGYVSMPAYANIF--XXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            IS QLR LLWKNF  +RR+   LLIE+  PL + FIL AVR +   Y+   C F  K M S G +P++   +C  N  C+             E    +GN  + I + L S A  +  +                +K + +N +    +  +F  + K + +PL S +              N+++  + N T   S  Y  +  I+CG PE              +++K    N+  +     S+        C  + ++   N I +  ++  L PL+ GK+ Y P+     +II++ N TF+ L  LR     W    +    +++ ++  ++ ++   +   +A         T +++ +V S++   S+        F+W             I R + C  LD+  P+ +    +KL N S      R F A IIF +  Q  + +    ++Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ I+Q+ I  VT  +  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV ++IK +VYEKE+RLKE M++MGL+N + W SWFIS+++ L++   ++ + L++  +   S   VVF  +  + +  I Q F++S  F++AN+A+  GGI+YFT Y+ +V+ +  +  + L       LLS VAF    ++   +E+   G+Q+ NLF +P E   + +   II+M +D+FIY ++TWY+EAVFPGQYG+ +PW F   +SYW +        P+++    N        E EP +L +G+ I NLVK+Y   K   +++L L FYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYI+ +DIR+E+ +IRQ +G+CPQ+NVLF  LTVE+H++FY  LK + + E+++ + +I+ D  L  K  + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP+ARRGIWDLL+KYR+  RTIIL+THHMDEAD L DR+AIIS GKL C GS +FLK   G G Y   + K      +S RN  + + +VK                                     ++ +ARM+E+   + T +LP        F ELF ++D H+A++ I SYG+SDT+LEE+FLKVA+D             P+ +   +  ++ + + + LK      R +  ++E+    +P+ +++ +L  SD    + ++G+ L +QQ +AL  KR+ YA+R  KGF A+++LP + +   ++F  I     K   + + PW+       E+  TF   +        +L +      G  G RCM      + +  C   +++  WS    P S+L++ M         SP C+CS  G +     C     G PP   +I +  D L NLTG NISDYL+K + ++  K            YGGF     ST     +++   P  EE+ D +   +   N   + + +F+  L     I G+ T +  +IW N+KG+ S+ A+ N+     L       K   K   YGI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERV+ +K  QF+SG+ P++YW++NF+WD+  Y++P  ++I+IF+ F  ++Y+ + N     LLL+ YG +I P MYP SF    PSTA+VVL + N+L+G   ++STF+L++   N   +  INDILK V LIFP F LGRG++D+  N    ++++ +   N      +WD+ G+ LF++    + ++I+ ++I+     +       N+ L  I     ED DV  ER+R+ S     D+L +  LTK+Y                     + ++ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct:    3 ISTQLRLLLWKNFTYRRRQTLQLLIEIVWPLFIFFILIAVRLNYPPYEQHECHFPNKAMPSAGTLPWIQGIVCNANNPCFRHP-------TPGESPGVVGNFNDSIISRLFSDAKKILLYSQNDKSLDGFKELIHAVKALQNNTSGKQAVGVTFKSLGKLLEMPLTSLMFPQLASMRSWSDLRNEILFLTRNATGSPSQMYQAVSRIVCGHPEGGGLKIKSLNWYEDSNYKALFGNYNSSDEEPVSVYDNTSTPFCNNLMKNMETNPISRM-IWRALKPLLMGKILYTPHTPATHKIIKEVNRTFQELGVLRDLGGMWE-ETRPKAWNFMEHSEEMDLLRTLLQNNVTAAFFSAQLTGTQWSVQDVISFLTKQSEDTRPHGTAFTWRDVFNETDQAIMSISRFMECVNLDKLEPVSTE---EKLINDSLGLLDNRKFWAGIIFPD-IQSNSSELPPHVNYKIRMDIDNVERTNKIK--DAYWDPGPRADPFEDLRYVWGGFSYLQDVIEQSIIRAVTGTKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLMSAGLLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTVFARANLAAACGGIIYFTLYLPYVLCVAWQDYIGLPAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWKNLFSSPMEKDDYSLTTSIIIMYVDAFIYGVMTWYIEAVFPGQYGIPRPWYFPFTKSYW-FGEGDQRPTPILKGRKANS--GAVCIEEEPTHLDMGVYIENLVKVYRHGKKLAVDDLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSAIRQSLGVCPQHNVLFSMLTVEEHVWFYARLKGLSEEEVKAEIDQILYDTGLPHKRKSRTCELSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRT-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTLVKKEPEASLSSCRNSSSTVSYVKKDDEASESSSDAGLGSDHESDAATAIDISLISGLIIKHVPNARMVEDLGHEITYILPYESAKDGAFVELFHDMDDHLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEILSDGTFPIRR--RRRHAFGADHQSCLKPLTEDDRYDGNESEV----DPESRETDYLSGSDGKGSYQIQGWSLKRQQFLALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALQPWMY------EDQVTFISDDAPEDASTQRLLAALMEGPG-FGTRCMEGE--PIPDAPCTIGDDD--WSIPEVPESVLEVLMSQNWTMDNPSPACECSSDGKKKMLPECPASAGGLPPPQIKI-SERDTLQNLTGRNISDYLVKTYAQIIGKSLKNKVWVNEFRYGGFSLGARST-----QVL---PPAEEIDDAIARVRVIFNLEKVTADRFLKSLSAF--INGLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRANLPPEKDPSK---YGITAFNHPLNLTKEQLSQVALVTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFIWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFEIPSTAYVVLTSVNILIGINGSVSTFVLELFGNN--EIGGINDILKNVLLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPFEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFK------PNAKLSPI---GEEDEDVARERQRIVSGAGQGDILELRELTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1851          

HSP 2 Score: 194.126 bits (492), Expect = 5.167e-49
Identity = 105/320 (32.81%), Postives = 174/320 (54.37%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + +  L K+Y   + P ++ L +     +    LG NGAGKTTT  +LTG    +SG A++  + I  E+D + Q +G CPQ++ + D LT  +H+ FY +L+ + + E+  V    I+ + L +  +  +   SGG  RKLS AMA IG   VVFLDEPT G+DP ARR +W+ +       R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           +  + + + ++KF++  +  + + E+ R      LP    +      +F  L +H   + I  Y +S T+L++VF+  A D
Sbjct: 1807 LELRELTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTVVTSGEAFLARKSILREIDQVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEREVCEVAEWGIRKLGLVKYSDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIILRVAGPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLPS---SVSSLAHIFSILAKHKDFLRIEDYSVSQTTLDQVFVNFAKD 2118          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 570/1723 (33.08%), Postives = 896/1723 (52.00%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAV-----NTLFNITNVKSYIDGVSK--------------LFSWIERGL-------NCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWV-----------------YNIKSSESIPLMRNNNQNCEINHQA--------------------------------------------FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLK----------------------RKFG----------------EGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLN-QNPDQKQSKFLDQSD------------HLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMW-----SPASILDIP--------MVSPECDCSK----TGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNL-NSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMI--LEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNY-FYNSNSIVKHEY--NALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            M+N L P + GK+ Y P+   IRQ+I+ AN TF+ L+ LR     W       L D+  +N+ ++ ++   +     NP + D +     NT   I ++ +++   S+              +F+  +R L        C  LD+F+    L D  +LT ++      + F A ++F +TF + T K    + ++IR+ +  ++ T K K  DR+W P PR +   D +YV  GF +LQ+ ++ A I+  T  E   +G  +  MPYPCY+ D F+  L+   P  +V+AW  SV++++KS+V EKE RLKE +K MG+ N V W +WFI + +V+     +++  +   K+   S+  ++F  +  +  + I Q F+++VFF+KAN+A+   GILYF+FY+  +     +  ++  M     L+SQVAF    +++  +E+   G+Q+ N+  +P E   F     II+M++D+ +Y ++ WY+++VFPGQYG+ +P+ F    SYW+                  +I +S   P    NNQ   +  Q                                             FE+EP  L +G+ + NLVK++  +  P ++ L++ FYE QITAFLGHNGAGKTTT+SILTG+F P+SGTA+I  +DIRT+MD+IR  +G+CPQ+N++F  +TV +HI FY LLK     E +  +  +++D  L  K N  + +LSGG++RKLS+AMAF+G ++VVFLDEPT+GVDP++RR IWDLL+KYR   RT+IL+THHMDEAD LSDRVAIISQG+L CCGS +FLK                      RK G                E    +  + ++     + + E I   V  ++ +AR++E    + T +LP      R +  LF+ L++ +A++ + S+G+SDTSLEE+FLKV  D    L        +          R     T + +N + P+ K++    Q                +KG  L+ +Q +AL IKR+H+  R  K F A+++LP   +L  ++F  I     +   + +SPW+   +       TF+  E   +  +        +  G  G RCM      L+ Y C   N    W     +PA ++D+           SP+C CS     T   +C +  +GG P   RI ++ D L +LTG NISDYL+K +P L R           + YGG      LP   G S K I D+   E+L    N +   H +  L ++  F+ Y++  + +        ++W N+KG+ +MPA+ N+ +N +LR+ L  +A    +YG++V N P+ + +    L  VN +   ++  +A+ VIF +SF+PASFV++L++ERV+ +K  QFVSG++P VYW +NFLWD++ Y +   +++ IFI FD + Y    N  A I LL+ YG ++ P MYP S+  S PSTA+V L+  NL +G  ++  TFILD+ + +   L   N +LK+V LIFP F LGRG++D+  N    +  +    +Y  +   W+  G+ +  + +    ++I+ I+I+     R           K + +   ED DV  ERER+     S D+L + +L+K Y                    +   + AV+ +C GV  GECFGLLGVNGAGKTTTF
Sbjct:  386 MWNTLKPFLMGKILYAPDSPAIRQLIKNANSTFEELERLRNIIRSWE-EVGPQLWDFFQSNIQLDVLRDILR-----NPSVMDYMDRGLKNTGLTIRHILNFLHTGSEEERERDMVQFDWRNIFNLTDRTLRMINQYGECLVLDKFV---GLPDETQLTQKALDLIAEKKFWAGLVFVDTFSWTT-KIPPHIKFKIRMDIDTVERTNKIK--DRYWDPGPRADPMDDLRYVWGGFAYLQDMVEHAVIKTHTGKE-WPLGVYLQQMPYPCYVDDLFMLTLSRCFPIFIVLAWVYSVSMMVKSVVLEKEMRLKETLKAMGVTNEVLWCAWFIDSFLVMAASTALLTAIIMGGKVLNYSNPIILFIFLLTFTTATIMQCFLMTVFFNKANLAAACSGILYFSFYLPHLACFTWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIHTSPLEGDEFSFHTSIIMMLLDTVLYAVLAWYLDSVFPGQYGIGRPFYFPIQPSYWLNLTNPTKAVPEKSVVKRPSIDNSAQKPEETANNQTQPVEEQTTQPSEPPGTCKHGDRREKLGMQIKLEEEGSSYQNQSYLSGEKVFFEAEPSGLVVGVHVENLVKVFSGSSKPAVDGLSITFYEGQITAFLGHNGAGKTTTMSILTGLFPPTSGTAFIYGKDIRTDMDTIRHSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLAEAQQEVENMLEDFGLPHKRNEQTQNLSGGLQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYRP-GRTVILSTHHMDEADLLSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGQTKSAGRQMDGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEIFLKVTADGETSLGKSAADLRALQETSRSSVFR----DTTVTVNTEEPEDKKACANGQPTAGGSSSGEGQGSRQVKGVSLVVKQFLALLIKRFHHTTRSGKDFFAQIVLPASFVLVSLMFTLIVPPFGEYPSLTLSPWIYGRQF------TFFSNEQSEMEGMKYFADVLLNRPG-FGTRCMVDE--PLEEYPC--NNITTEWEKPLVNPA-LVDVLNKSQWTELRPSPDCQCSTPTKLTMLPVCPE-GAGGLPLPQRIQSTGDVLIDLTGRNISDYLVKTYPTLIRTSLKSKYWVNEQRYGGISVGGRLP-VVGLSPKTIQDTA--EQLGGIFNITAGKHVKRALRDTGTFLRYMETEYNV--------KVWYNNKGWHAMPAFLNVANNAILRAHLPTNA-NPSEYGVTVINHPLNLTKEQ--LSEVNVLTTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFLWDMISYSVSAALVVQIFINFDKKCYTSPANLHALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCLNLFIGINSSAITFILDLFDSS-TTLYMFNQVLKRVLLIFPHFCLGRGLIDMAINQAVMDVYAQFGEDYSLDPFSWNFVGKNVVCMAAEGFIYFILNILIQY----RFFLEHWMPDSKKPLIV--DEDLDVAKERERIYRGGSSSDILHIRDLSKTY--------------------SGGTKPAVDRICVGVSPGECFGLLGVNGAGKTTTF 2036          

HSP 2 Score: 164.081 bits (414), Expect = 6.947e-40
Identity = 84/228 (36.84%), Postives = 128/228 (56.14%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            + I +L K Y     P ++ + +     +    LG NGAGKTTT  +LTG    SSG A I    I T +  +   +G CPQ++ + D LT  +H++ Y  L+ + ++EI  V    I+ + L++     +   SGG KRKLS A+A IG   +V LDEPT G+DP +RR +W  ++      R ++LT+H M+E + L  R+AI+  G  +C G++  LK KFG+GY
Sbjct: 1992 LHIRDLSKTYSGGTKPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVSSGEAAITGYSILTNILDVYHNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSQYAGYGAGTYSGGNKRKLSTAIAMIGCPALVLLDEPTTGMDPHSRRFLWKSIMSVIQDGRAVVLTSHSMEECEALCTRLAIMVNGIFKCLGTIQHLKYKFGDGY 2219          

HSP 3 Score: 53.9138 bits (128), Expect = 1.975e-6
Identity = 23/80 (28.75%), Postives = 42/80 (52.50%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQ 264
            +Q+R LLWKN+ +++R+     +E+  P+++   L  +R +   Y+   C F  K M S G +P++    C  N  C+  
Sbjct:    5 SQVRLLLWKNWTVRKRQKMRFFMEIMWPVMLFIGLVWLRKANPLYRQHECHFPNKAMPSAGVLPWIQGIFCNANNPCFQH 84          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 846.655 bits (2186), Expect = 0.000e+0
Identity = 569/1710 (33.27%), Postives = 888/1710 (51.93%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAV-----NTLFNITNVKSYIDGVSK--------------LFSWIERGL-------NCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWV-----------------YNIKSSESIPLMRNNNQNCEINHQA--------------------------------------------FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLK----------------------RKFG----------------EGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMW-----SPASILDIP--------MVSPECDCSK----TGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSR-----------KLYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNL-NSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMI--LEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNY-FYNSNSIVKHEY--NALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            M+N L P + GK+ Y P+   IRQ+I+ AN TF+ L+ LR     W       L D+  +N+ ++ ++   +     NP + D +     NT   I ++ +++   S+              +F+  +R L        C  LD+F+    L D  +LT ++      + F A ++F +TF + T K    + ++IR+ +  ++ T K K  DR+W P PR +   D +YV  GF +LQ+ ++ A I+  T  E   +G  +  MPYPCY+ D F+  L+   P  +V+AW  SV++++KS+V EKE RLKE +K MG+ N V W +WFI + +V+     +++  +   K+   S+  ++F  +  +  + I Q F+++VFF+KAN+A+   GILYF+FY+  +     +  ++  M     L+SQVAF    +++  +E+   G+Q+ N+  +P E   F     II+M++D+ +Y ++ WY+++VFPGQYG+ +P+ F    SYW+                  +I +S   P    NNQ   +  Q                                             FE+EP  L +G+ + NLVK++  +  P ++ L++ FYE QITAFLGHNGAGKTTT+SILTG+F P+SGTA+I  +DIRT+MD+IR  +G+CPQ+N++F  +TV +HI FY LLK     E +  +  +++D  L  K N  + +LSGG++RKLS+AMAF+G ++VVFLDEPT+GVDP++RR IWDLL+KYR   RT+IL+THHMDEAD LSDRVAIISQG+L CCGS +FLK                      RK G                E    +  + ++     + + E I   V  ++ +AR++E    + T +LP      R +  LF+ L++ +A++ + S+G+SDTSLEE+FLKV  D    L                      A K      Q      S    Q    +KG  L+ +Q +AL IKR+H+  R  K F A+++LP   +L  ++F  I     +   + +SPW+   +       TF+  E   +  +        +  G  G RCM      L+ Y C   N    W     +PA ++D+           SP+C CS     T   +C +  +GG P   RI ++ D L +LTG NISDYL+K +P L R           + YGG      LP   G S K I D+   E+L    N +   H +  L ++  F+ Y++  + +        ++W N+KG+ +MPA+ N+ +N +LR+ L  +A    +YG++V N P+ + +    L  VN +   ++  +A+ VIF +SF+PASFV++L++ERV+ +K  QFVSG++P VYW +NFLWD++ Y +   +++ IFI FD + Y    N  A I LL+ YG ++ P MYP S+  S PSTA+V L+  NL +G  ++  TFILD+ + +   L   N +LK+V LIFP F LGRG++D+  N    +  +    +Y  +   W+  G+ +  + +    ++I+ I+I+     R           K + +   ED DV  ERER+     S D+L + +L+K Y                    +   + AV+ +C GV  GECFGLLGVNGAGKTTTF
Sbjct:  386 MWNTLKPFLMGKILYAPDSPAIRQLIKNANSTFEELERLRNIIRSWE-EVGPQLWDFFQSNIQLDVLRDILR-----NPSVMDYMDRGLKNTGLTIRHILNFLHTGSEEERERDMVQFDWRNIFNLTDRTLRMINQYGECLVLDKFV---GLPDETQLTQKALDLIAEKKFWAGLVFVDTFSWTT-KIPPHIKFKIRMDIDTVERTNKIK--DRYWDPGPRADPMDDLRYVWGGFAYLQDMVEHAVIKTHTGKE-WPLGVYLQQMPYPCYVDDLFMLTLSRCFPIFIVLAWVYSVSMMVKSVVLEKEMRLKETLKAMGVTNEVLWCAWFIDSFLVMAASTALLTAIIMGGKVLNYSNPIILFIFLLTFTTATIMQCFLMTVFFNKANLAAACSGILYFSFYLPHLACFTWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIHTSPLEGDEFSFHTSIIMMLLDTVLYAVLAWYLDSVFPGQYGIGRPFYFPIQPSYWLNLTNPTKAVPEKSVVKRPSIDNSAQKPEETANNQTQPVEEQTTQPSEPPGTCKHGDRREKLGMQIKLEEEGSSYQNQSYLSGEKVFFEAEPSGLVVGVHVENLVKVFSGSSKPAVDGLSITFYEGQITAFLGHNGAGKTTTMSILTGLFPPTSGTAFIYGKDIRTDMDTIRHSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLAEAQQEVENMLEDFGLPHKRNEQTQNLSGGLQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYRP-GRTVILSTHHMDEADLLSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGQTKSAGRQMDGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEIFLKVTADGETSLGKSA------------------ADKKACANGQPTAGGSSSGEGQGSRQVKGVSLVVKQFLALLIKRFHHTTRSGKDFFAQIVLPASFVLVSLMFTLIVPPFGEYPSLTLSPWIYGRQF------TFFSNEQSEMEGMKYFADVLLNRPG-FGTRCMVDE--PLEEYPC--NNITTEWEKPLVNPA-LVDVLNKSQWTELRPSPDCQCSTPTKLTMLPVCPE-GAGGLPLPQRIQSTGDVLIDLTGRNISDYLVKTYPTLIRTSLKSKYWVNEQRYGGISVGGRLP-VVGLSPKTIQDTA--EQLGGIFNITAGKHVKRALRDTGTFLRYMETEYNV--------KVWYNNKGWHAMPAFLNVANNAILRAHLPTNA-NPSEYGVTVINHPLNLTKEQ--LSEVNVLTTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFLWDMISYSVSAALVVQIFINFDKKCYTSPANLHALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCLNLFIGINSSAITFILDLFDSS-TTLYMFNQVLKRVLLIFPHFCLGRGLIDMAINQAVMDVYAQFGEDYSLDPFSWNFVGKNVVCMAAEGFIYFILNILIQY----RFFLEHWMPDSKKPLIV--DEDLDVAKERERIYRGGSSSDILHIRDLSKTY--------------------SGGTKPAVDRICVGVSPGECFGLLGVNGAGKTTTF 2009          

HSP 2 Score: 164.081 bits (414), Expect = 6.191e-40
Identity = 84/228 (36.84%), Postives = 128/228 (56.14%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            + I +L K Y     P ++ + +     +    LG NGAGKTTT  +LTG    SSG A I    I T +  +   +G CPQ++ + D LT  +H++ Y  L+ + ++EI  V    I+ + L++     +   SGG KRKLS A+A IG   +V LDEPT G+DP +RR +W  ++      R ++LT+H M+E + L  R+AI+  G  +C G++  LK KFG+GY
Sbjct: 1965 LHIRDLSKTYSGGTKPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVSSGEAAITGYSILTNILDVYHNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSQYAGYGAGTYSGGNKRKLSTAIAMIGCPALVLLDEPTTGMDPHSRRFLWKSIMSVIQDGRAVVLTSHSMEECEALCTRLAIMVNGIFKCLGTIQHLKYKFGDGY 2192          

HSP 3 Score: 53.9138 bits (128), Expect = 2.023e-6
Identity = 23/80 (28.75%), Postives = 42/80 (52.50%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQ 264
            +Q+R LLWKN+ +++R+     +E+  P+++   L  +R +   Y+   C F  K M S G +P++    C  N  C+  
Sbjct:    5 SQVRLLLWKNWTVRKRQKMRFFMEIMWPVMLFIGLVWLRKANPLYRQHECHFPNKAMPSAGVLPWIQGIFCNANNPCFQH 84          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Cavefish
Match: zgc:172302 (zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5])

