Neur_chan_LBD domain-containing protein

Overview
NameNeur_chan_LBD domain-containing protein
Smed IDSMED30019864
Length (bp)2224
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neur_chan_LBD domain-containing protein (SMED30019864) t-SNE clustered cells

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30019864) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neur_chan_LBD domain-containing protein (SMED30019864) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30019864) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019864

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30019864SMESG000008589.1 Contig2886newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30019864SMESG000058958.1 Contig2886newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30019864SMESG000008589.1 dd_Smed_v4_10171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019864SMESG000008589.1 dd_Smed_v4_10171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019864SMESG000008589.1 dd_Smed_v4_10171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019864SMESG000008589.1 dd_Smed_v4_10171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019864SMESG000008589.1 dd_Smed_v4_10171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019864SMESG000008589.1 dd_Smed_v4_10171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019864SMESG000008589.1 Contig52152newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019864SMESG000008589.1 Contig52152uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019864SMESG000008589.1 Contig31485newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019864SMESG000008589.1 Contig31485uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30019864SMESG000008589.1 OX_Smed_1.0.07089ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30019864SMESG000008589.1 dd_Smed_v4_10171_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 73.9442 bits (180), Expect = 4.891e-13
Identity = 74/298 (24.83%), Postives = 137/298 (45.97%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-----TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     VAV + I    I  ID + E+   Y    + Q  WR+ +L  +    N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ +     TT+  D E     D   ++ +   T ++  ++ + ++  ITK+++      S  S+P LS++ +  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +
Sbjct:   48 DIRLRPDFGGPPVAVGMNI---DIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTD--DIEFYWRGDDNAVTGV---TKIELPQFSIVDYKLITKKVVF-----STGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYI 329          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 73.9442 bits (180), Expect = 4.891e-13
Identity = 74/298 (24.83%), Postives = 137/298 (45.97%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-----TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     VAV + I    I  ID + E+   Y    + Q  WR+ +L  +    N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ +     TT+  D E     D   ++ +   T ++  ++ + ++  ITK+++      S  S+P LS++ +  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +
Sbjct:   48 DIRLRPDFGGPPVAVGMNI---DIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTD--DIEFYWRGDDNAVTGV---TKIELPQFSIVDYKLITKKVVF-----STGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYI 329          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 73.559 bits (179), Expect = 5.563e-13
Identity = 74/298 (24.83%), Postives = 137/298 (45.97%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-----TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     VAV + I    I  ID + E+   Y    + Q  WR+ +L  +    N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ +     TT+  D E     D   ++ +   T ++  ++ + ++  ITK+++      S  S+P LS++ +  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +
Sbjct:   48 DIRLRPDFGGPPVAVGMNI---DIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTD--DIEFYWRGDDNAVTGV---TKIELPQFSIVDYKLITKKVVF-----STGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYI 329          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 73.559 bits (179), Expect = 5.563e-13
Identity = 74/298 (24.83%), Postives = 137/298 (45.97%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-----TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     VAV + I    I  ID + E+   Y    + Q  WR+ +L  +    N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ +     TT+  D E     D   ++ +   T ++  ++ + ++  ITK+++      S  S+P LS++ +  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +
Sbjct:   48 DIRLRPDFGGPPVAVGMNI---DIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTD--DIEFYWRGDDNAVTGV---TKIELPQFSIVDYKLITKKVVF-----STGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYI 329          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRB3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:HGNC Symbol;Acc:HGNC:4083])

HSP 1 Score: 73.1738 bits (178), Expect = 8.158e-13
Identity = 88/394 (22.34%), Postives = 166/394 (42.13%), Query Frame = 1
Query:  649 RGKTRRRMSTYGNKSQGRGENHSVIGNDNLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLVPHVSKVTNGPXXXXXXXXXXXXXXXXKEFQKRLEEKSPFMKSVINTVNNDNDKKDEVQEDETGERVLTPGEI 1785
            RG   R ++  GN S  +     ++   +++LR D     V V + I    I  ID + E+   Y    + Q  WR+ +L       N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ + +      +I+      + +   ++  ++  ++ + EH  +++ ++      +  ++P LS++ R  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +        GP                 + QK+L EK+   K       ND  K +  + D  G  +LT  E+
Sbjct:   21 RGSEPRSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNI---DIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER-IELPQFSIVEHRLVSRNVVF-----ATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYI----FFGRGP-----------------QRQKKLAEKTAKAK-------NDRSKSESNRVDAHGNILLTSLEV 374          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: lgc-46 (Probable ligand-gated ion channel 46 [Source:UniProtKB/Swiss-Prot;Acc:Q95Y52])

HSP 1 Score: 57.7658 bits (138), Expect = 2.230e-8
Identity = 58/274 (21.17%), Postives = 127/274 (46.35%), Query Frame = 1
Query:  739 KLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLD------GHTNEELATTDMDKYWSP-LLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYV-ITQSLPKISYLTYMDKYVLMSLA-ILC 1533
            K+   +V VE+ +   +I  I  +   +  D +I   W +P L+         N  L +  ++K W+P   +I++  ++  ++ +           TV    R+K      ++L  FP D  ++T ++T E  +   D +  + + S   +Q   D+ E   +E V+I K    +E+ +       L+++    RR G++    +L  ++   +S+ +F++  +    R  L    +L ++TF++  I ++LP++SY+  +D ++L  +  + C
Sbjct:   81 KIPGGQVDVEVEVWVQEITTISDITSDFQLDIYIYETWYDPALNYAFMNPCKYNLSLNSVLLEKLWTPNSCFINSKTADIHKSPFPNIFLMIYANGTVWTNYRLKLQGPCIMDLTKFPFD--NVTCSLTFESFNYNTDEV--KMDWSVNGVQKMRDKMELADYELVDIHKIRTTEEYPAGYWHE--LTMSFEFKRRAGWYILQAYLPTYLTICISWISFALGSKAIPARTMLGVNSLL-AMTFQFGNIIRNLPRVSYVKAIDVWMLSCMTFVFC 347          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: gab-1 (Gamma-aminobutyric acid receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:O18276])

HSP 1 Score: 55.8398 bits (133), Expect = 9.653e-8
Identity = 46/179 (25.70%), Postives = 83/179 (46.37%), Query Frame = 1
Query: 1024 RIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACV 1560
            R+      ++ L +FPLD Q+ T+ + +    +   L+     ++   ++     Q      H E    I+    S++  S+  LS+  +  R  GYF +  +L   +I  LS+ +F ++ E    R+ L  T VLT  T    + QSLP+ISY+  +D Y++M    +    + +A V
Sbjct:  173 RLTSTLSCSMNLRNFPLDSQNCTVEIESYGYTTSEVLMKWNYPLAVHGVEQADVPQFTITGFHTE--DSIV----STATGSYQRLSLVFQLRRSVGYFIFQTYLPCVLIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRQSLPRISYVKSIDIYLVMCFVFVFAALLEYAAV 345          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: lgc-48 (Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL;Acc:P91985])

HSP 1 Score: 54.299 bits (129), Expect = 2.018e-7
Identity = 58/274 (21.17%), Postives = 117/274 (42.70%), Query Frame = 1
Query:  745 RKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKL------DGHTNEELATTDMDKYWSP-LLYIDNILSETKEAQW----LTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAIL 1530
            R++ + V +     +I  I  +   +  + FI   W +P L          N  L    + K W+P   ++++  +E  E+ +    LT   N ++ V    R R+KG     ++L DFP+D Q   +   +    + E+ L  +        +Q       W      +IT  +I +++ + +     L VT    RR  +++   +L  F    +S+  FS+ P+    R  +    +L+ +     I ++LP++SY+  +D ++L S+  +
Sbjct:   48 RENGITVSVEFWIQEINSISEMTNDFELELFINEMWTDPSLRFPHLGACKANLTLDQQTLTKLWTPNTCFVNSKFAEIYESSFQNVFLTLFDNGTVWVNY--RVRVKGA--CNMDLVDFPMDTQSCRLNYQSFTYNNEEVRLQWNSQRSPVFALQEIRIADFWL----KDITPAVIKRDYPAGLWDE--LVVTFVFERRYMWYFLQAYLPTFFSIFISWIAFSLGPQAITPRTMIGVNALLSMIFHFGSIMKNLPRVSYIKAIDVWMLSSMTFV 311          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: acc-2 (Acetylcholine-gated chloride channel subunit acc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18812])