HSP 1 Score: 843.958 bits (2179), Expect = 0.000e+0
Identity = 580/1728 (33.56%), Postives = 917/1728 (53.07%), Query Frame = 1
Query:  478 VMSENETTI-ESGYNELGEIICGSPENDFKLF----------MRNFIKNQRRKRSLLT-------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIE------RGLNCTELDRFIPLDS-------------------LKDIDKLTNQSF-----RNFLAVIIF---NETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMP----YPCYL--IDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSS----ESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXIL---------------------------KFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHL---------LKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSI---YRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSI----VKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            ++ EN + + +  +     I+CG PE D +            +++F+   R + + L        C+ + Q+   N + +   +  + PL  GK+ Y P+    R+I+++ N TF+ LD L      W       +  ++ N++ I  +K F +      P++   VN    + N       +++  S  +      +G   T LD +  L+S                   L   D++  ++      R F A I+F   + +   L P     + Y+IR+ +  +  T + K  D+FW P P  + F+D +Y+  GF+++Q+ +++A  +++        G  + + P    + C++     FL+ L   LP  L +AW  SV ++IK +VYEKE+RLKE M++MGL++   W+SWF+S+ ++ +I  +++   L++  I   S  AVVF  +  +  + I   F++S FFS+AN+A+  G + YF+ Y+ +V+ +     L+         LS VAF    +++  +E+   G+Q+SN++ +P E   + +   II++ +D+FIY + TWY+EAVFPGQYG+ +PW F+    YW   +  +       P+   +N+         E+EP +L LG++IHNLVK+Y       +N+L++ F+E QIT+FLGHNGAGKTTT+SILTG+F P++G+ YI   DIRT+M+ IR+ +G+CPQ+NVLFD LTVE+H++FYG +K M  +E++  +  +++DV LT K +  + +LSGGM+RKLS+A+AFIG S+VV LDEPTAGVDP++RRGIWDLL+KYR  DRTIIL+TH+MDEAD L DR+AIISQGKL CCGS +FLK   G GYYL+ +K +            +L                              + Y++ AR++E+   +  I LP               LD+  AE  IISYGLSDT+LEE+FLKVA++        E                  AT   +  +Q  +  + +  D++D L         L G+ L  QQ+ AL  KR  YA R  KGF+A+++LP L IL  +LF  I     K   +++ PW+   +       TF+  +      +  L S      G  G +C+        + ++ Q  +       SP   ++ P  SP+C CS    +     C +   G PP   + +T  D L NLTG NISDYL+K +P++ +K            YGGF          S  LIG      +L + V A +  +  +  +SL + +D L   F     + +  ++W N+KG+ +M ++ NI +N LLR+ L     +   +GI+  N P+ + +      ++    +++ L+I VIF +S +PASFV+FL+EERVS +K  QFVSG+ P +YW +NF+WD++ Y +P  ++++IFI F  Q+Y+  KN  A +LLL+ YG AI P MYP SF  S PSTA+V L + NL +G   +I+TF+L++     E+L+E+N ILKKVFLIFP F LGRG++D+  N    ++++     K     L+WD  G+ LF++    + ++I  I+++     R      +      +     ED DV  ER+R+ + +  DD+L +I+L+K+Y                       ++ AVN LC G+  GECFGLLGVNGAGKT+TF
Sbjct:  249 LLQENSSALPQKRFQAFSRIMCGHPEQDGESIPSFNWYEDQDIKSFLGRSRSEETDLENDTTSPFCKSMIQNLEMNPVSRI-FWRGIKPLFIGKILYAPDTPATRRIMKEVNRTFQTLDVLEEVYGAWE-EVGPRIKRFMENSLEIRLLKDFLR-----RPEVAVVVN--LRLENTSWTASRLAQFLSTPDPDTPRRKGAPPTWLDLYQDLNSSLSTLSQVTKCFSQNKMEGLDTEDEMVERALELLEDRQFWAGIVFLLPDPSSSNLPPH----VKYKIRMDVDDVTRTNEIK--DKFWDPGPAADPFSDMRYIRGGFVYVQDLVERAITQVL--------GVFIKVTPENKFFFCWVSFPFSFLRVLNRSLPLFLTLAWTYSVAMIIKCVVYEKEARLKETMRIMGLSSGTLWLSWFVSSYLIFLISSLLLVTVLKVGDILPYSDPAVVFFFLSAFATATIMLCFLISTFFSRANLAAACGDLAYFSLYLPYVLCVSWREYLTSVHRILASFLSPVAFGFGCEYLSQYEEQGLGIQWSNMWSSPTEGDKYSLSTSIIMLYVDAFIYGVATWYIEAVFPGQYGIPRPWYFVFQLKYWGGALMEAGLPIPPAPIDEGDNR--------IEAEPSDLILGVAIHNLVKIYKKGAKLAVNHLSVKFFEGQITSFLGHNGAGKTTTLSILTGLFPPTAGSVYIKGMDIRTDMNEIRRTLGVCPQHNVLFDMLTVEEHVWFYGHMKGMSSSEVKEEMASLLEDVGLTHKRHEQTKNLSGGMQRKLSVAIAFIGGSKVVILDEPTAGVDPYSRRGIWDLLLKYR-KDRTIILSTHYMDEADLLGDRIAIISQGKLCCCGSSLFLKSHLGTGYYLTAVKKELQSRTPTSASGKLLAADTDSTRSDDTGLGSEVNSSVISGLVALAQHYVSGARLVEDVGREVVINLPHAASEDGTLALFLAELDKRQAEFGIISYGLSDTTLEEIFLKVAEETGVDAEPDEA-----------------ATPPAVSPSQQGEPPEDR--DETDPLSGDGRGSVSLTGWGLTWQQLRALFTKRLLYATRSRKGFIAQIVLPALFILIDLLFSLIVPPMGKYPALELQPWMYGEQF------TFFSNDAPQDPAMQNLLSALLDPPG-FGTKCLCTGENVGTKFNSPQIPFSTWKLFNSPNWTMEHP--SPDCMCSTEEVRRMLPDCPEGAGGLPPPQIKRLT-GDILQNLTGRNISDYLMKTYPQILKKSMKTKKWVNEFRYGGFSLGAKG----SQTLIGSL----QLEESVMAIRKQYKIAENSSLDQLLDRLPDLFTDLNSQNN-VKVWYNNKGWHAMVSFVNIMNNGLLRASLPPGPER-QKHGITAYNHPLNLTKEQLSDMVLMTTSVDVLLSISVIFAMSLVPASFVLFLIEERVSKAKHLQFVSGVKPILYWTANFVWDMLNYTVPATLVVLIFIGFQQQAYVSEKNLPALVLLLLLYGWAITPLMYPASFVFSVPSTAYVTLTSINLFIGINGSIATFVLELF--TNEHLREVNRILKKVFLIFPHFCLGRGLIDMAKNQAM-ADALQRLGTKQTLEPLEWDFVGKNLFAMAVEGVVFFIFTILLQYKFFIRCRLPWFE----PVLPPLCAEDEDVGRERDRVKNGRTQDDILTLIDLSKVY--------------------KSGKKPAVNRLCLGIPRGECFGLLGVNGAGKTSTF 1878          

HSP 2 Score: 189.504 bits (480), Expect = 1.309e-47
Identity = 109/320 (34.06%), Postives = 173/320 (54.06%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            +++ +L K+Y S K P +N L L     +    LG NGAGKT+T  +LTG  S + G A++ N  + TEMD + Q +G CPQ++ + + LT  +H+ FY  L+ + +  +  V    +K + LT   +  +   SGG KRKLS A++ IG   V+FLDEPT G+DP A+R +W+ +       R +ILT+H M+E + L  R+AI+  G+ QC GS+  LK +FG+GY + L  +         +      F  I + +      + LQ+   LP    NS     +F  L  +  E+ +  Y +S T+L++VF+  A +
Sbjct: 1834 LTLIDLSKVYKSGKKPAVNRLCLGIPRGECFGLLGVNGAGKTSTFLMLTGDTSVTCGEAFLCNHSVLTEMDRVHQLMGYCPQFDAINELLTGREHLEFYARLRGVPEAYVAKVAQWGVKKLGLTHYADREAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVIKEGRAVILTSHSMEECEALCTRMAIMVNGRFQCLGSVQHLKNRFGDGYTIILRLSAPPKDPCPVDAYIKNSFTGIVLKE---RHHNVLQYQ--LPS---NSCSLARVFDVLSNNYEELGVTDYSISQTTLDQVFVNFAKE 2145          

HSP 3 Score: 62.7734 bits (151), Expect = 4.106e-9
Identity = 31/80 (38.75%), Postives = 42/80 (52.50%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            I  QL  LLWKNF  +RR    L+ EL  PL +  IL +VR+S   YK   C F  K + S G + ++   +C  N  C+
Sbjct:    3 IGTQLYLLLWKNFTYRRRNKFQLITELLWPLFLFLILISVRNSHPPYKQSQCHFPNKALPSAGTLAWVQGIVCNVNNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Cavefish
Match: zgc:172302 (zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5])

HSP 1 Score: 840.877 bits (2171), Expect = 0.000e+0
Identity = 574/1682 (34.13%), Postives = 906/1682 (53.86%), Query Frame = 1
Query:  478 VMSENETTI-ESGYNELGEIICGSPENDFKLF----------MRNFIKNQRRKRSLLT-------CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWR---LHFQTFL------------LDYISNN--VFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIF---NETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMP----YPCYL--IDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXX-XILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHL---------LKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVK----HEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            ++ EN + + +  +     I+CG PE D +            +++F+   R + + L        C+ + Q+   N + +   +  + PL  GK+ Y P+    R+I+++ N TF+ LD L      W       + F+             D++      F++           A P   D    L +  +  S +  V  L + +E GL+  +      L+ L+D         R F A I+F   + +   L P     + Y+IR+ +  +  T + K  D+FW P P  + F+D +Y+  GF+++Q+ +++A  +++        G  + + P    + C++     FL+ L   LP  L +AW  SV ++IK +VYEKE+RLKE M++MGL++   W+SWF+S+ ++ +I  +++   L++  I   S  AVVF  +  +  + I   F++S FFS+AN+A+  G + YF+ Y+ +V+ +     L+         LS VAF    +++  +E+   G+Q+SN++ +P E   + +   II++ +D+FIY + TWY+EAVFPGQYG+ +PW F+    YW   +  ++ I                 E+EP +L LG++IHNLVK+Y       +N+L++ F+E QIT+FLGHNGAGKTTT+SILTG+F P++G+ YI   DIRT+M+ IR+ +G+CPQ+NVLFD LTVE+H++FYG +K M  +E++  +  +++DV LT K +  + +LSGGM+RKLS+A+AFIG S+VV LDEPTAGVDP++RRGIWDLL+KYR  DRTIIL+TH+MDEAD L DR+AIISQGKL CCGS +FLK   G GYYL+ +K +             ++   + Y++ AR++E+   +  I LP               LD+  AE  IISYGLSDT+LEE+FLKVA++        E +           +      +  +  NQ      ++   ++D L         L G+ L  QQ+ AL  KR  YA R  KGF+A+++LP L IL  +LF  I     K   +++ PW+   +       TF+  +      +  L S      G  G +C+       ++ Q  +       SP   ++ P  SP+C CS    +     C +   G PP   + +T  D L NLTG NISDYL+K +P++ +K            YGGF          S  LIG      +L + V A +  +  +  +SL + +D L   F     + +  ++W N+KG+ +M ++ NI +N LLR+ L     +   +GI+  N P+ + +      ++    +++ L+I VIF +S +PASFV+FL+EERVS +K  QFVSG+ P +YW +NF+WD++ Y +P  ++++IFI F  Q+Y+  KN  A +LLL+ YG AI P MYP SF  S PSTA+V L + NL +G   +I+TF+L++     E+L+E+N ILKKVFLIFP F LGRG++D+  N    ++++ +    H  + + WD  G+ LF++    + ++I  I+++     R      +      +     ED DV  ER+R+ + +  DD+L +I+L+K+Y                       ++ AVN LC G+  GECFGLLGVNGAGKT+TF
Sbjct:  225 LLQENSSALPQKRFQAFSRIMCGHPEQDGESIPSFNWYEDQDIKSFLGRSRSEETDLENDTTSPFCKSMIQNLEMNPVSRI-FWRGIKPLFIGKILYAPDTPATRRIMKEVNRTFQTLDVLEEVYGAWEEVGPRIKRFMENKNICFLFSVHQDFLRRPEVAFLSTPDPDTPRRKGAPPTWLDLYQDLNSSLSTLSQVTKVPFLINKME-GLDTEDEMVERALELLED---------RQFWAGIVFLLPDPSSSNLPPH----VKYKIRMDVDDVTRTNEIK--DKFWDPGPAADPFSDMRYIRGGFVYVQDLVERAITQVL--------GVFIKVTPENKFFFCWVSFPFSFLRVLNRSLPLFLTLAWTYSVAMIIKCVVYEKEARLKETMRIMGLSSGTLWLSWFVSSYLIFLISSLLLVTVLKVGDILPYSDPAVVFFFLSAFATATIMLCFLISTFFSRANLAAACGDLAYFSLYLPYVLCVSWREYLTSVHRILASFLSPVAFGFGCEYLSQYEEQGLGIQWSNMWSSPTEGDKYSLSTSIIMLYVDAFIYGVATWYIEAVFPGQYGIPRPWYFVFQLKYWGGALMEADRI-----------------EAEPSDLILGVAIHNLVKIYKKGAKLAVNHLSVKFFEGQITSFLGHNGAGKTTTLSILTGLFPPTAGSVYIKGMDIRTDMNEIRRTLGVCPQHNVLFDMLTVEEHVWFYGHMKGMSSSEVKEEMASLLEDVGLTHKRHEQTKNLSGGMQRKLSVAIAFIGGSKVVILDEPTAGVDPYSRRGIWDLLLKYRK-DRTIILSTHYMDEADLLGDRIAIISQGKLCCCGSSLFLKSHLGTGYYLTAVKKELQSRTPTSASGNGLVALAQHYVSGARLVEDVGREVVINLPHAASEDGTLALFLAELDKRQAEFGIISYGLSDTTLEEIFLKVAEETGVDAEPDEAATPPAVSP--SQQGEPPEDRDAVLFNQQVSLLYTE-AQETDPLSGDGRGSVSLTGWGLTWQQLRALFTKRLLYATRSRKGFIAQIVLPALFILIDLLFSLIVPPMGKYPALELQPWMYGEQF------TFFSNDAPQDPAMQNLLSALLDPPG-FGTKCL------FNSPQIPFSTWKLFNSPNWTMEHP--SPDCMCSTEEVRRMLPDCPEGAGGLPPPQIKRLT-GDILQNLTGRNISDYLMKTYPQILKKSMKTKKWVNEFRYGGFSLGAKG----SQTLIGSL----QLEESVMAIRKQYKIAENSSLDQLLDRLPDLFTDLNSQNN-VKVWYNNKGWHAMVSFVNIMNNGLLRASLPPGPER-QKHGITAYNHPLNLTKEQLSDMVLMTTSVDVLLSISVIFAMSLVPASFVLFLIEERVSKAKHLQFVSGVKPILYWTANFVWDMLNYTVPATLVVLIFIGFQQQAYVSEKNLPALVLLLLLYGWAITPLMYPASFVFSVPSTAYVTLTSINLFIGINGSIATFVLELF--TNEHLREVNRILKKVFLIFPHFCLGRGLIDMAKNQAM-ADALQRLGKCHMPSPIVWDFVGKNLFAMAVEGVVFFIFTILLQYKFFIRCRLPWFE----PVLPPLCAEDEDVGRERDRVKNGRTQDDILTLIDLSKVY--------------------KSGKKPAVNRLCLGIPRGECFGLLGVNGAGKTSTF 1807          

HSP 2 Score: 186.422 bits (472), Expect = 9.990e-47
Identity = 107/313 (34.19%), Postives = 169/313 (53.99%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEV 3150
            +++ +L K+Y S K P +N L L     +    LG NGAGKT+T  +LTG  S + G A++ N  + TEMD + Q +G CPQ++ + + LT  +H+ FY  L+ + +  +  V    +K + LT   +  +   SGG KRKLS A++ IG   V+FLDEPT G+DP A+R +W+ +       R +ILT+H M+E + L  R+AI+  G+ QC GS+  LK +FG+GY + L  +         +      F  I + +      + LQ+   LP    NS     +F  L  +  E+ +  Y +S T+L++V
Sbjct: 1763 LTLIDLSKVYKSGKKPAVNRLCLGIPRGECFGLLGVNGAGKTSTFLMLTGDTSVTCGEAFLCNHSVLTEMDRVHQLMGYCPQFDAINELLTGREHLEFYARLRGVPEAYVAKVAQWGVKKLGLTHYADREAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVIKEGRAVILTSHSMEECEALCTRMAIMVNGRFQCLGSVQHLKNRFGDGYTIILRLSAPPKDPCPVDAYIKNSFTGIVLKE---RHHNVLQYQ--LPS---NSCSLARVFDVLSNNYEELGVTDYSISQTTLDQV 2067          

HSP 3 Score: 62.7734 bits (151), Expect = 4.052e-9
Identity = 31/80 (38.75%), Postives = 42/80 (52.50%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            I  QL  LLWKNF  +RR    L+ EL  PL +  IL +VR+S   YK   C F  K + S G + ++   +C  N  C+
Sbjct:    3 IGTQLYLLLWKNFTYRRRNKFQLITELLWPLFLFLILISVRNSHPPYKQSQCHFPNKALPSAGTLAWVQGIVCNVNNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002495.1 (pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene:ENSPMAG00000002218.1 transcript:ENSPMAT00000002495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 414/1114 (37.16%), Postives = 640/1114 (57.45%), Query Frame = 1
Query: 1150 LSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLR----LSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSE---SIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXX--------------------------XXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNK-------LINKEKSYYSYYCNILKMKLRIN-ATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWL------MMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASI------------LDIPMVSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSS---KLIGDSPFWEELR-DFVNASQANHNQSNLNSLKFIDYLQKTFK----IYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQ 4278
            + Y+IR+ +  +  T K K  DR+W P PR + F D +Y+  GF +LQ++++Q  I   TN  S+ VG  +  MPYPCY+ D FL+ +   LP  L +AW  SV +++K +V+EKE+RLKE M++MGL+  + W+SWFIS ++ L+I  ++++V L+    L  I   S   +V+  +  + I+ + Q F++S FFS+AN+A+ +GGI+YF+FY+ +V+ +  + +++ ++  S  + S VAFS   +F   +E+   G+Q+ N+F +P E   +     I +M+ D+F+Y L+T Y+E VFPGQYGV KPW F C R+YW  +    E   +I   +        ++   E EP +L +G+SI  LVK+Y + K   ++ L+LNFY+ QIT+FLGHNGAGKTTT+SILTG+F P++GTAYIL  DIRT++D IR+ +G+CPQYNVLFD LTVE+HI+FY  LK   + E +  + ++I+DVDL  K + +S  LSGGM+RKLSI +AF+G S+VVFLDEPTAGVDP+ARRGIW+LL+KYR H RTIIL+THHMDEAD L DR+AIIS G+L+CCGS +FLK  FG GYYL+++K   +                           S +  +  ++ + ++ ++ DAR++E    + T +LP +      F  LFK LD+ +AE+ + SYG+SDT+LEE+FLKVA++P           ++   S Y+Y   +    +  N +T  +        +K ++   +    + G  L+  Q  AL IKR+H+A+R  KGF+A++ILP + +   ++F  I     K   +Q+ PW+       +S    EN+ T     ++   L+NK            G RCMN     + +  C       +  P S             ++ P  SPEC CS  G ++    C +  +GGPP   R+  ++D L +L+G NISDYL+K +P+  RK      +V    +G  S   K +  S   +++   F N  +  H ++     K +D L    K      G K +  ++W N+KG+ ++ A+ N+ +N  +      +     DYGI+  N P+ + +
Sbjct:    5 VRYKIRMDIDSVQRTNKIK--DRYWDPGPRADPFDDLRYIWGGFAYLQDSVEQGIIRAQTNG-SLSVGVYVQQMPYPCYVDDIFLRIMNRSLPMFLTLAWMYSVAMILKEVVHEKEARLKETMRIMGLSTSMLWLSWFISILIPLLISAMLLTVLLKVREQLGNILYYSDPTIVYLYLCVFAIATVMQCFLISTFFSRANLAAATGGIVYFSFYLPYVLCVAWQNQITYSVKISTSIFSTVAFSFGSEFFSLYEEQGVGMQWENVFSSPVEGEDYTFISSIFMMLFDAFVYGLLTVYIENVFPGQYGVPKPWYFPCTRAYWRGDTMEKELYETIAQKQPQAITGVPDNIYVEDEPGDLPVGVSIQGLVKIYNAGKKLAVDGLSLNFYQGQITSFLGHNGAGKTTTMSILTGLFPPTAGTAYILGRDIRTDIDKIRKNLGVCPQYNVLFDRLTVEEHIWFYARLKGRSEQEAKQEIEQMIQDVDLAHKRSDISKSLSGGMQRKLSIGIAFVGGSKVVFLDEPTAGVDPYARRGIWNLLLKYR-HGRTIILSTHHMDEADLLGDRIAIISHGRLRCCGSSLFLKNAFGAGYYLTMVKRSGSGGSNSSCLAGLASSSDEGFGSDESNPDSIAANHVSSVTRLLQQHVPDARLIENFGQELTYLLPSHGAKDGTFALLFKELDEKLAELGVSSYGVSDTTLEEIFLKVAEEPAANSHFTNGVKLSARNSKYTYLQPVHAGCICKNYSTCKKAPAELGELEKLNELDGKGTQQISGVQLILLQFKALFIKRFHHARRSRKGFVAQIILPAVFVCLALVFSLIIPPFGKYPMLQLQPWMYGEQYTFLSNDAPENVKT----NSLYDALLNK---------PGFGTRCMNGE--SIPDAACVETKSEWVQPPMSPAMARTMQSRNWSMEDP--SPECRCSGEGRRVILPDCPE-GAGGPPPMQRVQNTTDTLEDLSGRNISDYLVKTYPQAIRKSLKHKYWVNEIRYGGLSVGKKKLSHSASPKDMDIVFTNVKRVFHIEN-----KAVDVLYSGVKDMVSFLGPKETI-KVWFNNKGWHAIVAFMNM-ANNAVLRSSLPAGTDPSDYGITAYNHPLNLTK 1089          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Sea Lamprey
Match: abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:ZFIN;Acc:ZDB-GENE-030131-9790])

HSP 1 Score: 363.229 bits (931), Expect = 3.266e-102
Identity = 270/858 (31.47%), Postives = 435/858 (50.70%), Query Frame = 1
Query: 1141 TTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSL---TMYYSCGLLSQVAFSNAVKFMIYWEQ---LYEGVQFSNLFQNP--GESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCAR-SYWVYNI----KSSESIPLMRNNNQN-------CEIN----------HQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMD--KNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXX---------XXILKFVKIYIADARMM--EESR----LQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFL---KVADDP---------------MNKLINKEKSYYS--YYCNILKMKLRINATKTEIFLNQNPDQKQ------------------------SKFLDQSDHLLK-----GFPLLQQQIIALHIKRYHYAKRDFKGFLAE 3426
             T L+Y +R+ +  +  T   +  D  W P P  N   ++ Y    F+  +  +++A I L       E    +  MPYPCY  D FL  +  + P L ++AW  ++   +K +V EKE   +EYM +MG+    H++SW + + V+L++ V++++V L+ S      + A++ A+   + IS +   +M+S  F+  NVAS++   +Y   +  F+    L  +L+    ++   C LLS  AFS A   +        +   VQ+SN++ +P  G+ + F   +   ++IID+ IY ++ WY+  V+PG YG+A+P+ FL  R S   + I      S  I  +++  +        C                 E+ P +L  G+S+ +L K Y   K   + +L+L+FY+ QIT  LGHNGAGKTTT+S+L G++ PSSG+ ++   D RT+M  +R+++G+C Q +VLF +L V +H+  YG LK +D  +  ++  +   + D+ L    + L   LSGGMKRKLSIA+AFIG S  V LDEPT+GVDP +RR IW+L++K+R+  RTIIL+THH+DEA+ LSDR+A++  GKL+CCGS  +LK  +G+G  L+L K       S             E ++  V+  +A A +   E+S          +LP +  N    + L   L+++M E+ +  Y +SDT+LEEV L   +V  +P                  L+ K        Y C+ L  +      K     N++P+ +                         S       HL+K     G  LL ++  AL  KR+H+ +RD KG  A+
Sbjct:    2 ATHLNYTLRLSIQNVMRTDYLR--DLVWVPGPHTNQ--NYMYYTHAFLS-RTMLERAAISLYIGRNISEPALQVQPMPYPCYTDDSFLHSVGLMFPILFMIAWILTIASTVKFLVQEKELCQQEYMNIMGVRPASHFLSWLLQSCVLLLLMVILLTVILKASGTLPSINWALLLALFLCFGISVLAMGYMLSACFTHTNVASLTACFIYLLSFFPFLALSSLTLKLTRWQKSLIVRC-LLSPTAFSYATNLITQHCTCIPMRALVQWSNMYHSPLFGDDVSFA--YLCWMLIIDTAIYFILGWYIRNVYPGTYGLARPFYFLFTRISSKAHGIPGQKHGSRVIRGLQDGRKGVLRGVTECSCTSPLGAPDGSMRPQLEAVPADLTAGVSLRSLTKQYSKGKKAALQDLSLDFYQDQITTLLGHNGAGKTTTMSLLMGLYEPSSGSVHVGGHDARTDMAEVRRQLGVCLQRDVLFPALNVHEHLLLYGRLKALDWSRQRLQQEVDTFLNDLGLYNHKDKLVGTLSGGMKRKLSIAIAFIGGSTTVILDEPTSGVDPCSRRSIWNLILKHRA-GRTIILSTHHLDEAEVLSDRIAVLEHGKLRCCGSPQYLKEIYGQGLTLTLTKKVRVLCLSQSVTLGSRPPFDPERVVSLVRSGVAGAALKSGEDSSGNRNADMVFLLPAHSQNVLGQSFLV-TLEENMEELGLSGYAISDTTLEEVCLRQQRVMSEPALGCSASARYFTPTSAASLLTKATQCGPGLYSCSQLVQEAEDQRLKD--ITNKSPEAESGSINSETAAPPDHTSPAASSILCLSSLWRTEKHLVKKERVTGIHLLVRKTQALIYKRFHHWRRDVKGAAAQ 847          