HSP 1 Score: 52.373 bits (124), Expect = 7.979e-7
Identity = 65/280 (23.21%), Postives = 126/280 (45.00%), Query Frame = 1
Query:  745 RKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHT------NEELATTDMDKYWSPLLYIDNILSETKEAQ---------WLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPD-SEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLA-ILC 1533
            +++ + V + I    I  ID L   +  D +I   W +P L+  T      N  L    +D+ W+P    ++    +K AQ         +L    N +  V V  R R+KG    +L+L++FPLD+Q  ++   +   +  E+++     E    N+   +   ++ L E ++  +R   + + + M     L VT    RR  +++   +L  ++   +S+ +FS+       R  L    +L  V     I ++LP++SY+  +D ++L+S+  I C
Sbjct:   70 QEEGMTVVVEIWIQAITSIDELTNDFDMDIYITETWLDPALNFQTMTPCKGNLSLNHQVLDRLWTP----NSCFINSKVAQIHNSPFRSVFLMLFPNGT--VMVNYRVRVKGPC--SLDLSNFPLDLQKCSLIYESFNYNRQEVEMRWSDAEHPVFNLSKIM-LPDFDLFE-IQTERR--QEPYPAGMWDE--LHVTIIFERRFIWYFMQAYLPTYLTIFISWISFSLGSRAIPARTMLGVNSLLAIVFSFGNIMRNLPRVSYIKGIDVWMLVSMTFIFC 335          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: CG8916 (gene:FBgn0030707 transcript:FBtr0301233)

HSP 1 Score: 58.9214 bits (141), Expect = 1.280e-8
Identity = 68/285 (23.86%), Postives = 110/285 (38.60%), Query Frame = 1
Query:  763 VELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQ-WLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQ---EWKLHEH-VEITKRIILQEFSSSMKSH------------PCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSI 1545
            V+  I+   +G +  L   Y  D + +  WR+ +L       +  L+   +DK W P  Y  N     K +Q  +  V N+ L +     ++   R+       +EL +FP+D Q   +                      I    +++QQ   EWK  +  V     + L +F      H              L V     R  GYF   V++   +I  LS+ +F +  E    R+ L  T VLT  T        LPK+ Y T +D ++LMS  + CI ++
Sbjct:   33 VQTNILIRSMGPVSELDMDYSMDCYFRQYWRDKRLSFKGPIKSLSLSIKMLDKIWRPDTYFYN----GKHSQIHMITVPNKLLRLDQNGGILYSMRLTIKATCPMELQNFPMDRQSCPLV---------------------IGSYGYINQQLIYEWKNQDDAVSFVPGMTLNQFDLISMMHRNFTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSF-LYCIATL 291          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: CG8916 (gene:FBgn0030707 transcript:FBtr0301232)

HSP 1 Score: 58.9214 bits (141), Expect = 1.324e-8
Identity = 68/285 (23.86%), Postives = 110/285 (38.60%), Query Frame = 1
Query:  763 VELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQ-WLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQ---EWKLHE-HVEITKRIILQEFSSSMKSH------------PCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSI 1545
            V+  I+   +G +  L   Y  D + +  WR+ +L       +  L+   +DK W P  Y  N     K +Q  +  V N+ L +     ++   R+       +EL +FP+D Q   +                      I    +++QQ   EWK  +  V     + L +F      H              L V     R  GYF   V++   +I  LS+ +F +  E    R+ L  T VLT  T        LPK+ Y T +D ++LMS  + CI ++
Sbjct:  135 VQTNILIRSMGPVSELDMDYSMDCYFRQYWRDKRLSFKGPIKSLSLSIKMLDKIWRPDTYFYN----GKHSQIHMITVPNKLLRLDQNGGILYSMRLTIKATCPMELQNFPMDRQSCPLV---------------------IGSYGYINQQLIYEWKNQDDAVSFVPGMTLNQFDLISMMHRNFTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSF-LYCIATL 393          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: CG6927 (gene:FBgn0029733 transcript:FBtr0070721)

HSP 1 Score: 55.4546 bits (132), Expect = 1.409e-7
Identity = 56/212 (26.42%), Postives = 99/212 (46.70%), Query Frame = 1
Query:  907 DKYWSPLLYIDN-----ILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPD-SEIDLIPDQ----TEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVL 1512
            +  W P +++ N     IL  T E   LT+++ +    TVI   RIK      L L  FP D Q  +  + +   + SE+ L  +Q    T   A+++  FV Q+ W  +E V I   +      +   ++  LS T    R  G++  + FL   +I  +S+ +F +  ++A  R+ L  + +LT +T      ++LPK+SY+   + + L
Sbjct:  124 NSLWMPHIFLANERDSSILGLT-EKDILTSISPDG---TVIVSNRIKATLYCWLNLKKFPFDEQHCSTVLESWMYNTSELVLHWEQKRPITYDGALHLTEFVLQRSWS-NETV-INADLSDLRHGAFAGNYSSLSFTVHLTRVVGFYLMDYFLPSMLIVAISWVSFWLQADQAPPRITLGTSTLLTFITLASAQGKTLPKVSYIKVSEVWFL 329          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: HisCl1 (gene:FBgn0037950 transcript:FBtr0301826)

HSP 1 Score: 54.299 bits (129), Expect = 2.766e-7
Identity = 58/266 (21.80%), Postives = 109/266 (40.98%), Query Frame = 1
Query:  739 KLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTN--EELATTDMD---KYWSPLLYIDNILSETKEAQWLTAVANESL----EVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            KL      V   +  L +  I+     Y  D F+   WR+P+L    N  E+    D+D     W P  +  N    T       ++ N  L    + T++   ++  V    ++   +P D Q  ++ +     +S +  I + T+   +N +  + Q +   +   + T       F+       CL++     RR GY  ++ ++   +I  +S+ +F + PE    R+ L  T +LT  T      QSLP +SY+  +D ++
Sbjct:   74 KLLGQPTVVYFHVTVLSLDSINEESMTYVTDIFLAQSWRDPRLRLPENMSEQYRILDVDWLHSIWRPDCFFKNAKKVTFHEM---SIPNHYLWLYHDKTLLYMSKLTLVLSCAMKFESYPHDTQICSMMI-----ESYLVFIWNMTDPLVVNTEIELPQLDISNNYTTDCTIEYSTGNFT-------CLAIVFNLRRRLGYHLFHTYIPSALIVVMSWISFWIKPEAIPARVTLGVTSLLTLATQNTQSQQSLPPVSYVKAIDVWM 324          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: HisCl1 (gene:FBgn0037950 transcript:FBtr0082471)

HSP 1 Score: 53.1434 bits (126), Expect = 6.592e-7
Identity = 57/267 (21.35%), Postives = 109/267 (40.82%), Query Frame = 1
Query:  739 KLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTN--EELATTDMD---KYWSPLLYIDNILSETKEAQWLTAVANESL----EVTVIERRRIKGVFLETLELNDFPLDVQDLTITM-TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            KL      V   +  L +  I+     Y  D F+   WR+P+L    N  E+    D+D     W P  +  N    T       ++ N  L    + T++   ++  V    ++   +P D Q  ++ + +      ++  I + T+   +N +  + Q +   +   + T       F+       CL++     RR GY  ++ ++   +I  +S+ +F + PE    R+ L  T +LT  T      QSLP +SY+  +D ++
Sbjct:   74 KLLGQPTVVYFHVTVLSLDSINEESMTYVTDIFLAQSWRDPRLRLPENMSEQYRILDVDWLHSIWRPDCFFKNAKKVTFHEM---SIPNHYLWLYHDKTLLYMSKLTLVLSCAMKFESYPHDTQICSMMIESLSHTVEDLVFIWNMTDPLVVNTEIELPQLDISNNYTTDCTIEYSTGNFT-------CLAIVFNLRRRLGYHLFHTYIPSALIVVMSWISFWIKPEAIPARVTLGVTSLLTLATQNTQSQQSLPPVSYVKAIDVWM 330          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrb4 (gamma-aminobutyric acid type A receptor beta4 subunit [Source:ZFIN;Acc:ZDB-GENE-070424-211])