HSP 2 Score: 180.259 bits (456), Expect = 1.547e-45
Identity = 148/495 (29.90%), Postives = 238/495 (48.08%), Query Frame = 1
Query: 3859 NLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDI--LEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYL-----KRIEIRNTE-DFDVNLERERMSSDQK------SDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            NL+G ++ +YL+    +   K YGG+ F LP                                S  + L+ +   +   K++    +  ++W N +GY ++PAY N F+NLLL   L          GISV++ P   +Q ++  D++ Q + +  +AI ++ G S +  SF   +V ER++GSKR Q +SG++P  YW  NF +D++ Y +   + I +  AF   +Y  + N  A  LLLI +G A +P MY  S   S    AFV   + N+++G  T ISTF+++   L  + + L    +I++ +FL+FPQF LG G++ L      +   +++     L  D    +  S F++ I  W  + +  +GIV   +   L +S++     K +E    E D DV  ER R+    +       DD L+++ L K Y +                  N++   AV+ L  GV   +CFGLLGVNGAGKTTTF
Sbjct: 1059 NLSGEDVEEYLMGTTCQYLLKRYGGWSFGLP-------------------------------HSTTSDLEVVPDNRTLTKVW---RNHMKVWYNPEGYHALPAYVNSFNNLLLWDNLPDGEHPGDYKGISVNSKPYAGQQLSQ--DMILQNLGDTGVAICILLGFSILTGSFATAVVRERITGSKRLQQISGVSPTFYWAVNFTYDMVSYTVTTGLCIAVIAAFHLPAYTDNSNLGAVSLLLILFGFASLPWMYLISGVFSEEEMAFVTYISINIILGVSTIISTFLVNFLYLSSDSQSLYNAYNIMRWLFLVFPQFCLGWGLVSL------SKQRLMEDIMKLLGSD---PQESSSFAMDITGWPFVALAVNGIVCFTLRLVLTDSFIRWWRRKAVEPGQPELDTDVQAERSRVEEQSRVVDAATPDDTLQLVGLRKRYRLL-----------------NRSF-TAVDGLHLGVSPNQCFGLLGVNGAGKTTTF 1490          

HSP 3 Score: 176.407 bits (446), Expect = 2.323e-44
Identity = 101/308 (32.79%), Postives = 170/308 (55.19%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRT---EMDSIRQK---IGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             ++ L+L    +Q    LG NGAGKTTT  +LTG   PS G A I  ++  +   +M+  R+    IG CPQ++ L D LT  +H+Y Y  ++ +  + IE V   ++  + L+   + L    SGG KRKLS A+A IG  +++ LDEP++G+DP ++R +W  + +      ++ILT+H M+E + L D++AI+  G+ +C G+L  LK +FG G+       +   S+ N     + +F+  +   A + E+   Q    +P    N+ K +E+F  L++    +SI  Y +S T+L++VF+  A
Sbjct: 1462 AVDGLHLGVSPNQCFGLLGVNGAGKTTTFKMLTGDIQPSGGDAIIRTQNGHSALLKMEKARRTGTLIGYCPQFDALDDLLTGWEHLYCYARIRGIPSHHIEQVSQELVTRLHLSLHADKLVKTYSGGTKRKLSTALALIGKPQLLLLDEPSSGMDPKSKRYLWKTITREVRGGCSVILTSHSMEECEALCDKLAIMVNGQFKCLGTLQHLKNRFGNGH-----MIKLRLSSGNSKVTEVTEFITSHFPGAYLKEQHISQLEFQVPS---NAGKLSEIFIALEKEKESLSIQHYSISQTTLDQVFINFA 1761          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004117.1 (pep scaffold:Pmarinus_7.0:GL489716:190:6182:-1 gene:ENSPMAG00000003765.1 transcript:ENSPMAT00000004117.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 295.049 bits (754), Expect = 5.811e-88
Identity = 174/470 (37.02%), Postives = 286/470 (60.85%), Query Frame = 1
Query: 1156 YQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELS---LTMYYSC--GLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGK--TTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIE 2544
            Y+IR   S  + T + +    +W P P  N+   + Y   GF+++Q+ I++A I     ++ +E G+ + + PYPCY  D FL  + +++P  +V++W  SV ++I+ IV EKE RLKE MK+MGL+N V WV+WFI+  + L I V +++V L+  ++   S + +++  +  Y ++ +   F+VSV +SKA +A+  GGI+YF  Y+ + +++ +  E++   +T +  C   L+S  AF    K+   +E    G+Q+    Q+P E   F +   ++++++DS +Y ++TWY+EAV PG YG+ +PW F   RSYW+ + ++        +  +      +  E EP +L L + I  L K+Y + K   +NNL+LN YE+QI +FLGHNGAGK  T   +  TG+F P+SG+A I   DIR+EMD+IR+ +G+CPQ+NVLFD LTVE+H++FY  LK M  ++I 
Sbjct:    7 YKIRQNSSFTEKTNEIR--RAYWRPGP--NSGGQY-YFFYGFVWIQDMIERAIINTFVGHDVVEPGNYVQLFPYPCYTRDDFLFVIEHMMPLCMVISWVYSVAMMIQHIVAEKEHRLKEVMKMMGLSNAV-WVAWFITGFLQLSITVAVLTVILKYGQVLMHSDIFIIWLFLTIYALATVMFCFLVSVLYSKARMAAACGGIMYFLSYVPY-MYVAIREEVAHDKITAFEKCIASLMSTTAFGLGAKYFALYEVAGVGIQWHTFRQSPVEGDDFNLSLALLMLLLDSVVYGVLTWYIEAVHPGTYGLPRPWYFPLQRSYWLGSGRA--------DAWEWSGYEARGMEKEPTHLPLVVCIERLTKVYKTGKKLALNNLSLNLYENQIVSFLGHNGAGKTTTMYDTRTTGLFPPTSGSARIYGHDIRSEMDAIRKSLGMCPQHNVLFDQLTVEEHLWFYSRLKGMQAHDIR 461          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006988.1 (pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-1 gene:ENSPMAG00000006318.1 transcript:ENSPMAT00000006988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 247.669 bits (631), Expect = 1.407e-69
Identity = 184/555 (33.15%), Postives = 291/555 (52.43%), Query Frame = 1
Query: 1264 YVLSGFIFLQEAIDQAFIELVTNNESIEVGSSM-HIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKP---WNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLG---ISIHNLVKLY--PSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMD--SIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            Y+ SGF+ LQ AID A I+L TN  +  + S+M   M    + + +   +L  L    L  A+ P ++ L+ ++V EKE   ++ M+ MGL     W+SW +    ++ +  ++++V  R++ I   S+  ++F +   Y +S +    ++  FF KA  AS  G +L   F ++ +  + L    ++ +++   L S  AF+ AV  ++  E    G  FSNL + P    P  V   + ++++D  IYL +   +  + PG+ G+  P   + FL  R   V N  +   I L RNN  N  I+HQ    +     LG   I I N+ K Y      +  +  L+LN YE QITA LGHNGAGKTT I+ILTG+ +PS+G  +      + ++D   IR  +  C     L+ S T          L      ++ S + R++    L +  +     LSGG KRKLS+A A +G  R++ LDEPT+G+DP +RR +W LL+  +  +   +L+TH M+EAD L+D  A++SQG+L+C GS +FLK KFG GY
Sbjct:  135 YLESGFVSLQLAIDSALIQLQTNASARALTSAMVQRMGRGRHTVVRTWPQL--LASIYLAGAFAPFLSFLLLNLVLEKEQGSRDLMRTMGLRTPALWLSWAMVYGAMICLVSLVLAVVTRVTHIFDTSNTVLMFLLFLLYGLSLVAMALVLMAFFRKAKTASSVGSLLALLFCLLNIPVLLLWNSHTV-LHWLLSLFSPAAFALAVAQVVALEAGGSGAHFSNLLEGPN---PLAVP--LTMLLLDIAIYLGLAAALHRLLPGERGLEGPRIGFIFL-RRCSCVQNAWNLHQINLPRNN-LNPHISHQNLHDKVGREILGSEAIRIRNVRKTYRLKGTDVMALRGLSLNIYEGQITALLGHNGAGKTTLINILTGLITPSAGATHT-RAHTQHQLDKFEIRNTVKCCTSLTNLYPSRTTGRERKKDVSLSSFPSPDLPSEVSRVLSATGLEKAADKQVQDLSGGQKRKLSLAAALLGKPRLLILDEPTSGMDPVSRRRVWSLLLGGK-RECVTLLSTHSMEEADALADWKAVLSQGRLKCAGSSLFLKTKFGVGY 677          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006855.1 (pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene:ENSPMAG00000006189.1 transcript:ENSPMAT00000006855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 4.864e-47
Identity = 102/322 (31.68%), Postives = 169/322 (52.48%), Query Frame = 1
Query: 2251 KIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRM---DKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLE---EVFLKVADDPMNKLINKE 3198
            +I  ++ L +     +    LG NGAGKTTT  +LTG  S + G A++    +  +   ++Q IG CPQ++ LFD LT  +H+  Y  L+ +   D+  +  V+   ++ + LT   +  +   SGG KRKLS A+A IG   ++FLDEPT G+DP ARR +W+L++      R+++LT+H M+E + L  R+AI+  G  +C GS+  LK +FG+GY           + S  + + +L+F      DA + E      T V  Q    +     +F  ++Q +  + +  Y +S T+L+   +VF+  A    + L  +E
Sbjct:    1 RILAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDASVTGGEAFLNGHSVLRDQHKVQQTIGYCPQFDALFDELTAREHLELYTRLRGIPWRDEKRVRQVVNWALQKLGLTSYADKPAGTYSGGNKRKLSTAIALIGYPPLIFLDEPTTGMDPKARRFLWNLILDIIKTGRSVVLTSHSMEECEALCTRLAIMVNGHFKCLGSIQHLKNRFGDGY------MITIRTRSTLHVKEVLRFFSRSFPDAVLKER---HHTKVQYQLKSETLSLAAVFTKMEQVLDVLGVEDYSVSQTTLDNDPQVFVNFAKKQSDNLEQQE 313          

HSP 2 Score: 58.5362 bits (140), Expect = 4.452e-9
Identity = 26/32 (81.25%), Postives = 28/32 (87.50%), Query Frame = 1
Query: 5206 REVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            R +AV+ LC GVR GECFGLLGVNGAGKTTTF
Sbjct:    1 RILAVDRLCVGVRPGECFGLLGVNGAGKTTTF 32          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Yeast
Match: ATM1 (Mitochondrial inner membrane ATP-binding cassette (ABC) transporter; exports mitochondrially synthesized precursors of iron-sulfur (Fe/S) clusters to the cytosol; human homolog ABCB7 can complement yeast null mutant [Source:SGD;Acc:S000004916])

HSP 1 Score: 81.6481 bits (200), Expect = 5.989e-16
Identity = 63/232 (27.16%), Postives = 118/232 (50.86%), Query Frame = 1
Query: 2191 PENLKLGISIHNLVKLY-PSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRT-EMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESV----LPRIIKDV--DLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLI-KYRSHDRTIILTTHHMDE-ADYLSDRVAIISQGKLQCCG 2856
            PEN+   I+  N+   Y P  KI  + N +        TA +G +G+GK+T + ++   + P SG   I   DI+  ++D++R+ IG+ PQ   LF+  T+ +++ F G +   D+  I  V    L  +IK +       +    + +SGG K++L+IA   + N+R++F DE T+ +D    + +   +   + S  RT +   H +   AD  +D++ ++  G+++  G
Sbjct:  429 PENVPYDITFENVTFGYHPDRKI--LKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFND-TIWENVKF-GRIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIAD--ADKIIVLDNGRVREEG 654          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Yeast
Match: YOL075C_mRNA (Putative ABC transporter [Source:SGD;Acc:S000005435])

HSP 1 Score: 80.4925 bits (197), Expect = 1.842e-15
Identity = 68/260 (26.15%), Postives = 119/260 (45.77%), Query Frame = 1
Query: 2167 NHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISIL----TGIFSPSSGTAYILNEDIRTEMDSIRQK----------------IGLCPQYNVLFDSLTVEDHIYFYGLLK-----RMDKNEIESVLPRI-IKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHD-RTIILTTHH-MDEADYLSDRVAIISQGKLQCCGSL 2862
            N  +F   P   ++ + + +L  +       ++N  +++     + A +G +G+GKTT +++L    +G  + +    Y+L ED  +E +    K                +   PQ +VL   LT  + + F   LK     R  K  +E ++  + +KD   T   +     LSGG KR+LSI    I N  ++FLDEPT G+D ++   +   L K    D RT I++ H    +  +L D+V I+S+G +  C  +
Sbjct:   16 NRLSFSRIP---RISLHVRDLSIVASKTNTTLVNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVL-EDTGSEPNETEPKRAHLDGQDHPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSERTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVYCDKM 271          

HSP 2 Score: 61.2326 bits (147), Expect = 1.288e-9
Identity = 46/190 (24.21%), Postives = 95/190 (50.00%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTG-----IFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNV-LFDSLTVEDHIYFYGLLKRMDKNEIESV--LPRIIKDVDLTEKINALSMH-----LSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKY-RSHDRTIILTTHH 2787
            ++ ++N  F    I A +G +G+GK++ +++++G     +F+    +  I+  DI+      +       Q +  L  +LTV++ + +   L+     E E +     +I+ + L    N +  +     +SGG KR++++ +  + +  ++ LDEPT+G+D F    I ++L K  R   +TII+T H 
Sbjct:  709 ILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDIQVSELMFKNVCSYVSQDDDHLLAALTVKETLKYAAALRLHHLTEAERMERTDNLIRSLGLKHCENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQ 898          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Yeast
Match: ADP1 (Putative ATP-dependent permease of the ABC transporter family [Source:SGD;Acc:S000000604])

HSP 1 Score: 77.7962 bits (190), Expect = 1.105e-14
Identity = 58/205 (28.29%), Postives = 100/205 (48.78%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVD--------LTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRS-HDRTIILTTHH-MDEADYLSDRVAIISQGKL 2844
            V+N ++      QI A +G +GAGKTT + IL         +  I    I  +  S  + IG   Q + L  +LTV + +    LL+       E+   R+ K ++             N     +SGG KR++SIA   + +  V+FLDEPT+G+D      + + L++  S ++RT++L+ H       YL D++ ++S+G++
Sbjct:  405 VLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKIIGFVDQDDFLLPTLTVFETVLNSALLRLPKALSFEAKKARVYKVLEELRIIDIKDRIIGNEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNVIECLVRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEM 609          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Yeast
Match: STE6 (Plasma membrane ATP-binding cassette (ABC) transporter; required for the export of a-factor, catalyzes ATP hydrolysis coupled to a-factor transport; contains 12 transmembrane domains and two ATP binding domains; expressed only in MATa cells; human homolog ABCB1 mediates multidrug resistance in many chemotherapy-resistant tumors by effluxing toxic compounds from the cell [Source:SGD;Acc:S000001692])

HSP 1 Score: 76.2554 bits (186), Expect = 4.014e-14
Identity = 71/273 (26.01%), Postives = 128/273 (46.89%), Query Frame = 1
Query: 2098 WVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIP-VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRT-EMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRI-IKDV------DLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGE 2889
            W+Y I   +   L   NN    +         +  K  +SI NL   YPS     V  N+N + +  Q    +G +G GK+T + +LT +++   G   I   D+    + S+R++I +  Q  +LF+  T+ D++  YGL   + + E+   L  + I D        L  +I+  +  LSGG  ++L IA A +  S+++ LDE T+ +D  +   I +++ K      T+++T  H ++     + +A++  GK+   G+   L    GE
Sbjct: 1014 WIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVEQKPLLFNG-TIRDNLT-YGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRID--TTLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKKGPPALLTMVIT--HSEQMMRSCNSIAVLKDGKVVERGNFDTLYNNRGE 1280          

HSP 2 Score: 64.3142 bits (155), Expect = 1.847e-10
Identity = 57/208 (27.40%), Postives = 101/208 (48.56%), Query Frame = 1
Query: 2239 YPSNKI-PVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRT-EMDSIRQKIGLCPQYNVLFDS-------LTVEDHIYFYGLLKRMDKNEIE-----SVLPRIIKDV--DLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTH--HMDEADYL 2808
            YPS     V+ N++LNF   Q T  +G +G+GK+T  ++L   +   +G+  I   +I+T +   + + I +  Q   LF+        L   D +         +++ I+     ++L R I D+   L   I    + LSGG +++++IA AFI ++ ++FLDE  + +D   R  +   +  +R    TIILT     ++  DYL
Sbjct:  366 YPSRPSEAVLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILTHELSQIESDDYL 573          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Yeast
Match: MDL2 (Mitochondrial inner membrane half-type ABC transporter; required for respiratory growth at high temperature; localizes to vacuole membrane in response to H2O2; similar to human TAP1 and TAP2 implicated in bare lymphocyte syndrome and Wegener-like granulomatosis [Source:SGD;Acc:S000006191])

HSP 1 Score: 69.3218 bits (168), Expect = 3.856e-12
Identity = 61/196 (31.12%), Postives = 97/196 (49.49%), Query Frame = 1
Query: 2239 YPSN-KIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDI-RTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINA----LSMH---LSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGI---WDLLIKYRSHDRTIILTTHHM 2790
            YP+   + +  NLN           +G +G GK+T   +L   ++P++GT  I N+DI +    S+R+ IG+  Q  VL  S T+ D+I  YGL     K EI SV  +      +T+  N     +  H   LSGG K++++IA A I    ++ LDE T+ +D  +   I   +  L+K +S   TI+   H +
Sbjct:  455 YPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLM-SGTIRDNIT-YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM--TIVSIAHRL 646          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Nematostella
Match: EDO46878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNL9])

HSP 1 Score: 853.203 bits (2203), Expect = 0.000e+0
Identity = 535/1427 (37.49%), Postives = 814/1427 (57.04%), Query Frame = 1
Query: 1150 LSYQIRIPLSRIDSTYKF-KVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXX-------------------------------XILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSK--FLDQS---DHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDK--LNNLTGYNISDYLLKNFPKLSRKLY-GGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYN--SNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSD-QKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            + Y+IR     +D T +  ++ D +W P P    F+   Y+  GF+FLQ+ ID+A + +  N    E G+   + PYPCY+ D+F+  +   +P  + +AW  +  ++IKSIVYEKE RLKE MKVMGL   VHWV+WFI++   ++I ++ + +TL+  +I   S   ++F  +  ++ + I   F++SVFFS+ANV++  GGI++F  Y+ + +    E  ++ +   +  L S  AF  A  ++  +E+   G Q++NL+ +P     F +G+ + +M+ID  +Y L T+Y+EAV PGQYG+ +PW F   +SYW     +S  +  +  +      N  A E+EP +L +G+SI NLVK+Y   K   ++ LNLN YE QI +FLGHNGAGKTTT+S+LTG+F P+ GTA I   DIRT++D +R+ +G+CPQ+NVLFD LTVE+H++FY  LK M+K+ I   + + +KDV LT K + LS +LSGGMKRKLS+AMAF+  SRVV LDEPTAGVDP+ARR IWDLL+KY+  DRT++L+THHMDEAD L DR+AIISQGKLQCCG+ +FLK  +G GYYL+L K        + +                                 ++  F+K +I  A ++E    + T VLP +     KF ++F+ LD+++ ++ + SYG+SDT+LEEVFLKVA++  +     E++  S    + +     ++   +    Q P Q  SK   +D S   D    G  LL +Q  AL +KR+H+ +R+ K F+A++ILP + +   ++  +I    +K   ++++P + + +   EN    Y  ++    L   L   +    G  G  CM+ +  R          +   + P S+  +P  SP+CDCS+  N +C     G PP ++   TS D   +  ++G NISDYLLK + K  +K Y    + ++   +G  S   GD+          N   AN   S+  +++ +           I     +IW N+KGY ++PA+ N  SN +LR++     +    YGI+  N P+   +     +   +  +++ +AI V+F LSF+PASFV+FLV ERVS +K    VSG+ PY+YW++N++WD+  Y IP ++ + IF+AF  +SY  + N      LL+ YG +I P MYP S F S  STA++VL + NL VG   T++TFIL++ E + E L +IN +LK VFL+FP + LGRG++DL  N F    S   V    +   WDI G  +F++      ++ + ++IE     ++   K+    LK +E    ED DV  ER+R++S    + D LR++NLTK+Y                     + R VAV+ LC GV +GECFGLLGVNGAGKTTTF
Sbjct:   20 IKYKIR---QDVDFTPRTDRIRDWYWRPGPN-GWFSKQGYMNFGFVFLQDMIDRALLTISFNETVFEPGTYAQMFPYPCYIRDRFVFYIGGTMPLFMTLAWIYTAAMIIKSIVYEKEKRLKEVMKVMGLGRTVHWVAWFINSASTMLITIIFLVITLKAGRILQHSDPFIIFLFLVVFMFATIMMCFLISVFFSRANVSAACGGIIFFVTYLPYTMVRWFEAFMNSSQIAAACLSSTTAFGVACNYLARYEEQGVGAQWNNLYASPIAGDEFSLGYAMGMMMIDGVLYALATFYIEAVMPGQYGIPRPWYFPLQKSYWFPQKPASPDMDDVAFSPDGATNNDVAMETEPSHLSMGVSIRNLVKIYKEGKKLAVDGLNLNLYEGQILSFLGHNGAGKTTTMSVLTGLFPPTHGTALISGYDIRTDIDMVRRNLGMCPQHNVLFDCLTVEEHLWFYASLKGMEKSRIPGEIEKFLKDVGLTNKRHELSANLSGGMKRKLSVAMAFVAESRVVILDEPTAGVDPYARRSIWDLLLKYKK-DRTVLLSTHHMDEADVLGDRIAIISQGKLQCCGTSLFLKSHYGNGYYLTLTKKTPGLGLDSVDASERDSLGSRSSDSDPISDSVLGDYSDVYCNEKSVTSFIKSHIPSASLVEHVGTELTYVLPSHAAKEGKFQDMFEELDRNLHKLHVGSYGVSDTTLEEVFLKVAEEAQS-----EEAGTSAEVPVRRSTFTFSSHPVKCL--QPPAQGDSKNDSVDGSLEFDDRESGLALLLRQFFALLVKRFHHCRRNRKAFIAQIILPAVFVCLAMIVAQIRPFYEKPA-LELTPHMFVKEEPYENY-VLYANDDPGEPLARNLSDAFLQYPG-LGTWCMSNNCSR----------KPIAFQP-SLSPVPTPSPDCDCSEAMN-VCPAGAGGPPPPTW---TSYDGNIIQKMSGRNISDYLLKTYMKFVKKRYINKIEIMIVREYGGLS--FGDN---------YNNLPANVRNSSDPAIRRL-----------ISPRNVKIWYNNKGYHALPAFLNTLSNTVLRAKAKARGLDPSQYGITAYNHPMNYTKEQLDDETFVKRAVDVLVAICVVFALSFVPASFVVFLVSERVSKAKHLHLVSGVKPYIYWLANYVWDMCNYFIPAMLCVFIFLAFGDESYTTAMNFPPTFCLLLLYGWSITPLMYPASHFFSVSSTAYIVLISINLFVGINCTLATFILELFEDDKE-LTDINTVLKSVFLVFPNYCLGRGLIDLAKNQFLGIFSRFGVNLTRDPFSWDITGRNIFAMIIEGFVFFTLTVLIEYRFFIKLRPVKV---VLKPVE---EEDDDVQRERQRVNSGLGHATDALRLMNLTKVYR------------------SRRKRIVAVDRLCVGVPKGECFGLLGVNGAGKTTTF 1369          