HSP 1 Score: 74.3294 bits (181), Expect = 2.353e-13
Identity = 69/272 (25.37%), Postives = 126/272 (46.32%), Query Frame = 1
Query:  784 LKIGEIDTLKEL---YHADAFIQAKWREPKL---DGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            + I  ID++ E+   Y    + Q  WR+ +L   +   N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ + +    ++  +   Q   +A+   T VD+ E      VE+  R++ +E   +  S+P LS++ R  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  V
Sbjct:   68 INIASIDSISEVNMDYTITMYFQQSWRDKRLAYAEMALNLTLDNRVADQLWLPDTYF---LNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGDNAV---TGVDKLELPQFSIVEL--RLVSREVRFTTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYV 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:ZFIN;Acc:ZDB-GENE-141215-66])

HSP 1 Score: 73.559 bits (179), Expect = 3.122e-13
Identity = 69/274 (25.18%), Postives = 124/274 (45.26%), Query Frame = 1
Query:  724 GNDNLKLRKD----KVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTD---MDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            G DN KLR D       +E  +    IG +D +   Y  D F    W + +L  +++ +L   +   + K W P  +  N  S   +A W+T   N  L +     V+   R+       L+L++FP+D     +  ++   P +EI     + +  ++ +    DQ+ W+L++   +  R      ++    +  +++    +RR GYF    ++   MI  LS+ +F ++ +    R  L  T VLT  T   +  +SLPK+SY+T MD +V
Sbjct:   70 GYDN-KLRPDIGVRPTVIETAVYVNSIGPVDPINMEYTIDIFFAQTWYDSRLKFNSSMKLLMLNSNMVGKIWIPDTFFRN--SRKSDAHWITT-PNRLLRLWSNGRVMYTLRLTINAECYLKLHNFPMDEHSCPLEFSSYGYPKNEIQY---RWQRRSVEV---ADQRYWRLYQFAFVGLRNSSDVANTQSGEYVVMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYVTAMDLFV 333          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrb4 (gamma-aminobutyric acid type A receptor beta4 subunit [Source:ZFIN;Acc:ZDB-GENE-070424-211])

HSP 1 Score: 73.559 bits (179), Expect = 3.187e-13
Identity = 69/272 (25.37%), Postives = 126/272 (46.32%), Query Frame = 1
Query:  784 LKIGEIDTLKEL---YHADAFIQAKWREPKL---DGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            + I  ID++ E+   Y    + Q  WR+ +L   +   N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ + +    ++  +   Q   +A+   T VD+ E      VE+  R++ +E   +  S+P LS++ R  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  V
Sbjct:   68 INIASIDSISEVNMDYTITMYFQQSWRDKRLAYAEMALNLTLDNRVADQLWLPDTYF---LNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGDNAV---TGVDKLELPQFSIVEL--RLVSREVRFTTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYV 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:ZFIN;Acc:ZDB-GENE-141215-66])

HSP 1 Score: 73.1738 bits (178), Expect = 4.139e-13
Identity = 69/274 (25.18%), Postives = 124/274 (45.26%), Query Frame = 1
Query:  724 GNDNLKLRKD----KVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTD---MDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            G DN KLR D       +E  +    IG +D +   Y  D F    W + +L  +++ +L   +   + K W P  +  N  S   +A W+T   N  L +     V+   R+       L+L++FP+D     +  ++   P +EI     + +  ++ +    DQ+ W+L++   +  R      ++    +  +++    +RR GYF    ++   MI  LS+ +F ++ +    R  L  T VLT  T   +  +SLPK+SY+T MD +V
Sbjct:   70 GYDN-KLRPDIGVRPTVIETAVYVNSIGPVDPINMEYTIDIFFAQTWYDSRLKFNSSMKLLMLNSNMVGKIWIPDTFFRN--SRKSDAHWITT-PNRLLRLWSNGRVMYTLRLTINAECYLKLHNFPMDEHSCPLEFSSYGYPKNEIQY---RWQRRSVEV---ADQRYWRLYQFAFVGLRNSSDVANTQSGEYVVMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYVTAMDLFV 333          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:ZFIN;Acc:ZDB-GENE-091118-65])