HSP 2 Score: 191.43 bits (485), Expect = 8.314e-49
Identity = 130/426 (30.52%), Postives = 209/426 (49.06%), Query Frame = 1
Query: 1918 QFSNLFQNPGESL---PFG---VGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPS--NKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            QF  +F   G +L   PF     G  I  MII+ F++  +T  +E  F           F+  R   V  +K  E        + + +   Q   S   +    + + NL K+Y S   +I  ++ L +   + +    LG NGAGKTTT  +LTG    +SG  ++    I ++++   Q +G CPQ++ L D LT +DH+  Y  L+ + +  I  V+  +I+ ++L +  +  +   SGG KRKLS A+A +GN  +VF+DEPT G+DP ARR +W+++       RT+ILT+H M+E + L +RVAI+  G+++C GS   LK KFG+GY + L    +N          I  F    + D            +V  Q        + LF +L+ +     I  Y ++ T+L++VF+  A D
Sbjct: 1237 QFLGIFSRFGVNLTRDPFSWDITGRNIFAMIIEGFVFFTLTVLIEYRF-----------FIKLRPVKVV-LKPVE------EEDDDVQRERQRVNSGLGHATDALRLMNLTKVYRSRRKRIVAVDRLCVGVPKGECFGLLGVNGAGKTTTFKMLTGDIPVTSGEGFVDGHSILSDINGAHQSMGYCPQFDALDDLLTAKDHLRLYARLRGVPERYIPKVVNSLIQRMNLVQYQDVCAGKYSGGNKRKLSTAIALVGNPAIVFMDEPTTGMDPKARRFLWNIITGIMKEGRTVILTSHSMEECEALCNRVAIMVNGQMKCLGSPQHLKNKFGDGYTVILRVAGSNPDTEQVCQFIIQCFPNAVLKDK--------HHNMVEYQIPCQGLSVSRLFGHLEANRKMFDIEDYSVTQTTLDQVFINFAKD 1636          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Nematostella
Match: EDO38879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBQ0])

HSP 1 Score: 573.933 bits (1478), Expect = 5.002e-174
Identity = 370/1102 (33.58%), Postives = 577/1102 (52.36%), Query Frame = 1
Query:  484 SENETTIESGYNELGEIICGS-PENDFKLFMRNFIKNQRRKRSLLT--CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNV--FINDVKKFCKAYYSANPKICDAVNTLFNITNVKSY-----------------------IDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFR------NFLAVIIFNETFQYLTPKNT--TFLSYQIRIPLSRIDSTYKFKVLDR----FWTPYPRR--NTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYS----CGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQ-----------AFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXX----------------XXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLIN-----------------KEKSYYSYYCNI------------LKMK--LRINATKTEIFLNQNP-----------------DQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAE 3426
            + N+  I+  +  LG ++CGS P+      +++    +   +S  T   +L+F     N                 K+ Y PN      +I+ AN TF  ++ L+  + +W           + N    ++  V  + +AY  +  ++   ++     T+   +                       ID V K+  WIE+     +LD F+     KD + L   +F       +  + I+    F  + P  T    ++Y+IR+     ++TY     DR    +W P P+    ++ D      GF++LQ+ I++A + L    E I+    +H MPYPCY  D+F+  + +++P  L ++W  +V ++++SIVYEKE RLKE MK+MGL+N VHWV+WFI+++ V+ I V++++V L+  K+ A S   +++  +  + I  I   F++S FFSKA +A+  GGI+YF  YM FV     EG    T+  S      LLS  AF    ++   +E+  EGVQ+SN+ ++P     F +   +  ++ D+F+Y+++ WY+EAV PG YG+ +PW F    +YW  +  ++ + P +R  N     + +           A+E EP +L LG++I NL K+Y S     ++ LNLN YE QI +FLGHNGAGKTTT+SILTG+F P++GT YI   DIR +MD IR  +G+CPQ+NVLFD LTV++H++FY  +K M  + +++ + ++++D+ L  K N     LSGGMKRKLS+AMAF+  SR V LDEPTAGVDP+ARR IWDLLIKY+   RTI+L+TH M+EAD L DR+AIIS GKL+C GS ++LKR+FGEGY L+                     +N   S R+ E +  F+  +I+ A++  ++  ++T +LP N I    F +LF +L+Q++  + I SYG++ T LEEVFLKV D  +N+  N                  +K  +  +  +            L+M   +R     TE  L   P                       F     H L G  L  QQ  AL +KR+HYA+R+FKG +++
Sbjct:    5 ARNKAYIQGMWKNLGPVLCGSDPDEQPDRVVKHMFDYRCLTKSCQTRALRLMFYLLTHNP----------------KILYAPNNTAADDVIKDANRTFSDIEYLQDLAHDWLNTSSQIRRALLQNETQFYLGLVSNYIRAYPDSYWELISGISEKDPTTHAPYFKNIHSLLTKKNGGVNPIIEQLDRIDAVLKI--WIEQ-TKAFKLDIFV---GFKDEESLVRYAFNTSGVRGDDSSKIVAGIVFTNIEPNKTLPVHVTYKIRM-----NATYFTPATDRIRDSYWRPGPQSWGQSYYDL-----GFVWLQDKIERAVVNLHAMREVIKPAVYLHEMPYPCYSKDRFMLVIQHMMPLCLTVSWIYTVAIVVRSIVYEKEQRLKEVMKMMGLSNVVHWVAWFITSVSVMSITVMLLTVILKYGKVLAFSDPLIIWLSLMLFAIVTIVFCFLISAFFSKAKLAAACGGIIYFLTYMPFVFVSIREGAAHATIESSEKMAISLLSTSAFGLGARYFALYEEQGEGVQWSNIGKSPIRGDDFNLLKVLYFLVFDTFLYVILVWYIEAVHPGSYGLPRPWYFPIQPTYWFGH--NTNACPNLRKKNYRMMTSDEMEDSPQTPGLLAYEREPVHLPLGVTIDNLQKVYKSG-TKAVDGLNLNLYEGQIMSFLGHNGAGKTTTMSILTGLFPPTAGTGYIYGHDIRFDMDKIRHNLGMCPQHNVLFDGLTVDEHLWFYARMKGMAAHAVKTEMNQLVEDIGLPNKRNCAVETLSGGMKRKLSVAMAFVAGSRTVILDEPTAGVDPYARRAIWDLLIKYKK-GRTILLSTHFMEEADILGDRIAIISSGKLRCVGSPLYLKRRFGEGYNLTLVKKSISSPHGSIGSFRRSTSSNLEASRRSEEKLTSFITSHISSAQLKHKTNQEFTFILPDNSIKRGAFKKLFADLEQNIDVLGIDSYGITHTLLEEVFLKVTDVSLNETGNMPHHRQDKLPTQLLQFPADKPGHLGHVLLSPPLPTLPTNEGLEMSDVVRNRGEDTERLLGYQPLSDSGTHQGNLYNEASNGHAAGLFEGVGSHTLTGSALQWQQFYALMLKRFHYARRNFKGVISQ 1070          

HSP 2 Score: 259.61 bits (662), Expect = 1.323e-69
Identity = 178/531 (33.52%), Postives = 267/531 (50.28%), Query Frame = 1
Query: 3748 VSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKF---LDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNAL----QWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIR------NTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
              P C CS  G     D  + G      +  + D L N+TG N+S+YLL          YG   F                     +  FV         S L+S+  ID +++      I+ + ++ W N+KGY ++P Y N+ +N +LR+ + KS      YGI+  N P     ++      D + Q   ++ +AIFVI  +SF+PASFV+FLV ER + +K  QFVSG++P VYW+SN+LWD+  Y+IP +  I +   F   +Y    N  A + L + YG +I P MYP +F  S  S+A+V +   NL VG   T++TFIL +   + E L ++ND++K + L FP + LGRG+MDL +N + +       E +++    +W I    L  +      ++I+ I+IE               +LKR  I        TED DV  ER+R+      DD++++ NLTKIY                 Y + + + +AV+ LC GV +GECFGLLGVNGAGKT+TF
Sbjct: 1209 AGPGCRCSANGTWYLCDQGAAGKQPKELVTITRDTLQNVTGRNMSEYLLYTTQTFRMHRYGALSF-------------------GNVVQFV--------PSRLDSVH-IDAVRR----LAIREA-SKSWYNNKGYHALPTYLNVMNNAILRASIPKSKGNPAAYGITAYNHPFPFNSTSAVHLSADYLRQGT-DLVIAIFVIIAMSFVPASFVVFLVTERSTKAKHLQFVSGVDPVVYWLSNYLWDMCNYLIPALACITLLYLFGVPAYASETNFPAVVGLFMLYGWSITPMMYPSAFCFSEASSAYVAMIVLNLFVGVTATVTTFILQLFPDD-EVLTDVNDVIKLISLGFPNYCLGRGLMDLAYNQYLSEYYRQIGEEDSIKSPFEWMIVSRNLVCMLMEGFAFFILTILIEFKF------------FLKRRRIPVSQLPIETEDEDVAAERDRVLRGDADDDLVKIENLTKIY-----------------YSRKRGKHLAVDRLCVGVPQGECFGLLGVNGAGKTSTF 1675          

HSP 3 Score: 105.916 bits (263), Expect = 1.266e-22
Identity = 57/160 (35.62%), Postives = 92/160 (57.50%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIP---VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFL 2682
            + I NL K+Y S K      ++ L +   + +    LG NGAGKT+T  +LTG  + ++G A + +  I T++  + + IG CPQ++ L D +T E+HI  Y  L+ + + EI+ V+   I+ ++LT+         SGG KRKLS A+A IG+  ++FL
Sbjct: 1628 VKIENLTKIYYSRKRGKHLAVDRLCVGVPQGECFGLLGVNGAGKTSTFKMLTGDTAMTAGDAVLNSYRIATDIHRVHRCIGYCPQFDALIDEMTSEEHILLYARLRGVPEKEIKQVMKWAIRKMNLTQYAKTPCKTYSGGNKRKLSTAIALIGDPPIIFL 1787          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Nematostella
Match: EDO48951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI12])

HSP 1 Score: 452.21 bits (1162), Expect = 1.761e-131
Identity = 302/835 (36.17%), Postives = 471/835 (56.41%), Query Frame = 1
Query:  964 DGVSKLFSWIERGLNCTELDRFIPLD----SLKDIDKLTNQSFRNFLAVIIFN-ETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHI--MPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEG--ELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWV---YNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLY--PSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAE 3426
            D VS L S +   +N   ++R +  +    S++ +     +    +LA ++F+ E  +   PK    + Y +R+P S       ++  +R +  +      T   Y  SGF  LQ AID A I+    +        M+I  +PYP Y+ D F+Q +ANLLP LL +A+  S   +IK +V+EK+ RLKE MK+MGL+N++HW +WFI  ++ L   ++I+++ +++ KI   S+  VVF     Y+IS I   F +SVFFS   ++ + G +L++   + + +  + E    LS +   S  LL           +   E    G  FSNL  +P     F +   + +MII S +YL++TWY+  VFPGQYG+ KP+ F   +SYW    ++      +  ++NN         A E EP +L +G+ I +L K++   +     ++NL+LN Y+ QITA LGHNGAGKTTT+SILTG+F+P+SG+A I N+ I T++D IR+ +GLCPQ+NVLFD LTVE+H+ F+  LK       +  + ++I D+ L +K  A S  LSGGMKRKL+ A+A +G S  VFLDEPT+G+DP+ARR  WDLL+K+++  +T+ILTTH MDEAD+L DR+AI++ G+L+CCGS +FLK ++G GY+             + +   I+  V+  +  A+++     +   VL  N   S+ F  LF  L+ +  +  I SYG+S T++EEVF+KV +         EK+      +IL + LRI ++++ +   QN   K  + L  +  L  GF L  Q   A+ +KR+  +KRD K  + +
Sbjct:   84 DLVSGLMSSVASTMNIKVVNRSMVHNKDWTSVEQMVAEVAEHEDKYLAAVVFDVEKDKLSLPK---VVKYTLRMPHSSAGERKTWRT-ERTYPNFQGIGARTTNFYTFSGFAILQYAIDMAIIQ-AKASLPFPFAYPMNIKQLPYPGYVQDFFVQTVANLLPLLLTLAFIYSAVSIIKELVFEKQQRLKESMKMMGLSNWIHWSAWFIKCLLFLGFTIIIITIFVKVLKIFEFSNGIVVFLFFLCYIISMISYCFFISVFFSNPTLSMLFGSVLWYAALLPYQLLAQNENYDTLSQSAKASMCLLPNTCLGIGATLIARLEGFKTGASFSNLASSPSADDHFSLAWVLGMMIISSLVYLILTWYISTVFPGQYGIPKPFYFPFMKSYWCGFSHDDVVEAGLERVKNN--------PAIEDEPTDLAIGVQIKDLRKVFKGSTGSKVAVDNLSLNMYKGQITALLGHNGAGKTTTMSILTGLFTPTSGSAMIDNKSILTDIDGIRESLGLCPQHNVLFDRLTVEEHLEFFINLKGKYGQAAKDEVLQMITDLQLLDKRKAKSSELSGGMKRKLNCAIALVGGSETVFLDEPTSGMDPYARRATWDLLLKHKA-GKTVILTTHFMDEADFLGDRIAIMADGQLRCCGSSLFLKSRYGVGYH------LTLVKKEDCDDNAIINAVRETVPSAQVLSNVGAEIEFVL--NGEASKDFESLFVKLENNKEDYGIASYGVSCTTMEEVFMKVGE-------GSEKTVE----DILNLLLRILSSQS-LLRYQNIKIKILRLLKSNYPLQTGFALQWQHYKAMLVKRFINSKRDKKSVVTQ 884          

HSP 2 Score: 209.92 bits (533), Expect = 1.943e-54
Identity = 129/424 (30.42%), Postives = 222/424 (52.36%), Query Frame = 1
Query: 1912 GVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEI---NHQAFESEPENLKL-GISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            G+QF++   N       GVG   + M +++ +  ++T  ++        V +P+                  IP+    +Q+C++     +     PE +K   + + +L K+Y  +    +++L +     +    LG NGAGKTTT S+LTG  S S GTAY+   DI+T +  ++Q+IG CPQ++   + +T  + +  +  L+ +  ++I +V+   I+ ++L +  + L    SGG KRKLS A+A +GN  ++FLDEPT G+DP ARR +WD L       R+I+LT+H M+E + L  R+AI+  G+ +C GS   LK +FG GY L L         SN       +FV      A+++E      T  +   +++   ++ +F  L+++ A ++I+ Y +S TSLE+VFL +A +
Sbjct: 1334 GIQFTDSSLNWDRP---GVGQHALYMAVEAVVLFILTLLIQ--------VRRPYRL----------------IPICPWTSQDCDVAGERARVHSLNPEQIKKESVIVKDLTKVYHGSDRTAVDHLCIGIPRGECFGLLGVNGAGKTTTFSMLTGDQSISEGTAYLDGYDIQTHLKEVQQRIGYCPQFDAFIERMTGREMLTMFARLRGVQPDKIPNVVSTTIEHLNLGKWADKLCGDYSGGNKRKLSTAIALVGNPPIIFLDEPTTGMDPVARRFLWDSLTHVMKGGRSIVLTSHSMEECEALCTRLAIMVNGQFKCVGSAQHLKSRFGMGYTLMLKVEARLVPVSNTE-----QFVSSTFPGAQLLESHNGMLTYQINSTELS---WSRIFGELERNRASLNIVDYSVSQTSLEQVFLNLAKE 1722          

HSP 3 Score: 144.05 bits (362), Expect = 2.503e-34
Identity = 115/379 (30.34%), Postives = 194/379 (51.19%), Query Frame = 1
Query: 4234 DYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSF-----FISTPSTAFVV-LNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNS------------NSIVKHEYNALQWDIAGEKLFSLFSL--SIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSS---DQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            + GI  +N P+      K  D V   I  + LAIF+  G++F+ ASF+ FLV+ER S +K  QFVSG++ + YW + + WD + Y++P ++I+I+F AF  + +    +  +  LLLI +GL ++P +Y  SF      I+   T FV+ + ++ +L      ++ F+  I  +N   L +  +I+  VF++ P + +   ++D+  NY Y              ++ ++   ++L WD  G    +L+    ++  +I+ ++I+     R+I           I    ++D DV  ER R+ S   +Q   + + V +LTK+Y+            G D          AV++LC G+  GECFGLLGVNGAGKTTTF
Sbjct: 1119 EQGIETTNHPLPNNAQNK-ADNVTSTISVLFLAIFMSMGMAFMAASFITFLVQERTSKAKHLQFVSGVDAFSYWSATYTWDFLNYLVPCLLILILFAAFQIEEF--ENDMGSVFLLLILFGLVVLPFIYVMSFAFKSQLIAYAMTVFVLSIMSFGML------LAVFLCRIPSLN---LLDEAEIMHYVFMLLPTYTVSYALIDMSTNYGYRKICSTLQTVESCRDNGIQFTDSSLNWDRPGVGQHALYMAVEAVVLFILTLLIQVRRPYRLI----------PICPWTSQDCDVAGERARVHSLNPEQIKKESVIVKDLTKVYH------------GSD--------RTAVDHLCIGIPRGECFGLLGVNGAGKTTTF 1455          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Nematostella
Match: EDO32070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW56])

HSP 1 Score: 275.404 bits (703), Expect = 2.018e-80
Identity = 184/530 (34.72%), Postives = 308/530 (58.11%), Query Frame = 1
Query: 1261 KYVLSGFIFLQEAIDQAFIELVTNNESIEVGS-SMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMY--YSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESE---PENLKL----GISIHNLVKLYPSNKIPV-INNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIR--TEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLS 2811
            KY++     LQ +ID A  ++V N     V + ++ +MP   +     LQ +  ++P  +V+A+ P +T+L+ ++V EK+ + KE M++MG+ +  +W+SWF++  +V++I  +IM     ++     S+  V+  V + Y +S I  +FM+S  F     A    G +   F  +F V I      S+  Y  +   + S  AF+ A+   +   +++ G QFSNL    G+   F V +CI+++I+D  +YLLI  Y++AV P +YG  +P  F+   S+W    +      L  +  +     H+ + SE   P   ++     ISIHNL K++P  K  V ++ ++++ YE QITA LGHNGAGK+T I  LTG+  PSSGTA I  +DI    ++  +R+ IG+CPQ +V+F+ LTV++H+ FY  LK    ++  +    I+K++ L EK + ++ +LSGG KRKLS+ ++ +G+ +V+FLDEPT+G+DP +RR +W LL + +  ++ ++LTTH MDEAD L+
Sbjct:    8 KYLIYNTTTLQASIDAAISKVVANLPFYIVPNITVQMMPKAQF--TPSLQGIQTIVPIYMVLAFSPYITILVINLVREKQEKHKELMRIMGMVDTAYWLSWFLTYAIVVLIACLIMVTVSVIAGFFGESNYLVLLIVFYLYGLSIIMLSFMMSPLFKNPKTA----GFIASLFTAIFAVLIIPLTGPSIPQYAKWLVSIFSPTAFAFALNEAV---EVHPGAQFSNL-ATKGD---FPVLNCIVMLIVDILLYLLIALYLDAVVPAEYGRRQPPYFIFQPSFWKTMFQRGGG-SLEAHGVRRQLSAHEVYSSEDVEPVAQEMHGREAISIHNLKKVFPGKKPTVAVDGISMDIYEGQITALLGHNGAGKSTLIGALTGMIQPSSGTALIYGKDISRFGDLAELRRNIGVCPQQDVIFEFLTVKEHLEFYFKLKTGGDSQQNNGADAILKEIGLQEKKDDIAKNLSGGQKRKLSVGISLVGDPKVLFLDEPTSGMDPHSRREMWKLL-QGQCKEKCVLLTTHFMDEADILA 522          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Nematostella
Match: EDO32071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW57])

HSP 1 Score: 168.703 bits (426), Expect = 7.181e-46
Identity = 102/304 (33.55%), Postives = 168/304 (55.26%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXX--XXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
            V+ ++       ++   LG NGAGKTTT++++T     S G+  +   D++TE   + Q +G CPQ + LFD +T+E+H+  Y  ++ +    I++V+   +  + +TE  N  +  LSGG KRKLS  MA +G+  ++ LDEP+ G+DP ARR     L K  +  R  ILTTH M+EAD L  RV I+ +G+L+C GS   LK KFG GY L +  + +  +          ++ FV+    +A+  E    +    +P+++++  K +  F  L++    + I  Y  S ++LE+VFL+ A
Sbjct:    3 VVKDVYFGVTPGEVFGLLGPNGAGKTTTLNMMTAGIPASRGSVSVAGYDLQTETHKVFQHMGFCPQQDALFDDITLEEHLTLYASVRGVPWASIDNVVNHYMSAMKITEHANKRAKELSGGTKRKLSFGMAMLGDPDLLLLDEPSTGMDPSARR----FLCKNVTGARGAILTTHSMEEADALCSRVGIMVKGQLKCLGSTQHLKSKFGSGYTLEIKLSPSFQSSDPDVDMQTQLVAFVEGLFPNAKRTESFGDRVIYKVPKSNVS--KLSSTFATLEEGKRSIGIEEYSFSQSTLEQVFLEFA 300          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Medaka
Match: ENSORLT00000045391.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 882.093 bits (2278), Expect = 0.000e+0
Identity = 585/1667 (35.09%), Postives = 912/1667 (54.71%), Query Frame = 1
Query:  547 PENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSAN--PKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRF--IPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXX--------------------------------------XXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD--------PMNKLINKEKSYYSYYCNILKM-----KLRINATKTEI---FLNQNPDQKQSKFLD-QSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWSPA---SILDIPM--------VSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKT---FKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYN---SNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            P +D +  M +  +N +       C  +  +      ++F ++    PL+ GKV Y P+    R ++E+AN TF  L  ++  +  W      F+  ++ N   + +         S +  P   DA N L +   + S +             L C EL++F  +P +     + L +     F A I+F E  Q  +     +L Y+IR+ +  +  T K  V +R W+P    N + + +Y+  GF +L++ ID A I L T+  S  +G  +  MPYPCY+ D FL+ LA  LP  + +AW  SV +++K IV +KESRLKE +++MGL   V+W +W ++ ++ + I  V++++ ++  K+   S  +VVF  +  + +S I + F++SVFFSKAN+A+  GG++YF  Y+  V+       +         LLS VAF    + +  +E+   G+Q+ N+  +P E   +     I++M++D+ IY ++TWY+E VFPGQYG+ +PW FL   SYW       E IP      +   + ++  E    N+K G+SI NLVK+Y + K   ++ L+++FYE+QIT+FLGHNGAGKTTT+SILTG+F P+SGTA I   DIRT+MD+IR+ +G+CPQ+NVLFD LTVE+HIYFYG LK ++ +E+++ + ++IKDV L  K   L  +LSGGM+RKLS+A+AF+G S++VFLDEPTAGVDPFARRGIWDLL+KY+   RTIIL+THHMDEAD L DR+AIIS GK++CCGS +FLK+ FG GYYL+L+++      + R+G                                      +++ +FV+ ++ +A  +E    + T +LP        F  LF+ LD+ M ++ + SYG+SDT+LEE+FLKVA+D        P  + + K+    S       M     K     TK E+     N+  D K+S  ++ +   ++ G+ L++QQ +AL IKR+H+A+R  KG +A+++LP + +   ++F  I         +++ PW+  S+       TFY  +      ++++      + G  G RCM  NP I RL    C     ++ +SP+   S+ DI +         SP C CS  G  I    C     G  P   R+  ++D L NLT  N++D+LLK +    +K YGG      S  G +S+++            +   +     +NL    + D +QK     K  G + +  ++W  +KG+ SM ++ ++ +N +LR  L +       YG+SVSN P+ + +    L  +     ++ ++I VIF +SFIPASFV+FL++ERVS +K  QFVSG+NP VYWV++F+WDI  Y+IP  +++ IFI F  ++Y+  +N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF++++ E   E + +IN+I+K+V LIFP F LGRG+MD+  N       SN       + L W++ G+ L ++       +   ++I+     +          L +++    ED DV  ER+R+   + ++DVLR+ +LTK+Y                     +    AV  LC GV   ECFGLLG+NGAGKTTTF
Sbjct:   17 PTSDQQDTMNSSFQNSQDSDPF--CTTLIDTMVTTPSMQF-LWKNFRPLLKGKVLYTPDTPAARLLVEEANATFMALAAIKEFADSWG-EDGPFVWGFVENGTAVVNESSANSNNSSTDTPPTSEDAYNDLTHFLKLLSKV-------------LGCFELNKFEAVPTEYELVTEALEHLKNDTFWAGIVF-ENLQPNSSSIPPYLKYKIRMDVEEVQRTDK--VENRLWSPGANDNPYENLRYIWGGFAYLEDIIDHASIRLQTST-SQPLGVYVQQMPYPCYVDDPFLRALAGFLPLFMTIAWIFSVALIVKGIVGDKESRLKETVRIMGLRGEVYWSTWLLTCLLPMAISSVLLTIIIKYGKVLQYSDPSVVFIFLLVFCLSTISECFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFQAKVGVSLLSCVAFGYGCENLSKFEEQGVGIQWHNIATSPEEGQRYTFIVSILMMLLDAAIYWVLTWYIENVFPGQYGIPRPWYFLFTYSYWFGKTSVPEDIPDNFKLLKRSSVPNEFLEKPDPNMKAGVSIRNLVKIYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDNIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVFLDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNTKDELKKKLSNKVEDFKKSASVNGRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQ------TTFYSNDMPEDANVSRVVETLVDNPG-FGTRCMEGNP-IPRL---PC-SSGASDWFSPSVDQSVADIFLNGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGI-----SVGGINSQVL------------LTEVEIEEAFANLEPPGYGDTIQKAEMVLKKLGTRNN-VKVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQ-NLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLIQYKFFYK------PRLSLPKVQSEEKEDVDVARERQRVHEGRANNDVLRICDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTF 1601          

HSP 2 Score: 196.823 bits (499), Expect = 6.297e-50
Identity = 112/322 (34.78%), Postives = 173/322 (53.73%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESR--LQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + I +L K+YP    P +  L +    ++    LG NGAGKTTT  +LTG    SSG A++    IRT+M  + Q +G CPQ++ + D L   +H+  Y  L+ + + E+  V    I+ + L +  N  +   SGG KRKLS AMA IG   V+FLDEPT G+DP ARR +WD ++      R+++LT+H M+E + L  R+AI+  G+ QC GS+  LK +FG+GY                + + +  FV+       + E+    LQ+ + L Q    ++ FTE    L  H  E+ +  Y +S T+L++VF+  A +
Sbjct: 1557 LRICDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGY-----TLIVRVGGCPPDLKPVEDFVEETFPGTVLKEKHHNTLQYQL-LSQEGALAKIFTE----LTDHQQELGLEDYSVSQTTLDQVFVNFAKE 1868          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Medaka
Match: ENSORLT00000046301.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 879.782 bits (2272), Expect = 0.000e+0
Identity = 587/1667 (35.21%), Postives = 908/1667 (54.47%), Query Frame = 1
Query:  547 PENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNN--VFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRF--IPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXX--------------------------------------XXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD--------PMNKLINKEKSYYSYYCNILKM-----KLRINATKTEI---FLNQNPDQKQSKFLD-QSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCM--NPSIYRLDNYQCFYRNENNMWSPA---SILDIPM--------VSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKT---FKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYN---SNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            P +D +  M +  +N +       C  +  +      ++F ++    PL+ GKV Y P+    R ++E+AN TF  L  ++  +  W      F+  ++ N   V          +     P   DA N L +   + S +             L C EL++F  +P +     + L +     F A I+F E  Q  +     +L Y+IR+ +  +  T K  V +R W+P    N + + +Y+  GF +L++ ID A I L T+  S  +G  +  MPYPCY+ D F+Q +  +LP  L++A+  SV + IK +V EKE RLKE ++ +G+ N   W S F  T+++L +P V+MSV ++  K+   S  +VVF  +  + +S I + F++SVFFSKAN+A+  GG++YF  Y+  V+       +         LLS VAF    + +  +E+   G+Q+ N+  +P E   +     I++M++D+ IY ++TWY+E VFPGQYG+ +PW FL   SYW       E IP      +   + ++  E    N+K G+SI NLVK+Y + K   ++ L+++FYE+QIT+FLGHNGAGKTTT+SILTG+F P+SGTA I   DIRT+MD+IR+ +G+CPQ+NVLFD LTVE+HIYFYG LK ++ +E+++ + ++IKDV L  K   L  +LSGGM+RKLS+A+AF+G S++VFLDEPTAGVDPFARRGIWDLL+KY+   RTIIL+THHMDEAD L DR+AIIS GK++CCGS +FLK+ FG GYYL+L+++      + R+G                                      +++ +FV+ ++ +A  +E    + T +LP        F  LF+ LD+ M ++ + SYG+SDT+LEE+FLKVA+D        P  + + K+    S       M     K     TK E+     N+  D K+S  ++ +   ++ G+ L++QQ +AL IKR+H+A+R  KG +A+++LP + +   ++F  I         +++ PW+  S+       TFY  +      ++++      + G  G RCM  NP I RL    C     ++ +SP+   S+ DI +         SP C CS  G  I    C     G  P   R+  ++D L NLT  N++D+LLK +    +K YGG      S  G +S+++            +   +     +NL    + D +QK     K  G + +  ++W  +KG+ SM ++ ++ +N +LR  L +       YG+SVSN P+ + +    L  +     ++ ++I VIF +SFIPASFV+FL++ERVS +K  QFVSG+NP VYWV++F+WDI  Y+IP  +++ IFI F  ++Y+  +N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF++++ E   E + +IN+I+K+V LIFP F LGRG+MD+  N       SN       + L W++ G+ L ++       +   ++I+     +          L +++    ED DV  ER+R+   + ++DVLR+ +LTK+Y                     +    AV  LC GV   ECFGLLG+NGAGKTTTF
Sbjct:   17 PTSDQQDTMNSSFQNSQDSDPF--CTTLIDTMVTTPSMQF-LWKNFRPLLKGKVLYTPDTPAARLLVEEANATFMALAAIKEFADSWG-EDGPFVWGFVENGTAVVNESSANSNNSSTDTPPTSEDAYNDLTHFLKLLSKV-------------LGCFELNKFEAVPTEYELVTEALEHLKNDTFWAGIVF-ENLQPNSSSIPPYLKYKIRMDVEEVQRTDK--VENRLWSPGANDNPYENLRYIWGGFAYLEDIIDHASIRLQTST-SQPLGVYVQQMPYPCYVDDPFIQSIGAILPMFLILAFMSSVAMTIKGLVLEKELRLKEVLRGVGIQNGALWSSTFTETMILLTVPCVLMSVMVKYGKVLQYSDPSVVFIFLLVFCLSTISECFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFQAKVGVSLLSCVAFGYGCENLSKFEEQGVGIQWHNIATSPEEGQRYTFIVSILMMLLDAAIYWVLTWYIENVFPGQYGIPRPWYFLFTYSYWFGKTSVPEDIPDNFKLLKRSSVPNEFLEKPDPNMKAGVSIRNLVKIYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDNIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVFLDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNTKDELKKKLSNKVEDFKKSASVNGRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQ------TTFYSNDMPEDANVSRVVETLVDNPG-FGTRCMEGNP-IPRL---PC-SSGASDWFSPSVDQSVADIFLNGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGI-----SVGGINSQVL------------LTEVEIEEAFANLEPPGYGDTIQKAEMVLKKLGTRNN-VKVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQ-NLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLIQYKFFYK------PRLSLPKVQSEEKEDVDVARERQRVHEGRANNDVLRICDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTF 1601          

HSP 2 Score: 196.823 bits (499), Expect = 7.210e-50
Identity = 112/322 (34.78%), Postives = 173/322 (53.73%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESR--LQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + I +L K+YP    P +  L +    ++    LG NGAGKTTT  +LTG    SSG A++    IRT+M  + Q +G CPQ++ + D L   +H+  Y  L+ + + E+  V    I+ + L +  N  +   SGG KRKLS AMA IG   V+FLDEPT G+DP ARR +WD ++      R+++LT+H M+E + L  R+AI+  G+ QC GS+  LK +FG+GY                + + +  FV+       + E+    LQ+ + L Q    ++ FTE    L  H  E+ +  Y +S T+L++VF+  A +
Sbjct: 1557 LRICDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGY-----TLIVRVGGCPPDLKPVEDFVEETFPGTVLKEKHHNTLQYQL-LSQEGALAKIFTE----LTDHQQELGLEDYSVSQTTLDQVFVNFAKE 1868          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Medaka
Match: abca1a (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163147])

HSP 1 Score: 863.603 bits (2230), Expect = 0.000e+0
Identity = 603/1812 (33.28%), Postives = 931/1812 (51.38%), Query Frame = 1
Query:  274 NWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICGSPE--------------NDFKLFMRNFIKNQR-------RKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEW---RLHFQTFL-----LDYISNNVFINDVKKFCKAYYSANP-KICDAVNTLFNITNVKSYIDGVSKLFSW-------------IERGLNCTELDRFIPLDSLKDIDKLTNQSF-----RNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGS-------------LVFLKRKF-------------------------GEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLI----------NKEKSYYSYYCNILKMKLRINATKTEIFLNQ---NPDQKQSKFLDQSDH----LLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWS----PASILDI--------PMVSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK-----------LYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIF--XXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            +WL    + F   +  +  I  SL +G       M  +  +   F     S+  + K I+ L  T N   S N+      Y  +  I+CG PE              N++K    N   +            S   C  + +S   + I +  ++  L PL+ GK+ Y P+    ++II + N TF+ L  LR     W   +  F  F+     +D + N +  N    F  A  S    ++ D  N L   +  K         ++W             I R + C  LD+  P+    + ++L N+S      + F A I+F +            ++Y+IR+ +  ++ T K K  D +W P PR + F D +YV  GF +LQ+ I+Q  I  VT ++  + G  +  MPYPCY+ D FL+ ++  +P  + +AW  SV ++IK +VYEKE+RLKE M++MGLNN   W+SWFIS+++ L+I   ++ + L++  +   S   VVF  +  + +  I Q F++S  FS+AN+A+  GGI+YFT Y+ +V+ +  +  +         LLS VAF    ++   +E+   G+Q+SNL  +P E   + +   I LM+ D+ +Y ++TWY+E+VFPGQYG+ +PW F   +SYW    K ++++  + +   N E+     E EP +++ G+ I NLVK+Y       ++ L+L FYE QIT+FLGHNGAGKTTT+SILTG+F P+SGTAYIL +DIR+E+ +IRQ +G+CPQ+NVLF  LTVE+HI+FY  LK + + ++++ + +I+ DV L  K  + +  LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP+ARRGIWDLL+KYR   RTIIL+THHMDEAD L DR+AIIS GKL C GS             L  +KR +                          E    + L ++ +   +  +   I   +  ++ +AR++E+   + T VLP        F ELF  LD  + ++ I SYG+SDT+LEE+FLKVA+D     +           + +  +  + + LK       T+ E   N    +P+ +++ +L  +D      +KG+ L +QQ +AL  KR+ YA+R  KGF A+++LP + +   ++F  I     K   + + P +   +       +F   +       NKL        G  G RCM      + N  C    +   W+      S+ DI           SP C CS  G +     C D   G PP         + L NLTG N+SDYL+K + ++  K            YGGF     S+   S K            D ++ + A+    +L+S  FI  L     +        +IW N+KG+ S+ ++ N+     L       K   KF   GI+  N P+ + +       +    +++ ++I VIF +SF+PASFV+FL++ERV+ +K  QF+SG+ P++YW++NF+WD+  YI+P  ++IIIF+ F   +Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   ++STF+L++   N   +  INDILK VFLIFP F LGRG++D+  N    ++++ +   N     L WD+ G+ LF++    + ++ + ++I+       I  +   S+LK I     ED DV  ER+R+ S     D+L +  LTKIY                     + ++ AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct:  225 DWLNKAQSHFLSNLDFLKPIRVSLSTG-------MDGVHPDSQSFFSSMKSWKDMRKEILYL--TANPTGSPNQM-----YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGNHGNDSDIEPMSIYDNSSTPYCNNLMKSLESSPISRM-IWRALKPLLMGKILYTPDTPATQRIIHEVNKTFQELGVLRDLGGMWEEMKPQFWNFMENSEEMDMVRNLLQSNVGAAFLNAQLSGTEWRVSDVANFLSKASEDKR---PAGTAYTWRDAFNESDHAIQTISRFMECVNLDKLEPV---ANEERLVNKSMSLLDNQKFWAGIVFPDIVHSDNSDLPPNVNYKIRMDIDNVERTNKIK--DGYWDPGPRADPFEDLRYVWGGFSYLQDVIEQGIIRAVTGSKE-KTGIYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLNNGTLWLSWFISSLIPLLISAGLLVMLLKMGNLLPYSDPGVVFLFLGSFGVVTIMQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFGAKVLVSLLSPVAFGFGCEYFALFEEQGVGIQWSNLLASPLEEDSYNLTTSICLMLFDAVLYGIMTWYIESVFPGQYGIPRPWYFPFTKSYWCGE-KENKNMSALLSKKGNAEV---CIEEEPGHIEPGVYIENLVKVYSHGNKLAVDGLSLKFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSELSTIRQNLGMCPQHNVLFSMLTVEEHIWFYARLKGLSEEKVKAEMEQIVNDVGLPHKRKSRTNTLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYR-QGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTMVKRDYDLALQSCRNSASTVSYSKKTEKDSISESSSDAGLGSEPDSETTTIDVSLISNVIFKHVREARLVEDLGHELTYVLPYQSAKDGAFVELFHELDDRLTDLGISSYGISDTTLEEIFLKVAEDSGVDAVELSDGVVPTRTRRRHAFGDHQSCLK-----PFTEDEFDFNDSEGDPESRETDWLGGADGKGSFQVKGWSLKRQQFVALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALHPSMYGEQF------SFISNDMPDDPHTNKLLGALMEKPG-FGSRCMKGE--PIPNTPCTAVEDE--WAVPEVSESLRDIFAKGNWTRENPSPLCQCSCEGRKRMLPECPDGAGGLPPPQV------NTLQNLTGRNVSDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSLGARSSQFLSHK------------DDIDGTAADRFFHSLSS--FIQGLDSKNNV--------KIWFNNKGWHSISSFLNVMNNGILRASLPAGKDPTKF---GITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSN--EIGGINDILKNVFLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFCITVLIQYRFC---ITTRSSISHLKPI---GEEDEDVARERQRVLSGSGQSDILELRELTKIY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTF 1931          

HSP 2 Score: 193.741 bits (491), Expect = 6.390e-49
Identity = 102/320 (31.87%), Postives = 176/320 (55.00%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            + +  L K+Y   + P ++ L +     +    LG NGAGKT+T  +LTG    +SG AY+  + + TE+D + Q +G CPQ++ + D LT  +H+ FY +L+ + + E+  V    I+ + L + ++  +   SGG  RKLS A+A IG   VVFLDEPT G+DP ARR +W+ ++      R+++LT+H M+E + L  R+AI+  G+ +C GS+  LK +FG+GY           +  + +   ++ F++  +  + + E+ R      LP +  +      +F  L ++   + I  Y +S T+L++VF+  A D
Sbjct: 1887 LELRELTKIYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSLVTSGEAYLAGKSVTTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVAEWGIRKLGLVKYVDKSAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNAILSIIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGY-----TIILRVAGPDPDLRPVMGFIERELPGSTLKEKHRNMLQYQLPSSLTS---LARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKD 2198          

HSP 3 Score: 67.781 bits (164), Expect = 1.209e-10
Identity = 33/80 (41.25%), Postives = 45/80 (56.25%), Query Frame = 1
Query:   19 ISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            +S QL  LLWKNF  +RR+   LLIE+  PL + FIL +VR     Y+   C F  K M S G +P++   +C  N  C+
Sbjct:    3 VSTQLGLLLWKNFTYRRRQTIQLLIEIIWPLFIFFILISVRMYYPPYEQHECHFPNKAMPSAGTLPWVQGIICNANNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Medaka
Match: zgc:172302 (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101162276])

HSP 1 Score: 840.877 bits (2171), Expect = 0.000e+0
Identity = 610/1863 (32.74%), Postives = 960/1863 (51.53%), Query Frame = 1
Query:  220 LTDFLCTFNTSCYDQT-QINWLGTNLNEFHVFIGNI-TEIYNSLPS---GALNVPKFM--KWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMS-------------ENETTIESGYNELGEIICGSPE--------------NDFK-LFMRNFIKNQRRKRSLLT---CQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTF---KILDNLRLASVEWRLHFQTFL-----------------LDYISNNVFINDVKKFCK-AYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDS-LKDIDK----LTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLT--------------MYYSCGL----------LSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXX--------------------------------------XXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMK-LRINATKTEIFLNQNPDQKQSKFLD---QSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKM-----------GKEN-LNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQI----CNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKL-----------YGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANH---NQSNLNSL--KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNA------LQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLK-RIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            L D +C  N S  ++   +    TN+ +    + N+  E+     S     L++ KF+  + + SN  +   +  + S IS+ +  L  +++ + S             E+ T     ++   +I+CG PE              NDFK L  ++ I++     S  T   C+ +      +   +  ++  + PL  GK+ Y P+   +++++++ N TF   ++L ++  A +E     +T++                 +  + N    N      + A++ + P           +T +  Y D  S + + + +   C  LD+   L+S  K ID+    L N+ F   +  ++ N +   L P     +SY+IR+ +  +  T K K  D FW P P    F+D +Y+  GF+++Q+ +++A  +++T  +    G  +  MPYPCY+ D FL+ L   LP  + +AW  SV ++ KSIVYEKE+RLKE M++MGL++   W SWFIS+++  +I   ++   L+   I   S  AVVF  +  +  + I Q F++S FF KAN+AS  GG++YF+ Y+ + +F      L+ T              +Y+  G+          LS VAF    ++   +E+   G+Q+ NL  +P E   +     II++ +D+FIY L  WY+EAVFPG++G+ +PW F+   +YW   +     +P+        E N    E+EP N+ LG++I NLVK+Y       +N+LNL F+E QIT+FLGHNGAGKTTTIS+LTG+F P+SGT YI   DIR +MD IR  +G+CPQ+NVLFD LTVE+H++FYG LK + + ++++ L  +++DV L  K +  + +LSGGM+RKLS+A+AF+G S+VV LDEPTAGVDP++RRGIWDLL+KYR   RTIIL+TH+MDEA+ L DR+AIIS+GKL CCGS +FLK + G GYYL+++K +                                           S+     +L  V+ +I  A ++EESR +  I LPQ              LDQ + E+ I SYGLSD++LEE+FL+VA++     ++ E        N  +    R+     E      P+  ++  L    +    L G  L+ QQ+ AL IKR+ YA+R  +GF A+++LP L +L  +LF  I     +   +++ PW+   +              EN L     +       + K E    S   E G +   P +     +Q F +   +   P         SPEC CS          C +   G PP   + +T  D L NLT YN+SDYL+K + ++ +K            YGGF            K+       E + D V+A +  +     S+L+SL  K   +L+       +K     +W N+KG+ SM ++ N+ +N LLR+ L     +   +GIS  N P+ + +       +    +++ ++  VIF +SF+PASFV+FL+EER S +K  QFVSG+ P +YWV+NF+WD++ Y +P  ++++IFI F  +SY+  +N  A ILLL+FYG +I P MYP SF  + PSTA+VVL + NL +G   +++TF+L++  V+ + L +IN++LKKVFLIFP F LGRG++D+  N    + +   H   A       QWD  G+ LF + +  + ++I  I+++           LK  + + ++     ED DV  ER R+ S +   D+L +INL+K+Y                       ++ AVN LC G+  GECFGLLGVNGAGKT+TF
Sbjct:  192 LKDVVC--NGSLLEKMLSVEGGATNMTDLQTQLCNLPAEVLKEAESLFFSQLDLTKFITRELVVSNAEDLRVMSQAISTISQDLTVLTDSISSLSSFTEVSQALSFLTPESNTAEGERFSAFSKIMCGHPEMGGERIPSFNWYEDNDFKSLLGKDAIEDANLGLSNTTTPFCRSLIHQLESDPRSRI-VWRGIKPLFVGKLLYAPDTPAVKEVMKEVNKTFEDLQVLQDVDEAWMEVGPEIKTYMETSSDIRLLRDLLRRPEVAVLVNMRLENTPWTASQIAHFLSTPSPNAERKPGHPVTWLDLYND-FSHVTNTVAQVTKCISLDKLEGLESEAKLIDRALELLDNRQFWGGVLFLLPNSSTTELPPH----VSYKIRMDIDNVARTNKIK--DNFWDPGPAAEPFSDLRYIWGGFVYIQDLVERALNQVLTGIKQT-TGIYIQQMPYPCYVDDVFLRVLNRSLPLFMTLAWIYSVAMITKSIVYEKEARLKETMRIMGLSSGTLWFSWFISSLIPFLISAALLIGLLKWGNILPYSDPAVVFFFLMAFATATIMQCFLISTFFCKANLASACGGLIYFSLYLPYALFTAWRDHLNSTHRILNCIFSPFIVKIYFCLGMFFFLREFLSFLSPVAFGFGCEYFAQYEEQGLGIQWFNLQSSPVEGDSYSFTTSIIMLYVDAFIYALAAWYIEAVFPGEFGIPRPWYFIFQLNYW-GGVPLEAGMPIPPAPTDQDEDN---IEAEPSNMTLGVNIRNLVKIYKKGGKLAVNHLNLKFFEGQITSFLGHNGAGKTTTISVLTGLFPPTSGTVYIKGLDIRYDMDIIRNTLGVCPQHNVLFDILTVEEHVWFYGCLKGLSEEKVKAELDNLLEDVGLLHKRHEQTKNLSGGMQRKLSVAIAFVGGSKVVVLDEPTAGVDPYSRRGIWDLLLKYRK-GRTIILSTHYMDEAELLGDRIAIISKGKLCCCGSPLFLKSQLGSGYYLTVVKREETNPNTPSGSSFSTSTSIITNKLPHAKDSESSLSEDTGLGSDESSSCVAALLALVQQHIPSASLVEESRREAVINLPQKAAKDGSLAIFLSKLDQRLPELGISSYGLSDSTLEEIFLRVAEE---TGVDAEPEQEELSPNSQQPSGERVEEQPAE---QPEPEPLETDLLSGDCRGGEPLSGSWLMWQQLKALFIKRWLYARRSRRGFFAQIVLPALFVLVALLFSLIVPPFGRYPSVELQPWMYGEQYTFFSNDAPGNPAMENLLEALLDQPGFGTKCMEKEEGNNTSCEVEGGGQFRRPQV-SFSMWQMFSKGNWSKERP---------SPECQCSTEDVSRMLPECPEGAGGLPPPQIKRVT-GDILQNLTSYNVSDYLVKTYAQILKKSLKTKKLVNEFRYGGFSL--------GGKVTQTEVDVEHVEDAVSAFRRRYQVTQNSSLDSLLNKLPAFLEGLHSKDNVK-----VWFNNKGWHSMVSFVNVMNNGLLRASLPPGPER-SKHGISAYNHPLNLTKDQLTEVALMATSVDVLISTCVIFAMSFVPASFVLFLIEERASKAKHLQFVSGVQPLLYWVANFIWDMLNYAVPAAMVVLIFIGFQQKSYVSEQNLPALILLLLFYGWSITPLMYPASFVFTVPSTAYVVLTSINLFIGINCSMATFVLELF-VD-DNLNQINNVLKKVFLIFPHFCLGRGLIDMAKN---QAMADAFHRLGARPVLDPFQWDFVGKNLFCMAASGVFYFIFTILLQYKFFIH-----LKPWWTEPQLPPIGPEDEDVARERARVMSGKFHSDILTMINLSKVYKA--------------------GKKPAVNRLCLGIPPGECFGLLGVNGAGKTSTF 1977          