HSP 1 Score: 68.5514 bits (166), Expect = 8.423e-12
Identity = 70/291 (24.05%), Postives = 129/291 (44.33%), Query Frame = 1
Query:  724 GNDNLKLRKD----KVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEE---LATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACV 1560
            G DN KLR D       +   +    IG ++ +   Y  D F    W + +L  ++  +   L +  + K W P  +  N  S+  +A W+T   N  L +     ++   R+       L+LN+FP+D     +  ++   P  EI     + + S++ +    D + W+L++   +  R   +   +    +  L+V    +RR GYF    ++   +I  LS+ +F ++ +    R  L  T VLT  T   +  +SLPK+SY+T MD +V      +C + ++ A +
Sbjct:   76 GYDN-KLRPDIGVKPTVIHTDMFVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTMKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITT-PNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPKEEIVY---KWKRSSVEVG---DIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-----SVCFIFVFAALI 351          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GABRG2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:NCBI gene;Acc:779514])

HSP 1 Score: 73.9442 bits (180), Expect = 3.961e-13
Identity = 70/275 (25.45%), Postives = 127/275 (46.18%), Query Frame = 1
Query:  724 GNDNLKLRKDKVAVELRIVFL-----KIGEIDTLKELYHADAFIQAKWREPKLDGHTNEE---LATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            G DN KLR D + V+  ++        IG ++ +   Y  D F    W + +L  ++  +   L +  + K W P  +  N  S+  +A W+T   N  L +     V+   R+       L+L++FP+D     +  ++   P  EI     Q + S++ +    D + W+L++   +  R   +E  ++   +  ++V    +RR GYF    ++   +I  LS+ +F ++ +    R  L  T VLT  T   +  +SLPK+SY+T MD +V
Sbjct:  106 GYDN-KLRPD-IGVKPTVIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITT-PNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPKEEIIY---QWKRSSVEVG---DVRSWRLYQFSFVGLRNTTEEVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 369          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GABRG2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:NCBI gene;Acc:779514])

HSP 1 Score: 73.559 bits (179), Expect = 4.787e-13
Identity = 70/275 (25.45%), Postives = 127/275 (46.18%), Query Frame = 1
Query:  724 GNDNLKLRKDKVAVELRIVFL-----KIGEIDTLKELYHADAFIQAKWREPKLDGHTNEE---LATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            G DN KLR D + V+  ++        IG ++ +   Y  D F    W + +L  ++  +   L +  + K W P  +  N  S+  +A W+T   N  L +     V+   R+       L+L++FP+D     +  ++   P  EI     Q + S++ +    D + W+L++   +  R   +E  ++   +  ++V    +RR GYF    ++   +I  LS+ +F ++ +    R  L  T VLT  T   +  +SLPK+SY+T MD +V
Sbjct:  106 GYDN-KLRPD-IGVKPTVIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITT-PNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPKEEIIY---QWKRSSVEVG---DVRSWRLYQFSFVGLRNTTEEVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 369          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: dusp5 (dual specificity phosphatase 5 [Source:Xenbase;Acc:XB-GENE-957572])

HSP 1 Score: 73.1738 bits (178), Expect = 6.192e-13
Identity = 93/388 (23.97%), Postives = 167/388 (43.04%), Query Frame = 1
Query:  682 GNKSQGRGENHSVIGNDNLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGHTNEELATT----DMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-----TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLVPHVSKVTNGPXXXXXXXXXXXXXXXXKEFQKRLEEKSPFMKSVINTVNNDNDKKDEVQEDETGERVLTPGEI 1785
            GN S  +     ++   +++LR D     VAV + I    I  ID + E+   Y    + Q  WR+ +L  +T   L  T      D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ +     TT+  D E   +     ++ +     ++  ++ + +H  ++K ++      +  S+P LS++ +  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +        GP                 + QK+L EKS   KS     N D+ K +  + D  G  +LT  EI
Sbjct:   32 GNMSFVKETVDKLLKGYDIRLRPDFGGSPVAVGMNI---DIASIDMVSEVNMDYTLTMYFQQYWRDKRL-AYTGIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTD--DIEFYWLGGDNAVTGVE---RIELPQFSIMDHKLVSKNVVF-----ATGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYI----FFGRGP-----------------QMQKKLAEKSA--KS-----NKDHSKFESNRVDAHGNILLTTLEI 374          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000020814.1 (gamma-aminobutyric acid type A receptor theta subunit [Source:NCBI gene;Acc:100496398])