HSP 2 Score: 183.726 bits (465), Expect = 7.885e-46
Identity = 99/320 (30.94%), Postives = 172/320 (53.75%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADD 3171
            +++ NL K+Y + K P +N L L     +    LG NGAGKT+T  +LTG    + G A++    + TEMD + Q +G CPQ++ + D LT  +H+  Y  L+ + +  +  V    ++ + LT+     +   SGG KRKLS A++ IG   V+FLDEPT G+DP A+R +W+ +       + ++LT+H M+E + L  R+AI+  G+ QC GS+  LK +FG+GY    +  +   + S+     + +++     +  + E+ +      LP +  +      +F  L  +  E+ +  + +S T+L++VF+  A D
Sbjct: 1933 LTMINLSKVYKAGKKPAVNRLCLGIPPGECFGLLGVNGAGKTSTFRMLTGDTPITHGEAFLDRHSVLTEMDRVHQLMGYCPQFDAISDLLTGREHLELYARLRGVPEESVSKVAQWGVRKLGLTQYAEQKAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVTKEGKAVVLTSHSMEECEALCTRMAIMVNGQFQCLGSVQHLKNRFGDGY---TVILRLADTKSDTESCPVDEYMTKSFPNIELKEQHQNVLQYHLPSHGCS---LALIFDALANNCEELGVADFSVSQTTLDQVFISFAKD 2246          

HSP 3 Score: 67.3958 bits (163), Expect = 1.888e-10
Identity = 32/78 (41.03%), Postives = 42/78 (53.85%), Query Frame = 1
Query:   25 NQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCY 258
            +QL  LLWKN   +RR    L+IEL  PL +  IL AVR S   YK   C F  K + S G +P++   +C  N  C+
Sbjct:    5 HQLYLLLWKNVTYRRRNKIQLIIELAWPLFLFLILIAVRQSHPPYKQGQCHFPNKALPSAGTLPWIQSIVCNVNNPCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Medaka
Match: abca4a (retinal-specific ATP-binding cassette transporter [Source:NCBI gene;Acc:101171449])

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 533/1636 (32.58%), Postives = 852/1636 (52.08%), Query Frame = 1
Query:  670 MYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVN-----TLFNITNVKSYIDG-----------------VSKLFSWIERGLN----CTELDRFIPLDSLKDIDKLTNQSFR-----NFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYY---------------------------XXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMW-----SPASI--LDIP-----MVSPECDCSKTGN----QICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRK------------LYGGFQF--VLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSL-KFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFN-YFYNSNSIVKHEY--NALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            M+N + P++ G++ Y P+   +R++I+ AN TF+ L+ LR     W       +  +  + + +  ++   +     NP + D ++       F+  ++ +++                   V K+   + R LN    C  LD+F+   +L D D +T ++        F A +IF     + T      + ++IR+ +  ++ T K K  DR+W P PR +   D +YV  GF + Q+ I+   I   T  E   +G  +  MPYPCY+ D F   L    P  +V+AW  SV++++KSIV EKE RLKE +K MG+ N V W +WFI + +++     +++  +   ++   S+  ++F  +  +  + I Q F++SVFF++A +A+   GI+YFT Y+  V  I  +  ++  M     LLSQVAF    +++  +E+   G+Q+ N+  +P E   F     I +M++D+ +Y ++ WY++ VFPGQYG+ +P+ F     YW+ N K+ +   L +   +  E +   FE+EP+NL  G+ I NLVK++ S   P I+ L ++FYE  IT+ LGHNGAGKTTT+SILTG+F P+ GTA I  +DIRT+MDSIR  +G+CPQ+N+LF  +TV +HI F+ LLK     E E  +  +++D+ L  K + L  +LSGGM+RKLS+A+AF+G ++VV LDEPT+GVDP++RR IWDLL+KYR+  RT+I++THHMDEAD LSDRVAI+SQG+L CCGS +FLK  FG G+Y                            ++  N      S  N E+I+  V  ++  AR++E    + T +LP  +   R +  LF+ L++ + ++ + S+G+SDTSLEE+FLKV  D  N+    E +                         Q+P Q +     +  + ++G  L  +Q +AL IKR H+A R +K F+A+++LP   + F ++F  I     +   + +SPW+     G++   TF+  E  +   +    +      G  G RCM      L+++ C   N    W     +PA I  L+ P       SPEC CS         +C +  +GG P   RI ++ D L +LTG NISDYL+K +PKL R              YGG      LP         I D     +L   +N +   +++  L  +  F+ YL+    +        ++W N+KG+ +M ++ N+ +N +LR+ L + A    ++GI+V N P+ + +       V    ++  +A+ VIF +SF+PASFV++L++ERV+ +K  QFVSG++P VYW++NFLWD++ Y I   +++ IF+ FD + Y  + N  A I LL+ YG ++ P MYP S+  S PSTA+V L+  NL +G  ++                                + LGRG++D+  N    +  +    +Y  +   W   G  LF + +    ++I+ I+I+     R      +   L+       ED DV  ER+R+     ++D+LR+ +L+K Y   +                      AV+ +C GV  GECFGL+GVNGAGKTTTF
Sbjct:  384 MWNSVKPMLMGRILYAPDSPAVRRVIKNANTTFEELERLRTMGKAWE-EVAPQIWAFFQDGIQVEMIRDIIR-----NPSVMDFIDKSLEDAPFSSKHILNFLRNEPLEDRPYDVPNFDWRDVFKMIDRVIRMLNQYGDCVVLDKFV---ALPDEDAVTYRALNLLEDGKFWAGLIFVNMHPWTT-SVPPHIKFKIRMDIDIVERTNKVK--DRYWDPGPRADPMEDLRYVWGGFAYFQDIIEHGIIRTHTGKE-WPLGVYLQQMPYPCYVDDLFTLTLNRCFPVFMVLAWVYSVSMVVKSIVLEKELRLKETLKTMGVTNGVIWSTWFIDSFIMMGTSTALLTAIIMGGRVLNYSNPFILFLFLLTFTTATIMQCFLLSVFFNQAKLAAACCGIIYFTLYLPHVFCIAWQDRITKDMKILLSLLSQVAFGFGTEYLSRYEEQGMGLQWDNIQTSPLEGDEFSFLTSICMMVLDTVLYSVLAWYLDNVFPGQYGIGRPFYFPLLPCYWL-NKKNRKKRILKKILEKVSEQDMSFFEAEPDNLVKGVCIENLVKVFSSCVRPAIDGLTISFYEGHITSLLGHNGAGKTTTMSILTGLFPPTCGTATIYGKDIRTDMDSIRLSLGMCPQHNILF-HMTVAEHILFFSLLKGCPIAEAEEEVENMLQDLGLPHKRDELIQNLSGGMQRKLSVALAFVGGAKVVVLDEPTSGVDPYSRRSIWDLLLKYRT-GRTVIMSTHHMDEADLLSDRVAILSQGRLYCCGSPIFLKNCFGAGFYLTLVRRMKNDPPKVGRKPPVCFCAFKARAVSSNSKTAFLSTGNIESIMALVHHHVPQARLIETIGQELTFLLPNQNFQPRAYASLFRELEETLVDIGLSSFGVSDTSLEEIFLKVTADGTNRKCIPESN------------------------GQDPSQIKEGSAGRGSYRVRGVCLTVKQFLALLIKRLHHATRSYKDFVAQIVLPASFVFFSLMFNLIVPPFGEYPSLTLSPWM----YGRQ--YTFFSNERPTDAAMRYFGNVLLDKPG-FGTRCMVDE--PLEDFPC--NNITTEWEMPLVNPALIEMLESPRWDSLRPSPECQCSTAKKLTMLPVCPE-GAGGLPPPQRIQSTGDVLMDLTGRNISDYLVKTYPKLIRTREVKQVFCSVMFRYGGISVGGQLP-VLSLQPNAIQD--LASQLGQLLNVTGGKYSKQTLRDIGTFLRYLETPNNV--------KVWYNNKGWHAMVSFMNVANNAILRAHLPERA-NLDEFGITVINHPLNLTKEQLSEITVLSTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWMANFLWDMVNYSISAAMVVQIFLFFDKKCYTSATNVQALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCINLFIGINSS-------------------------------HYCLGRGLIDMAMNQAVTDVYARFGEDYSPDPFSWVFIGRNLFCMAAEGFVYFIINILIQY----RFFMDHWQPHILE-------EDVDVAEERKRIQQSGNTNDILRIKDLSKTYTGTII--------------------PAVDRICVGVLPGECFGLVGVNGAGKTTTF 1893          

HSP 2 Score: 167.162 bits (422), Expect = 7.270e-41
Identity = 80/228 (35.09%), Postives = 132/228 (57.89%), Query Frame = 1
Query: 2212 ISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGY 2895
            + I +L K Y    IP ++ + +     +    +G NGAGKTTT  +LTG    +SG A +    I T +  + Q +G CPQ++ + + LT  +H++ Y  L+ + +++I  V    I+ + L+E  +  +   SGG +RKLS A+A IG   +V LDEPT G+DP +RR +W+ ++      R ++LT+H M+E + L  R+AI+  G  +C G++  LK K+G+GY
Sbjct: 1849 LRIKDLSKTYTGTIIPAVDRICVGVLPGECFGLVGVNGAGKTTTFKMLTGDIDVTSGDASVAGHSILTNILDVHQNMGYCPQFDAIDELLTGREHLHLYARLRGVPESQISRVADWAIQKLGLSEYASRTAGTYSGGNRRKLSTAIAMIGCPALVLLDEPTTGMDPLSRRFLWNSIMSVIQDGRAVVLTSHSMEECEALCTRLAIMVNGSFKCLGTIQHLKYKYGDGY 2076          

HSP 3 Score: 54.6842 bits (130), Expect = 1.073e-6
Identity = 24/81 (29.63%), Postives = 40/81 (49.38%), Query Frame = 1
Query:   22 SNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQ 264
              Q+R LLWKN+ ++RR+     +E+  P+++   L  +R     Y+   C F  K M S G +P++    C  N  C+  
Sbjct:    4 GGQVRLLLWKNWTIRRRQRMRFFVEIMWPVMLFIGLVWLRRVNPLYRQHECHFPNKAMPSAGVLPWIQGIFCNANNPCFQH 84          
BLAST of ATP binding cassette subfamily A member 1 vs. Planmine SMEST
Match: SMESG000029537.1 (SMESG000029537.1)

HSP 1 Score: 2964.87 bits (7685), Expect = 0.000e+0
Identity = 1565/1729 (90.51%), Postives = 1629/1729 (94.22%), Query Frame = 1
Query:  115 MVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            MVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRI+PLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAVVFAVIFFYVISFICQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYLSLLKNQNNHSNSNRNGENILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAELILPVLMILFIILFLKISILPKKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF +LSRK++GG+QF+LP+ F  SSKLI  SP W+ +RD VN SQ      NL  L+F+ Y Q+ F       +F+RIW NSKGY SMPAYANI SNLLLRSR+  S   + +YGISV+N+PI  +  TK     N ++LE++LAI+VI  LSFI ASFVIFL++ER+SGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYI SKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVG+ITT+STFILDI+E   E  +  N+ILKKVFLIFPQ++LGRG++DL  NY   + +    +Y+A  W++A EKL SL  L + WWI+LIIIE G++NR++   LK SY    +I+ TEDFD++LE+ RM+S+QK DDVL+VINLTKIYN    F+  C  K K+N ++N+ ++ AVNNLCFGVREGECFGLLGVNGAGKTTTF
Sbjct:    1 MVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIIPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAVVFAVIFFYVISFICQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYLSLLKNQNNHSNSNRNGENILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAELILPVLMILFIILFLKISILPKKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQP----QNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSW-NYGISVTNYPIA-DSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASLILLFLLWWIILIIIERGVINRVLYRMLKVSYFNN-KIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCC-KNKNNDVENENQKFAVNNLCFGVREGECFGLLGVNGAGKTTTF 1721          

HSP 2 Score: 187.963 bits (476), Expect = 2.337e-47
Identity = 106/304 (34.87%), Postives = 177/304 (58.22%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDR-TIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSR-KFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA 3165
             +NNL     E +    LG NGAGKTTT  +LTG    + G A+I    I +++    + +G CPQ++ L   LT E+ + FY  ++ ++ N+I+SV+   ++++ LT     L+ +LSGG KRKLS A+A IGN +V+FLDEPT+G+D  ARR +W+++ K  + ++  +ILT+H+M+E + L  R++I+  G+++C GS+  LK KFG+ YY+ +  +      +N         VK  I +A + + S         Q    S+ +  +LF+  +Q  A  +I+ Y +S  +LE+VF+ +A
Sbjct: 1693 AVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITHGNAFINGHSIISDIIGAHRNMGFCPQFDALHALLTCEEQLIFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVKIRLHSGEAETNNHEK------VKKIIQEAFLSDVSLRDENFATLQYQFCSKIRIFKLFEFFEQMKATKTILDYSISQMTLEDVFINLA 1990          
BLAST of ATP binding cassette subfamily A member 1 vs. Planmine SMEST
Match: SMESG000029534.1 (SMESG000029534.1)

HSP 1 Score: 2249.94 bits (5829), Expect = 0.000e+0
Identity = 1202/1814 (66.26%), Postives = 1426/1814 (78.61%), Query Frame = 1
Query:    7 MNSLISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLG--TNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNF----IKN---------QRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKA-YYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMR--NNNQNCEINHQA---FESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXX-----XXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQS---------DHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENI-------SLG-------LINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            MNS+ + QL+ LLWKNFRLK+RK   L+ E+ VPL+++ I+  VR+S  K+KMD C FKEK M SMG +PF+ DF CTFNT+CY++TQINW    +++  F +F  N+  +Y +LP   L V   + W T +  E  +L ++   I K + PLI+++ +  +EN T  +    ++ ++ CGS ENDF  F   F     KN         Q    S +TC+  F++FF NS     ++  ++  +FGK+++ PN  + R+I+ +AN+TF+ LD +RLAS+EWRLHF+ ++ + ++N+  IN++K  CK+ Y+  +  +C+ VN + N   ++S ++ +S +FS++E+ LNCTEL++F+P++    ++    Q  ++  AV++ N+TF+YLTP N TFL+YQIRIP S+IDST  FKV D+FWT  PRR T  DFKY  SGF+ LQEAID+AFIE+VTNNE+I+VGSSM IMPYPCY+ D F++ + N++PF+LV+AW PSVT LIKSIVYEKE RLKE+M+VMGL N VHW+ WF+ST+VVLI PV IMS+ L  S I + S  AVVF V+  YV+SFICQ FM+S+FF+ AN+ASV+GG++YF  YM FVVFI+++ +LS   YY  GL +QVAF NA+ F+ YWEQ  EG  F NLF      L FGVGHC++++I+DS +YL + WYVE+VFPGQYGV K W FL  R+YW    ++ E+I L    NN++   I++ +   FE+E  +L++GISI NLVK YP  K   ++NLNLNFY+SQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIR++MD IR+K+GLCPQ+N+LF +LTVEDHIYFYGLLK M   EI  VLP IIKDV LT K+N LS  LSGGMKRKLS+A+AFIG+  +VFLDEPTAGVDPFARRGIWDLLIKYR+ +RTIILTTH MDEADYLSDR+AIISQGKLQCCGS VFLKRKFG+GY L L+KN N          + +G+ +L+F+K +I DA+M  E+  QW+ VLPQND NS KF+ LF NLD+ +  ++ +SYGLSDTSLEEVF++VADDP  K+  + K+      N+ ++ +  +    E FL+   D  Q  F+D+S           LL+GFPLL+QQII L IKR+HYAKR+ KG  AELILP+LMI  +I  LK+    +    M+ISPWLMM K    NLNTFYRKEN         LG       L ++LESEYRSDLGESGIRCMNPSIYR  +Y+CF   +NN WSP    +IP++SPECDC+ TG QICND RSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF KLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIW NSKGYVSMPAYANIFSNLLLRSRLNKSAVKFIDYGISVSNFPIEMEQSTKFLDLV QMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYI SKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLN YNLLVGTITTISTFILDILE NYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF
Sbjct:    1 MNSIFTKQLKVLLWKNFRLKKRKPITLISEILVPLLIIIIIVPVRNSIFKFKMDHCEFKEKSMASMGFVPFILDFFCTFNTTCYNKTQINWNENYSSIYAFKMFTKNLYNVYQTLPKEKLTVNSLITWATIHKFEIDQLISNIMPIIKLLSPLIASLKEADTENLTASKPIIIQIFKVFCGSDENDFTEFYYKFSSISTKNVSGQTNAGSQFMNESNVTCERNFENFFGNS----NIFGTISSWVFGKIYFSPNSPLTREIMRRANITFETLDYIRLASIEWRLHFRDWINEAVNNSKLINELKS-CKSWYFYFDNNLCETVNAVLNFQTIQSILNKISLMFSFLEKTLNCTELNKFVPINESITVENFIKQPIKSVFAVLVINDTFRYLTPSNATFLNYQIRIPESQIDSTKHFKVTDKFWTAEPRRETLRDFKYYTSGFLLLQEAIDRAFIEIVTNNETIDVGSSMQIMPYPCYVDDMFIRFITNMMPFMLVIAWVPSVTGLIKSIVYEKERRLKEFMRVMGLGNSVHWIGWFLSTVVVLIFPVTIMSLLLIYSSILSFSCFAVVFLVLLLYVVSFICQVFMISLFFNNANLASVAGGVIYFILYMPFVVFIRMQSDLSTGFYYLGGLSAQVAFCNAINFIGYWEQSTEGAHFGNLFDGAIIDLKFGVGHCMLMLIVDSVLYLSVAWYVESVFPGQYGVGKAWYFLFTRNYW----RAKENISLAHDINNSEPLIIDYDSEGNFENEYTDLRVGISIRNLVKTYPGAKTRAVDNLNLNFYQSQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKVKEIRQVLPIIIKDVGLTAKVNTLSKKLSGGMKRKLSLALAFIGDPSIVFLDEPTAGVDPFARRGIWDLLIKYRNDERTIILTTHQMDEADYLSDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPA-KINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLE-DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAELILPILMITLMIALLKLVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFRKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWVNSKGYVSMPAYANIFSNLLLRSRLNKSAVKFIDYGISVSNFPIEMEQSTKFLDLVIQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNVYNLLVGTITTISTFILDILEGNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 1803          

HSP 2 Score: 183.726 bits (465), Expect = 5.044e-46
Identity = 104/318 (32.70%), Postives = 172/318 (54.09%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDR-TIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQN-------------------DINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVF 3153
             +NNL     E +    LG NGAGKTTT  +LTG    + G A+I  + I ++M    + +G CPQ++ L   LT E+ + FY  ++ ++ N+I+SV+   +K++ LT     L+ +LSGG KRKLS A+A IGN +V+FLDEPT+G+D  ARR +W+++ K  + ++  +ILT+H+M+E + L  R++I+  G+++C GS+  LK KFG+ YY                       VKI++   +     RL+  + +  N                   D++  K +++F    +   +  II + +  TSL+E+F
Sbjct: 1775 AVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITHGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLKNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDNYY-----------------------VKIHLYSRKCQISHRLEVKLAIENNFRSGISIKDENFLTLLYTFDLSFIKLSDIFTFFHKMKVDGLIIDFTVYQTSLDEIF 2069          
BLAST of ATP binding cassette subfamily A member 1 vs. Planmine SMEST
Match: SMESG000032861.1 (SMESG000032861.1)

HSP 1 Score: 1911.73 bits (4951), Expect = 0.000e+0
Identity = 1004/1743 (57.60%), Postives = 1302/1743 (74.70%), Query Frame = 1
Query:  163 MDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELV-TNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNN----------NQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXX-----XXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPM-------NKLINKEK-SYYSYYCNILKMKLRINATKTEIF-----LNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNT-EDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            MDLC  +EK+M SMGPIPFL DFLCT NT+CY++TQI+W G N N+F  F+ N+T +Y+       N P    + T  PN+  +L  S +Y++    PL+  + ++ S N+T  + G   +   ICGS END  LF+ +F+ NQ+ KRSL +CQ  F     +S    ++Y ++APLIFGK++Y P+    R++I++AN TFKILD+LRL++VEWRLHF ++ ++Y++N+  IN+++ FCK       ++C  VNT  ++ N+ +Y   +S +F+ IE  LNCTEL++F+P+ S  DID L NQS  N  A ++ NE+FQYLT  N TFLSYQIR+P +RID+T KFKV+D FWTP PR +TF+DFKY  SGF+ LQEA+DQAFIE+V TNNESI VGSSM IMPYPCY+ DKF++ L++++PFLL++AW PSVT+L+K IVYEKE+RLKE+M+VMGL+N VHW+ WFI+TI +L++P++IM++ LR S I   SS AVVF ++  YV+SFICQ+FM+SVFF KANVA+V+GGI+YF  Y+ F VFI +  +++ +MYY  GLL+QVAFSN++ F+ +WEQ  +GVQFSNLF +   +L  GVGHC+++M +DS IYLLI WYVE+VFPGQYGV KPW FL  + YW  N  S +  P+  +N          N N  I    FESEP NLK+GISI NLVK YP  K   +++LNLNFY+SQITAFLGHNGAGKTTTISILTGIFS +SGTAYILNEDIR++MD IR+K+GLCPQ+N+LF +LTVEDHIYFYGLLK M   EI  +LP+II+DV LT+K+ + S +LSGGMKRKLS+AMAFIG+S+VVFLDEPTAGVDPFARRGIWDLLIKYR+ +RTIILTTHHMDEADYLSDR+AIISQGKLQCCGS VFLK++FG+GYYL L+KN  +      S  + +GE +L F++ +I DA+M+EE+R QWTIVLPQN+INS KF++LF ++D+ ++ ++I+SYGLSDTSLEEVFLKVADDP        +K I  E     +   N  +   R++      F     LN  P +  +        LL G  LL+QQ++ L +KR+HY KR+ KGF+AEL+LP+L+I+ +I F KIS     Q PM+ISPWLMM K    NLNTFYRKEN S  LI+KL   YRSDL E+G RCMN S+YRLD+Y C   +  N W+      IP+++  CDC+ TG Q+C++  SGGP NSYR+M S+DKLNNLTGYNISD+L+K F    +K YGGFQF+LPS FG S KLIG  P W+ +R   + S ++++ SN + L F++Y Q+ F + GIKT+FTRIW NSKGY S+PAY NIFSNLL+R+R   +     +YGISV+N+P++  QS     L  QM +E+SLA+FVIFGLSFIPASFVIFL+EER++GSKRQQ VSG+NPYVYW+SNFLWDI+KYI+PI II++IF+AFDYQSYI SKN  AFI LLIFYGLAIIPHMYPFSF +STPSTAFVVL+AYNLL+G+ITTISTF LD+L+ + E LK +ND+LKKVFL+FPQ+ LGRG+MDL FNY   + S  K +Y+   W   GEKL SL  L +GWWIV+ IIESGI+NR++CGK+KN  LK  E+++  ED DV +ERER+ S++ SDDVL+VI LTK+YN  L  K+ C +K   + ++N+ R++AVNNLCFGV+EGECFGLLGVNGAGKTTTF
Sbjct:    1 MDLCELREKQMASMGPIPFLRDFLCTLNTTCYNKTQIDWSGNNTNDFQTFLNNMTYLYD-----VFNKP----FPTPTPNDITQLTYSLNYLNSSTYPLLVAMMQIQSGNKTESDKGMKTIEASICGSSENDMNLFVNSFVTNQKSKRSLQSCQNQFLQTLGSSSYGSQLYEVIAPLIFGKIYYTPDSPFTRELIKRANSTFKILDDLRLSAVEWRLHFSSYFVNYMNNSQPINNLRNFCKLNIPGTQQMCSTVNTTLDMENILAYNAAISAVFAIIENSLNCTELNKFVPMKSSIDIDNLANQSLTNIYAGLVINESFQYLTRNNATFLSYQIRMPTNRIDTTLKFKVIDSFWTPAPRISTFSDFKYYTSGFMLLQEALDQAFIEIVSTNNESINVGSSMQIMPYPCYVNDKFIKFLSSMMPFLLIIAWMPSVTILLKGIVYEKENRLKEFMQVMGLSNLVHWIGWFITTISILMLPIIIMTLILRYSTILGFSSPAVVFLILLSYVVSFICQSFMISVFFDKANVAAVAGGIIYFISYLPFYVFITIPDDVTDSMYYGVGLLTQVAFSNSINFIAFWEQSTDGVQFSNLFDSTVVNLNVGVGHCMVMMWVDSVIYLLIAWYVESVFPGQYGVGKPWYFLFTQHYWCQNSASYKITPI--DNYYPYESSPIPNINEGILKHGFESEPTNLKVGISIKNLVKTYPGAKTRAVDDLNLNFYQSQITAFLGHNGAGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDERTIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINSGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITAEDLDSLTDDGNFPRPSSRLSFRCKREFPRFDDLNSIPYESGAP-----SSLLTGSALLRQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVVMIAFSKISSNLNYQPPMEISPWLMMPKARSLNLNTFYRKENSSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYPC-SSSIGNQWTGNPPEPIPLLTAACDCNTTGFQLCSNSSSGGPQNSYRLMASTDKLNNLTGYNISDHLIKKFKSYIKKQYGGFQFLLPSPFGQSCKLIGSLPIWDAMR---SQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLMRTRFESNGS---NYGISVANYPLKYTQSDLLSKLNTQMFVEVSLAVFVIFGLSFIPASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLLGSITTISTFFLDLLQQDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVFIIESGIINRMLCGKIKNRNLKAKEMKDEFEDVDVAVERERIISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDTLENEKRKLAVNNLCFGVQEGECFGLLGVNGAGKTTTF 1720          

HSP 2 Score: 189.889 bits (481), Expect = 6.986e-48
Identity = 110/314 (35.03%), Postives = 180/314 (57.32%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDR-TIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDI-NSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA--DDPMNKLI 3189
             +NNL     E +    LG NGAGKTTT  +LTG    + G A+I  + I ++M    + +G CPQ++ L   LT E+ + FY  ++ +  N+I+SV+ R ++++ LT     L+ +LSGG KRKLS A+A IGN +V+FLDEPT+G+D  ARR +W+++ K  + ++  +ILT+H+M+E + L  R++I+  G+++C GS+  LK KFG+ YY+++         ++         VK  I D    E S +  + V  Q    +S K   +F   +    +  I+ Y +S T+L++VF+  A  D P+  L+
Sbjct: 1692 AVNNLCFGVQEGECFGLLGVNGAGKTTTFKMLTGEEEITHGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIKSNQIKSVVDRSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVTIRMPFGKDHENDNEK------VKAIIEDKFPSEVSFVDGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILDYSVSQTTLDDVFINFARDDKPVKSLV 1999          
BLAST of ATP binding cassette subfamily A member 1 vs. Planmine SMEST
Match: SMESG000032891.1 (SMESG000032891.1)

HSP 1 Score: 1903.64 bits (4930), Expect = 0.000e+0
Identity = 1001/1732 (57.79%), Postives = 1291/1732 (74.54%), Query Frame = 1
Query:  193 MVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNFIKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELV-TNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNN---------NQNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXX-----XXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMN--------KLINKEKSYYSYYCNILKMKLRINATKTEIF-----LNQNPDQKQSKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNT-EDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            M SMGPIPFL DFLCT NT+CY++TQI+W G N N+F  F+ N+T +Y+       N P    + T  PN+ I+L  S +Y++    PL+  + ++ S N+T  + G   +   ICGS END  LF+++F+ NQ+ KRSL +CQ  F     +S    +MY +LAPLIFGK++Y P+    R++I++AN TFKILD+LRL++VEWRLHF ++ ++Y++N+  IN+++ FCK       ++C  +N   ++ N+ +Y   +S +F+ IE  LNCTEL++F+P+ S  DID L NQS  N  A ++ NE+FQYLT  N TFLSYQIR+P +RID+T KFKVLD +WTP PR NT TDFKY  SGF+ LQEA+DQAFIE+V TNNESI VGSSM IMPYPCY+ D F + L+ ++PFLL++AW PSVT+L+K IVYEKE+RLKE+M+VMGL+N VHW+ WFI+TI +L++P++IM++ LR  KI A SS AV+F ++  YV+SFICQ+FM+SV F KANVASV+GGI+YF  Y+ F VF+ L  +++ +MYY  GLL+QVAF N++ F+ +WEQ  +GVQFSNLF +   +L  GVGHC+++M +DS IYLLI WYVE+VFPGQYGV KPW FL  R YW  N  +S+ I L+ N+         N N  I    FESEP NLK+GISI NLVK YP  K   +++LNLNFY+SQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNED+R++MD IR+K+GLCPQ+N+LF +LTVEDHIYFYGLLK M   EI  +LP+II+DV LT+K+ + S +LSGGMKRKLSIAMAFIG+S+VVFLDEPTAGVDPFARRGIW+LLIKYR+ +RTIILTTHHMDEADYLSDR+AIISQGKLQCCGS VFLK++FG+GYYL L+KN  +      S  + +GE +L F++ +I DA+M+EE+R QWTIVL QN+IN+ KF++LF ++D+ ++ ++I+SYGLSDTSLEEVFLKVADDP          ++  ++    +   N  +   R++      F     LN  P +  +        LL G  LL QQ++ L +KR+HY KR+ KGF+AEL+LP+L+I+ +I F KIS     Q PM+ISPWLMM K    NLNTFYRKEN S  LI+KL   YRSDL E+G RCMN S+YRLD+Y C  R   N W+      IP+++  CDC KTG Q+C++  SGGP NSYR+M S+DKLNNLTGYNISD+L+K F    +K YGG+QF+LPS FG S KLIG  P W+ +R   + S ++++ SN + L F++Y Q+ F + GIKT+FTRIW NSKGY S+PAY NIFSNLLLR+R   +     +YGISV+N+P++  QS     L  QM +E+SLA+FVIFGLSFIPASFVIFL+EER++GSKRQQ VSG+NPYVYW+SNFLWDI+KYI+PI II++IF+AFDYQSYI SKN  AFI LLIFYGLAIIPHMYPFSF +STPSTAFVVL+AYNLLVG+ITTISTF LD+L+ + E LK +ND+LKKVFL+FPQ+ LGRG+MDL FNY   + S  K +Y+   W   GEKL SL  L +GWWIV++IIESGI+NR +CGK+KN  LK  EI++  ED DV +ERER+ S++ SDDVL+VI LTK+YN  L  K+ C +K   + ++N+ R++AVNNLCFGVREGECFGLLGVNGAGKTTTF
Sbjct:    1 MASMGPIPFLRDFLCTLNTTCYNKTQIDWSGNNTNDFQTFLNNMTYLYD-----VFNKP----FPTPTPNDIIQLTYSLNYLNSSTYPLLVAMMQIQSGNKTESDKGMKTIEASICGSSENDMNLFVKSFVNNQKSKRSLQSCQNQFIQTLGSSSYGSQMYQVLAPLIFGKIYYTPDSPFTRELIKRANSTFKILDDLRLSAVEWRLHFSSYFVNYMNNSQPINNLRNFCKLNIPGTQQMCIYLNATLDMENILAYNAAISAVFAIIENSLNCTELNKFVPMKSSIDIDNLANQSLTNIYAGLVINESFQYLTRNNATFLSYQIRMPTNRIDTTLKFKVLDSYWTPAPRINTLTDFKYYTSGFMLLQEALDQAFIEIVSTNNESITVGSSMQIMPYPCYVNDNFNKFLSGMMPFLLIIAWMPSVTILLKGIVYEKENRLKEFMQVMGLSNLVHWIGWFITTISILMLPIIIMTLILRYGKILAFSSPAVIFLILLSYVVSFICQSFMISVLFDKANVASVAGGIIYFISYLPFYVFLNLPDDVTDSMYYGVGLLTQVAFCNSINFIAFWEQSTDGVQFSNLFDSTVVNLNVGVGHCMVMMWVDSVIYLLIAWYVESVFPGQYGVGKPWYFLFTRHYWCQN-SASDKITLIDNHYSYESLPIPNINEGILKHGFESEPTNLKVGISIKNLVKTYPGAKTRAVDDLNLNFYQSQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDLRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSIAMAFIGDSKVVFLDEPTAGVDPFARRGIWNLLIKYRNDERTIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLSQNEINNGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITTEDLDSLTDDGNFPRPSSRLSFRDKREFPRFDDLNSIPYESGAP-----SSLLTGSALLCQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVIMIAFSKISSNLNYQPPMEISPWLMMPKARSLNLNTFYRKENSSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYPCSSRT-GNQWTGNPPEPIPLLTAACDCKKTGYQMCSNSSSGGPQNSYRLMASTDKLNNLTGYNISDHLIKKFKSYIKKQYGGYQFLLPSPFGQSCKLIGSLPIWDAIR---SQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLLRTRFESNGS---NYGISVANYPLKYTQSDLLSKLNTQMFIEVSLAVFVIFGLSFIPASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLVGSITTISTFFLDLLQKDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVLIIESGIINRTLCGKIKNRNLKAKEIKDEFEDVDVAVERERIISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDALENEKRKLAVNNLCFGVREGECFGLLGVNGAGKTTTF 1710          

HSP 2 Score: 188.348 bits (477), Expect = 1.795e-47
Identity = 110/314 (35.03%), Postives = 180/314 (57.32%), Query Frame = 1
Query: 2260 VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDR-TIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVKIYIADARMMEESRLQWTIVLPQNDI-NSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVA--DDPMNKLI 3189
             +NNL     E +    LG NGAGKTTT  +LTG    + G A+I  + I ++M    + +G CPQ++ L   LT E+ + FY  ++ ++ N+I+SV+   ++++ LT     L+ +LSGG KRKLS A+A IGN +V+FLDEPT+G+D  ARR +W+++ K  + ++  +ILT+H+M+E + L  R++I+  G+++C GS+  LK KFG+ YY+++         ++         VK  I D    E S +  + V  Q    +S K   +F   +    +  I+ Y +S T+L++VF+  A  D P+  LI
Sbjct: 1682 AVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITRGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVTIRMPFGKDHANDNGK------VKAIIEDKFPSEVSFVDGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILDYSVSQTTLDDVFINFARDDKPVKSLI 1989          
BLAST of ATP binding cassette subfamily A member 1 vs. Planmine SMEST
Match: SMESG000068605.1 (SMESG000068605.1)

HSP 1 Score: 1896.32 bits (4911), Expect = 0.000e+0
Identity = 997/1762 (56.58%), Postives = 1304/1762 (74.01%), Query Frame = 1
Query:   97 LTVPLIMVFILFAVRSSQAKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNEFHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRIVPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNF-IKNQRRKRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIEKANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSANPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLKDIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYKFKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEVGSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKESRLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSLAXXXXXXXXXXXXXXCQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFIKLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGESLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYW-----VYNIKSSESIPLMRNNN-QNCEINHQAFESEPENLKLGISIHNLVKLYPSNKIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXI-----LKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLIN-KEKSY-------------YSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQSDH-LLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAEXXXXXXXXXXXXXXXXXXXXXXKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFXXXXXXXXXXKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 5301
            + +PL ++FIL AVR   + Y M  C  +EK+M SMGPIPFL DF+CTFNTSCY+ TQI+W   ++N+F  F+ NI+ +Y+SL +    VP F+ W   NPN + +L NS +YIS  I   I+++ ++ + ++T I      LG+++CGS +ND  +F++NF +      +S+ TCQL F ++F  S     +Y ++ PL+FGK++Y PN    ++II +AN TF+ILDNLRLASVEWRL F  +L++  +N   +ND + +C    ++   +C  +N   +I  ++S I  +S +F  IE  LNCT+L++F P+ S  DID L+NQS    LA I+F + FQYLTP+N TFL+Y+IR+P SRIDST  FKVLDR WTP PR NT T+F Y  SGF+FLQE IDQAFIEL+T+N S+ +GSSM IMPYPCYL D+ +  L+NL+PFLLV+AW P+VT LIKSIVYEKE+RLKE+M+VMG++NFVHWVSWF STI++LI+P+++M++ L+L KI   SS  ++F ++FFYV+SFICQ FM+SVFF KA+VASVSGGILYF FY+ F++F+ L+  +++ MYY+  LL+QV+ SN++ F+ YWEQ  +G+QFSNLF +    L FGVGHC+++M IDS IYLLI WYVE VFPGQ+G++KPWNF   R+YW       N+  +ES     N    N  +N + FE EP +LK+GISI NL K++P +KIP +NNLNLNFY+SQITAFLGHNGAGKTTTISILTG+F+PSSGTA+ILN+DIRT MD IRQK+GLCPQ+N+LF+ LTVEDHIYFYGLLKRMDKN I++++P+II++V LT+KI++L+ +LSGGMKRKLS+A+AF+G+SRVVFLDEPTAGVDPFARRGIWDLL+KYR  DR IILTTHHMDEADYLSDR+AIISQGKLQCCGS VFLK++FG GYYL ++K ++      +N  +I     LKF++ ++ DA+MMEE+R QWTI LPQ++ N  KF +LF NLD+ M ++ I++YGLSDTSLEEVFLKVADDP  ++   KEK               +    +IL ++ +    K E       + ++  F  +  + +L G  L  QQII L IKR+HY +R+ K F+AEL+LPVLMIL II  L IS       PM ISPWLMM K    NLNTFYRKE+ S  +I+ +E+ YRSD+GESG+RCMN ++YRL NY C+  N  N WS      I + SPECDCSKTG Q C+D  SGGP  S RIMTSSD+L N+TGYNISDYLLK F    +K YGG+QF+LPS FG SS  IG SP W+ +     +S  N + +N NSL F++Y Q+ F   GIKT++TRIW NSKG+VSMPAY NIFSN+LLRS+L  S      YGISV+N+P++  Q+     L  QM LE+SLAIFVIFGLSFIPASFVIFL+EER+SG+KRQQFVSG+NPY+YW+SNF+WD++KYIIP+ I+++IF+ F+YQSYI ++NA AFI+LL+FYGLAIIPHMYPFSF +S PSTAFV+L+AYNLLVG ITTI+TF LD+L+V+   LK  ND+LKK+FLIFPQ++LGRG+MDL FNY   + S  K  Y+   W+  G+KL SL  L I WW V+  IESGI+NR ICG++KN  LK  E+++ ED DV LERERM+  +++ DVL+VINLTKIYN  L   + C ++   + + ++ R++AVNN+CFGV+EGECFGLLGVNGAGKTTTF
Sbjct:    1 MLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYCA---NSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSNQSSLGILAGIVFTDDFQYLTPQNATFLNYRIRMPASRIDSTKNFKVLDRLWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTILILILPIILMTIILKLGKILTFSSPIIIFLILFFYVVSFICQCFMISVFFDKASVASVSGGILYFVFYLPFLIFVNLQDSMTVPMYYAAALLTQVSLSNSINFIAYWEQSTDGIQFSNLFDSAIMDLNFGVGHCMVMMWIDSVIYLLIAWYVETVFPGQFGLSKPWNFPFTRNYWNSICGKSNLDETESFSNSLNEPIPNESLNERGFEHEPAHLKMGISIQNLFKIFPKSKIPAVNNLNLNFYQSQITAFLGHNGAGKTTTISILTGLFAPSSGTAFILNDDIRTNMDRIRQKMGLCPQHNILFEDLTVEDHIYFYGLLKRMDKNMIKNIIPKIIEEVGLTKKISSLTKNLSGGMKRKLSVALAFVGDSRVVFLDEPTAGVDPFARRGIWDLLVKYRCEDRAIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIALPQSENNCSKFPDLFDNLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIE-------EIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFIAELVLPVLMILMIIGLLNISSPLSDAPPMVISPWLMMPKTRLVNLNTFYRKESPSNAIIDSMENVYRSDVGESGVRCMNSAVYRLGNYSCYPENNVNQWSAIPSAPISLSSPECDCSKTGFQFCSDPLSGGPTISSRIMTSSDQLGNITGYNISDYLLKKFKTFIKKQYGGYQFLLPSNFGLSSNSIGSSPIWDGI-----SSYINSSPNNSNSLGFLNYSQRFFNQSGIKTNYTRIWVNSKGFVSMPAYENIFSNILLRSKL-NSFSDISKYGISVTNYPLKFSQTDLQSQLNTQMFLEVSLAIFVIFGLSFIPASFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWSVIFTIESGIINRSICGRIKNYKLKERELQHEEDTDVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTF 1746          

HSP 2 Score: 172.17 bits (435), Expect = 1.617e-42
Identity = 125/422 (29.62%), Postives = 209/422 (49.53%), Query Frame = 1
Query: 1999 SFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYWVYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLY-PSNKIP-------------------VINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESVLPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAGVDPFARRGIWDLLIKYRSHDRT-IILTTHHMDEADYLSDRVAIISQGKLQCCGSLVFLKRKFGEGYYXXXXXXXXXXXXXXXXXXXILKFVK-IYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKE 3198
            S I L I W+   +F  + G+      +C R    Y +K  E   L    + +  +  +      EN+ + + + NL K+Y PS  I                     +NN+     E +    LG NGAGKTTT  +LTG    + G A+I +  I  EM    + +G CPQ++ L   LT E+ +YFY  ++ +  + I+  +   +K++ L      L+  LSGG KRKLS A+A IG  ++VFLDEPT+G+D  ARR +W+++    + ++T +ILT+H+M+E + L  R++I+  G+++C G++  LK KFG+ Y++ +  N   + +         +F + + + D   +    LQ+          S K + +F   +   A   I  Y +S TSL+EVF+  A +  +   N+E
Sbjct: 1619 SLIILFIAWW-SVIFTIESGIIN--RSICGR-IKNYKLKERE---LQHEEDTDVFLERERMTKRKENVDV-LKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFIT---LQYRFNC------SLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNKSSNNENEE 2023          
The following BLAST results are available for this feature:
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA11.817e-4434.39ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA74.043e-4132.80ATP binding cassette subfamily A member 7 [Source:... [more]
ABCA42.941e-4731.04ATP binding cassette subfamily A member 4 [Source:... [more]
ABCA122.060e-4330.59ATP binding cassette subfamily A member 12 [Source... [more]
ABCA121.903e-4330.70ATP binding cassette subfamily A member 12 [Source... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abt-27.278e-10937.58ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-28.630e-10937.58ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-41.664e-10634.88ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
ced-73.177e-5727.91ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
ced-73.377e-5727.91ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA7.567e-12135.14gene:FBgn0031170 transcript:FBtr0332489[more]
ABCA8.258e-12135.14gene:FBgn0031170 transcript:FBtr0332488[more]
ABCA8.628e-12135.14gene:FBgn0031170 transcript:FBtr0306679[more]
CG60524.144e-10834.57gene:FBgn0036747 transcript:FBtr0075195[more]
CG428166.581e-7533.05gene:FBgn0261998 transcript:FBtr0307890[more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca1b7.413e-4734.02ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4a6.173e-4132.26ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca121.980e-4130.40ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4b1.454e-6736.14ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1a8.664e-17438.17ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA17.871e-4332.61ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA17.018e-4434.36ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA18.621e-4333.68ATP binding cassette subfamily A member 1 [Source:... [more]
klf92.397e-4433.41Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
ABCA16.803e-4433.60ATP binding cassette subfamily A member 1 [Source:... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abca14.091e-4534.39ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca41.170e-4431.44ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca128.122e-4630.92ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca135.904e-16928.57ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca73.927e-16132.89ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41233|ABCA1_MOUSE2.862e-4434.39Phospholipid-transporting ATPase ABCA1 OS=Mus musc... [more]
sp|O95477|ABCA1_HUMAN8.727e-4434.39Phospholipid-transporting ATPase ABCA1 OS=Homo sap... [more]
sp|Q7TNJ2|ABCA7_RAT2.309e-4330.87ATP-binding cassette sub-family A member 7 OS=Ratt... [more]
sp|O35600|ABCA4_MOUSE8.185e-4431.44Retinal-specific phospholipid-transporting ATPase ... [more]
sp|Q8IZY2|ABCA7_HUMAN1.941e-4032.80Phospholipid-transporting ATPase ABCA7 OS=Homo sap... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
N1PB024.826e-4536.88Uncharacterized protein OS=Capitella teleta OX=283... [more]
W5LAQ71.364e-4533.33ATP binding cassette subfamily A member 1 OS=Astya... [more]
A0A3Q2D7H11.609e-4034.67Zgc:172302 OS=Cyprinodon variegatus OX=28743 PE=4 ... [more]
A0A3B4Y3901.246e-4433.84Uncharacterized protein OS=Seriola lalandi dorsali... [more]
A0A3Q3L3K99.427e-4134.58Zgc:172302 OS=Mastacembelus armatus OX=205130 PE=4... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016919.25.167e-4933.33pep primary_assembly:Astyanax_mexicanus-2.0:8:9912... [more]
abca4a6.947e-4033.08retinal-specific ATP-binding cassette transporter-... [more]
abca4a6.191e-4033.27retinal-specific ATP-binding cassette transporter-... [more]
zgc:1723021.309e-4733.56zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5][more]
zgc:1723029.990e-4734.13zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5][more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002495.10.000e+037.16pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene... [more]
abca123.266e-10231.47ATP-binding cassette, sub-family A (ABC1), member ... [more]
ENSPMAT00000004117.15.811e-8837.02pep scaffold:Pmarinus_7.0:GL489716:190:6182:-1 gen... [more]
ENSPMAT00000006988.11.407e-6933.15pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-... [more]
ENSPMAT00000006855.14.864e-4731.68pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ATM15.989e-1627.16Mitochondrial inner membrane ATP-binding cassette ... [more]
YOL075C_mRNA1.842e-1526.15Putative ABC transporter [Source:SGD;Acc:S00000543... [more]
ADP11.105e-1428.29Putative ATP-dependent permease of the ABC transpo... [more]
STE64.014e-1426.01Plasma membrane ATP-binding cassette (ABC) transpo... [more]
MDL23.856e-1231.12Mitochondrial inner membrane half-type ABC transpo... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468788.314e-4937.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388795.002e-17433.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489511.761e-13136.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320702.018e-8034.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320717.181e-4633.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045391.16.297e-5035.09ATP-binding cassette sub-family A member 1-like [S... [more]
ENSORLT00000046301.17.210e-5035.21ATP-binding cassette sub-family A member 1-like [S... [more]
abca1a6.390e-4933.28ATP-binding cassette sub-family A member 1 [Source... [more]
zgc:1723027.885e-4632.74ATP-binding cassette sub-family A member 1 [Source... [more]
abca4a7.270e-4132.58retinal-specific ATP-binding cassette transporter ... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029537.12.337e-4790.51SMESG000029537.1[more]
SMESG000029534.15.044e-4666.26SMESG000029534.1[more]
SMESG000032861.16.986e-4857.60SMESG000032861.1[more]
SMESG000032891.11.795e-4757.79SMESG000032891.1[more]
SMESG000068605.11.617e-4256.58SMESG000068605.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019868 ID=SMED30019868|Name=ATP binding cassette subfamily A member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5301bp
TTTTTTATGAATTCGTTAATTTCCAATCAACTTCGTACATTATTATGGAA
AAACTTTCGACTAAAAAGGAGAAAATGGAAAATATTATTAATAGAATTAA
CGGTTCCTCTTATAATGGTTTTTATTCTATTTGCAGTAAGGTCTTCACAG
GCTAAATATAAAATGGATTTATGTTCGTTTAAAGAGAAAAGAATGGTCTC
GATGGGTCCAATTCCATTTCTAACAGATTTTTTATGCACTTTCAATACAA
GTTGTTATGATCAAACGCAAATAAATTGGTTAGGGACTAATTTGAACGAA
TTTCATGTATTTATAGGTAATATTACTGAAATTTACAACAGTTTACCAAG
TGGGGCTCTAAATGTCCCTAAATTCATGAAATGGATTACATCGAATCCAA
ATGAATTTATTCGCCTTCAGAATAGTTTTTCATACATTTCTAAACGAATA
GTTCCTTTAATTTCTACTGTTAATAAAGTCATGTCGGAAAATGAAACAAC
AATTGAAAGCGGTTATAATGAACTTGGTGAAATTATATGCGGTTCGCCTG
AAAATGATTTTAAACTATTTATGCGTAATTTTATCAAAAATCAAAGAAGA
AAAAGATCACTTTTAACTTGCCAATTAATATTTCAATCTTTCTTTCAAAA
TAGCATTGTAAAATTTGAAATGTATAATATGCTGGCTCCTTTGATTTTCG
GGAAAGTATTTTATTTTCCAAATGTGTTAATTATTCGACAAATTATTGAA
AAGGCTAACTTAACCTTTAAAATTCTTGACAATTTACGATTGGCTTCAGT
TGAATGGAGATTACATTTTCAAACCTTTTTATTGGATTATATTTCCAACA
ATGTTTTCATCAATGACGTGAAAAAGTTTTGCAAAGCATATTATTCAGCA
AATCCAAAGATATGTGACGCTGTTAACACTTTATTTAATATTACCAATGT
CAAATCATATATTGATGGTGTTTCGAAATTGTTTTCATGGATTGAGAGAG
GATTGAACTGTACCGAATTGGATAGATTTATTCCATTGGATTCATTAAAG
GACATTGATAAACTAACCAATCAATCTTTCAGAAATTTTCTGGCTGTGAT
TATTTTCAATGAAACATTTCAATATCTTACTCCTAAAAATACGACATTTT
TAAGTTATCAAATTCGCATACCACTCAGTCGAATTGATTCAACGTACAAA
TTCAAAGTTCTGGATAGATTTTGGACACCTTATCCAAGACGAAACACGTT
TACGGATTTTAAATATGTTTTAAGTGGTTTTATTTTTCTTCAAGAAGCGA
TTGATCAGGCGTTTATTGAGTTGGTAACAAATAATGAATCTATTGAAGTT
GGCTCAAGTATGCATATAATGCCGTATCCGTGTTATTTAATTGACAAATT
TCTTCAAAGATTAGCTAATTTGTTACCCTTTTTATTAGTAATGGCATGGG
GCCCCTCGGTTACTGTGTTAATTAAAAGCATTGTATATGAAAAAGAAAGC
CGACTGAAGGAATACATGAAAGTAATGGGTTTAAATAATTTCGTTCATTG
GGTTAGTTGGTTCATATCAACAATTGTTGTATTGATCATTCCTGTTGTGA
TAATGTCTGTGACTCTACGACTCAGTAAGATAACTGCCATGTCCTCTTTA
GCAGTTGTTTTTGCTGTCATATTTTTTTATGTCATTTCCTTTATATGTCA
AACATTCATGGTCAGTGTTTTCTTCAGTAAAGCCAATGTTGCAAGTGTTT
CGGGTGGAATACTTTATTTCACTTTTTATATGGTTTTTGTTGTTTTTATC
AAACTAGAAGGTGAATTGAGTTTAACCATGTACTATTCTTGTGGACTTTT
ATCTCAAGTGGCATTTAGTAATGCTGTAAAATTCATGATTTATTGGGAAC
AACTGTACGAAGGCGTACAATTTTCTAATCTTTTTCAAAATCCAGGTGAA
AGTCTTCCTTTTGGTGTAGGTCATTGTATCATTTTAATGATAATAGATAG
CTTCATATATCTGTTAATAACATGGTATGTTGAAGCAGTTTTTCCCGGCC
AGTATGGGGTTGCTAAGCCATGGAACTTTCTTTGTGCAAGGAGTTATTGG
GTATATAATATTAAAAGTTCCGAATCTATTCCTTTGATGCGTAATAACAA
TCAAAATTGTGAAATTAATCACCAAGCATTTGAATCGGAGCCTGAAAATT
TGAAATTGGGAATATCTATTCATAATTTGGTAAAGTTATACCCCAGTAAT
AAGATCCCTGTCATAAATAACTTAAATTTGAATTTTTATGAATCACAGAT
TACGGCATTTCTTGGTCATAATGGAGCCGGGAAAACAACCACTATTTCAA
TATTAACCGGGATTTTTTCTCCATCTTCCGGTACGGCTTACATATTAAAT
GAAGACATTCGAACTGAAATGGATAGCATTAGACAGAAAATAGGTTTATG
TCCTCAATATAATGTATTATTCGATAGTTTAACGGTAGAAGATCATATTT
ACTTTTACGGACTACTTAAAAGAATGGATAAAAATGAAATAGAATCTGTT
TTGCCAAGAATAATAAAAGATGTCGATTTAACTGAGAAAATTAATGCATT
ATCAATGCATCTTTCCGGTGGAATGAAACGAAAATTAAGCATTGCAATGG
CATTTATTGGGAATTCCCGAGTTGTGTTTTTGGATGAACCGACTGCTGGG
GTTGATCCATTTGCTAGACGGGGAATATGGGATTTATTGATCAAATACCG
TAGTCATGATAGAACAATAATTCTCACAACCCATCATATGGATGAAGCGG
ATTATCTCAGTGACAGGGTTGCTATTATTTCTCAAGGAAAACTTCAATGT
TGTGGGTCTTTGGTGTTTTTGAAAAGAAAATTTGGAGAAGGCTATTATCT
GAGTTTGTTAAAAAATCAGAATAATCACTCAAATAGCAATAGAAATGGTG
AAAATATCTTAAAATTCGTAAAAATCTATATAGCTGATGCTAGAATGATG
GAAGAATCAAGATTACAGTGGACAATTGTTTTGCCACAAAACGATATCAA
TAGCAGGAAATTTACTGAACTTTTTAAGAATCTTGATCAACACATGGCTG
AAATGAGTATAATTTCATATGGCTTATCTGATACTTCTCTTGAGGAGGTG
TTTTTAAAAGTCGCTGATGACCCTATGAATAAATTAATTAATAAAGAGAA
ATCCTATTATTCATATTATTGCAATATTTTAAAGATGAAGTTACGTATTA
ATGCTACGAAAACTGAGATTTTCTTAAATCAAAATCCAGATCAAAAGCAA
TCAAAGTTTCTAGATCAGTCAGATCATTTACTTAAAGGATTTCCTTTACT
TCAACAACAAATAATTGCGCTTCATATAAAGAGATACCACTATGCAAAGA
GAGATTTTAAAGGATTTCTTGCTGAGTTAATTTTACCGGTTTTGATGATT
TTATTCATTATATTATTTTTGAAAATAAGCATTTTACCAAAGAAACAAAT
TCCAATGCAGATTTCCCCATGGCTAATGATGTCCAAAATGGGTAAAGAAA
ATTTGAATACTTTCTATCGGAAAGAGAACATATCTCTTGGATTGATAAAT
AAGTTGGAAAGCGAATACCGATCCGATCTAGGAGAATCCGGGATAAGGTG
CATGAACCCATCAATCTATCGATTGGACAATTATCAGTGCTTTTATAGGA
ATGAAAACAACATGTGGTCACCCGCTTCTATTTTAGATATTCCAATGGTT
AGTCCAGAATGTGATTGCTCGAAAACTGGAAATCAGATCTGCAATGATCT
TCGCAGCGGTGGTCCACCGAATTCATACCGAATAATGACCAGTAGTGATA
AACTGAACAATTTAACCGGATATAATATATCGGATTATTTATTGAAAAAC
TTTCCTAAACTATCACGAAAACTTTATGGCGGTTTTCAATTTGTGCTACC
CAGCACTTTTGGATGGTCATCGAAACTAATAGGAGACTCTCCGTTCTGGG
AGGAATTACGCGATTTTGTGAATGCTTCCCAGGCTAATCATAATCAATCG
AATTTGAATTCATTGAAATTTATTGATTATCTTCAAAAAACCTTTAAGAT
ATACGGAATAAAGACCTCATTCACTCGAATATGGGCCAATTCCAAAGGCT
ACGTGTCAATGCCAGCATATGCAAATATTTTCAGCAATTTACTGCTGAGA
TCTAGATTGAATAAATCAGCAGTGAAATTTATCGATTATGGAATCTCAGT
GTCAAACTTCCCGATTGAAATGGAACAATCGACTAAATTTTTAGACCTAG
TCAATCAGATGATTCTCGAAATGTCATTGGCTATTTTCGTAATATTTGGA
CTATCTTTTATTCCGGCTAGTTTTGTGATATTTTTAGTCGAAGAAAGGGT
AAGTGGTTCCAAGCGGCAGCAATTCGTGTCGGGAATCAACCCCTACGTGT
ATTGGGTATCCAATTTCTTGTGGGACATCATGAAATACATCATTCCCATT
ATTATCATCATAATAATTTTTATTGCCTTTGATTATCAATCATATATCTG
CAGCAAAAATGCTCTTGCTTTCATTCTTCTTTTAATTTTCTACGGATTAG
CTATTATTCCCCATATGTATCCATTTAGCTTCTTCATTTCCACACCAAGC
ACCGCATTTGTGGTGTTAAATGCCTACAATTTATTAGTCGGCACAATTAC
AACGATTTCCACATTTATTTTAGATATTTTGGAAGTCAATTATGAATATT
TAAAAGAGATTAATGACATTTTGAAAAAGGTTTTCTTAATATTCCCCCAG
TTCAATCTCGGTAGAGGGATCATGGATTTATTTTTTAATTACTTTTACAA
TAGTAATTCGATAGTTAAACATGAATATAACGCTTTACAGTGGGATATTG
CCGGGGAGAAACTTTTTTCACTTTTCAGTTTGTCTATTGGATGGTGGATT
GTTTTAATAATCATTGAAAGTGGGATTGTAAATCGAATTATTTGCGGTAA
GTTGAAAAACTCGTATTTGAAAAGAATAGAAATCAGAAATACAGAAGACT
TTGATGTTAATTTAGAGAGAGAAAGAATGAGTTCAGACCAAAAATCTGAT
GATGTGTTAAGAGTCATTAATTTAACTAAAATCTACAATGTGTATTTAAA
ATTTAAAGACAATTGTGGTGAAAAAGGAAAAGATAACTATATTAAGAATA
AAGCCCGTGAAGTGGCTGTTAATAATCTGTGTTTTGGTGTTCGAGAAGGC
GAATGTTTCGGATTGCTCGGCGTGAATGGCGCGGGTAAAACAACGACTTT
T
back to top

protein sequence of SMED30019868-orf-1

>SMED30019868-orf-1 ID=SMED30019868-orf-1|Name=SMED30019868-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1767bp
FFMNSLISNQLRTLLWKNFRLKRRKWKILLIELTVPLIMVFILFAVRSSQ
AKYKMDLCSFKEKRMVSMGPIPFLTDFLCTFNTSCYDQTQINWLGTNLNE
FHVFIGNITEIYNSLPSGALNVPKFMKWITSNPNEFIRLQNSFSYISKRI
VPLISTVNKVMSENETTIESGYNELGEIICGSPENDFKLFMRNFIKNQRR
KRSLLTCQLIFQSFFQNSIVKFEMYNMLAPLIFGKVFYFPNVLIIRQIIE
KANLTFKILDNLRLASVEWRLHFQTFLLDYISNNVFINDVKKFCKAYYSA
NPKICDAVNTLFNITNVKSYIDGVSKLFSWIERGLNCTELDRFIPLDSLK
DIDKLTNQSFRNFLAVIIFNETFQYLTPKNTTFLSYQIRIPLSRIDSTYK
FKVLDRFWTPYPRRNTFTDFKYVLSGFIFLQEAIDQAFIELVTNNESIEV
GSSMHIMPYPCYLIDKFLQRLANLLPFLLVMAWGPSVTVLIKSIVYEKES
RLKEYMKVMGLNNFVHWVSWFISTIVVLIIPVVIMSVTLRLSKITAMSSL
AVVFAVIFFYVISFICQTFMVSVFFSKANVASVSGGILYFTFYMVFVVFI
KLEGELSLTMYYSCGLLSQVAFSNAVKFMIYWEQLYEGVQFSNLFQNPGE
SLPFGVGHCIILMIIDSFIYLLITWYVEAVFPGQYGVAKPWNFLCARSYW
VYNIKSSESIPLMRNNNQNCEINHQAFESEPENLKLGISIHNLVKLYPSN
KIPVINNLNLNFYESQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILN
EDIRTEMDSIRQKIGLCPQYNVLFDSLTVEDHIYFYGLLKRMDKNEIESV
LPRIIKDVDLTEKINALSMHLSGGMKRKLSIAMAFIGNSRVVFLDEPTAG
VDPFARRGIWDLLIKYRSHDRTIILTTHHMDEADYLSDRVAIISQGKLQC
CGSLVFLKRKFGEGYYLSLLKNQNNHSNSNRNGENILKFVKIYIADARMM
EESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEV
FLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQ
SKFLDQSDHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAELILPVLMI
LFIILFLKISILPKKQIPMQISPWLMMSKMGKENLNTFYRKENISLGLIN
KLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMV
SPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKN
FPKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQS
NLNSLKFIDYLQKTFKIYGIKTSFTRIWANSKGYVSMPAYANIFSNLLLR
SRLNKSAVKFIDYGISVSNFPIEMEQSTKFLDLVNQMILEMSLAIFVIFG
LSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPI
IIIIIIFIAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPS
TAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQ
FNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWI
VLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSD
DVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREG
ECFGLLGVNGAGKTTTF
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000240body wall musculature
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR026082ABCA
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR003439ABC_transporter-like
IPR017871ABC_transporter_CS
IPR033113PLipase_A2_His_AS
Vocabulary: molecular function
TermDefinition
GO:0016887ATPase activity
GO:0005524ATP binding
GO:0051117ATPase binding
GO:0090554phosphatidylcholine-translocating ATPase activity
GO:0090556phosphatidylserine-translocating ATPase activity
GO:0000166nucleotide binding
GO:0005102signaling receptor binding
GO:0005215transporter activity
GO:0005515protein binding
GO:0005543phospholipid binding
GO:0005548phospholipid transporter activity
GO:0008509anion transmembrane transporter activity
GO:0015485cholesterol binding
GO:0017127cholesterol transporter activity
GO:0019905syntaxin binding
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0031267small GTPase binding
GO:0034185apolipoprotein binding
GO:0034186apolipoprotein A-I binding
GO:0034188apolipoprotein A-I receptor activity
Vocabulary: biological process
TermDefinition
GO:0043691reverse cholesterol transport
GO:0045332phospholipid translocation
GO:0050702interleukin-1 beta secretion
GO:0055085transmembrane transport
GO:0055091phospholipid homeostasis
GO:0055098response to low-density lipoprotein particle
GO:0060155platelet dense granule organization
GO:0071222cellular response to lipopolysaccharide
GO:0071300cellular response to retinoic acid
GO:0071397cellular response to cholesterol
GO:0090107regulation of high-density lipoprotein particle assembly
GO:0098656anion transmembrane transport
GO:0002790peptide secretion
GO:0006497protein lipidation
GO:0006629lipid metabolic process
GO:0006810transport
GO:0006911phagocytosis, engulfment
GO:0007040lysosome organization
GO:0007186G-protein coupled receptor signaling pathway
GO:0007584response to nutrient
GO:0008202steroid metabolic process
GO:0008203cholesterol metabolic process
GO:0010745negative regulation of macrophage derived foam cell differentiation
GO:0010875positive regulation of cholesterol efflux
GO:0010887negative regulation of cholesterol storage
GO:0015914phospholipid transport
GO:0015917aminophospholipid transport
GO:0016197endosomal transport
GO:0034380high-density lipoprotein particle assembly
GO:0034616response to laminar fluid shear stress
GO:0038027apolipoprotein A-I-mediated signaling pathway
GO:0042157lipoprotein metabolic process
GO:0042158lipoprotein biosynthetic process
GO:0042493response to drug
GO:0042632cholesterol homeostasis
GO:0030301cholesterol transport
GO:0030819positive regulation of cAMP biosynthetic process
GO:0032367intracellular cholesterol transport
GO:0032489regulation of Cdc42 protein signal transduction
GO:0033344cholesterol efflux
GO:0033700phospholipid efflux
Vocabulary: cellular component
TermDefinition
GO:0045121membrane raft
GO:0045335phagocytic vesicle
GO:0048471perinuclear region of cytoplasm
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0009897external side of plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0034364high-density lipoprotein particle
GO:0043231intracellular membrane-bounded organelle
GO:0030139endocytic vesicle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 764..947
e-value: 7.4E-9
score: 45.4
NoneNo IPR availablePFAMPF12698ABC2_membrane_3coord: 434..676
e-value: 4.9E-19
score: 68.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 728..977
e-value: 5.4E-63
score: 214.7
NoneNo IPR availablePANTHERPTHR19229:SF216ATP-BINDING CASSETTE, SUB-FAMILY A (ABC1), MEMBER 1Acoord: 7..76
NoneNo IPR availablePANTHERPTHR19229:SF216ATP-BINDING CASSETTE, SUB-FAMILY A (ABC1), MEMBER 1Acoord: 985..1174
NoneNo IPR availablePANTHERPTHR19229:SF216ATP-BINDING CASSETTE, SUB-FAMILY A (ABC1), MEMBER 1Acoord: 208..983
NoneNo IPR availableCDDcd03263ABC_subfamily_Acoord: 738..958
e-value: 2.10543E-104
score: 327.154
NoneNo IPR availableTMHMMTMhelixcoord: 1138..1157
NoneNo IPR availableTMHMMTMhelixcoord: 544..566
NoneNo IPR availableTMHMMTMhelixcoord: 517..539
NoneNo IPR availableTMHMMTMhelixcoord: 578..600
NoneNo IPR availableTMHMMTMhelixcoord: 28..46
NoneNo IPR availableTMHMMTMhelixcoord: 474..496
NoneNo IPR availableTMHMMTMhelixcoord: 654..676
NoneNo IPR availablePFAMPF12698ABC2_membrane_3coord: 77..376
e-value: 8.7E-35
score: 120.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 391..491
e-value: 3.4E-8
score: 35.0
NoneNo IPR availablePANTHERPTHR19229:SF185coord: 98..491
NoneNo IPR availableTMHMMTMhelixcoord: 248..270
NoneNo IPR availableTMHMMTMhelixcoord: 319..341
NoneNo IPR availableTMHMMTMhelixcoord: 277..299
NoneNo IPR availableTMHMMTMhelixcoord: 211..233
NoneNo IPR availableTMHMMTMhelixcoord: 362..384
NoneNo IPR availableTMHMMTMhelixcoord: 165..187
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 756..899
e-value: 2.3E-28
score: 99.4
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 738..970
score: 19.901
IPR026082ABC transporter APANTHERPTHR19229ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A ABCAcoord: 985..1174
IPR026082ABC transporter APANTHERPTHR19229ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A ABCAcoord: 208..983
IPR026082ABC transporter APANTHERPTHR19229ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A ABCAcoord: 7..76
IPR026082ABC transporter APANTHERPTHR19229ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A ABCAcoord: 98..491
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 871..885
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 738..954
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 461..491