HSP 1 Score: 70.4774 bits (171), Expect = 4.044e-12
Identity = 72/309 (23.30%), Postives = 138/309 (44.66%), Query Frame = 1
Query:  682 GNKSQGRGENHSVIGNDNLKLR----KDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHT----NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            GN S  +     ++   +++LR     D V+V + I    I +I  +   Y    + Q  WR+ +L  +T    N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ + +      +I       E +A+   + ++  ++ + E   ++K ++      +  S+P LS++ R  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  V
Sbjct:   20 GNISVVKKTVDKLLKGYDIRLRPDFGGDPVSVGMSIHISSIDQISEVNMDYTITMYFQQSWRDKRL-AYTALPLNLTLDNRVADQLWLPDTYF---LNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDQQNCTLEIESYGYTIDDIKFFWQGGEEAAVTGVSALELPQFTIIETRLVSKNVVF-----TTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYV 319          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000020832.1 (gamma-aminobutyric acid type A receptor theta subunit [Source:NCBI gene;Acc:100496398])

HSP 1 Score: 70.4774 bits (171), Expect = 5.381e-12
Identity = 72/309 (23.30%), Postives = 138/309 (44.66%), Query Frame = 1
Query:  682 GNKSQGRGENHSVIGNDNLKLR----KDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHT----NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            GN S  +     ++   +++LR     D V+V + I    I +I  +   Y    + Q  WR+ +L  +T    N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ + +      +I       E +A+   + ++  ++ + E   ++K ++      +  S+P LS++ R  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  V
Sbjct:   37 GNISVVKKTVDKLLKGYDIRLRPDFGGDPVSVGMSIHISSIDQISEVNMDYTITMYFQQSWRDKRL-AYTALPLNLTLDNRVADQLWLPDTYF---LNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDQQNCTLEIESYGYTIDDIKFFWQGGEEAAVTGVSALELPQFTIIETRLVSKNVVF-----TTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYV 336          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrg3 (gamma-aminobutyric acid (GABA) A receptor, subunit gamma 3 [Source:MGI Symbol;Acc:MGI:95624])

HSP 1 Score: 74.3294 bits (181), Expect = 1.926e-13
Identity = 64/269 (23.79%), Postives = 121/269 (44.98%), Query Frame = 1
Query:  739 KLRKD----KVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKY---WSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            KLR D       +++ I    IG + ++   Y  D F    W + +L  ++  ++ T + +     W P     N  S+T EA W+T   N+ L +     ++   R+       L+L++FP+D     +T ++   P  E+     +  + A       DQ+ W+L++   +  R   +  ++S   +  +++    +RR GYF    ++   +   LS+ +F +  +    R  L  T VLT  T   +  +SLP++SY+T MD +V
Sbjct:   61 KLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNSNMVGLIWIPDTIFRN--SKTAEAHWITT-PNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDAHACPLTFSSYGYPKEEMIYRWRKNSVEA------ADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFV 320          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrb2 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 2 [Source:MGI Symbol;Acc:MGI:95620])

HSP 1 Score: 73.559 bits (179), Expect = 4.402e-13
Identity = 74/298 (24.83%), Postives = 137/298 (45.97%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-----TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     VAV + I    I  ID + E+   Y    + Q  WR+ +L  +    N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ +     TT+  D E     D   ++ +   T ++  ++ + ++  ITK+++      S  S+P LS++ +  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +
Sbjct:   48 DIRLRPDFGGPPVAVGMNI---DIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTD--DIEFYWRGDDNAVTGV---TKIELPQFSIVDYKLITKKVVF-----STGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYI 329          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrb2 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 2 [Source:MGI Symbol;Acc:MGI:95620])

HSP 1 Score: 73.1738 bits (178), Expect = 5.474e-13
Identity = 74/298 (24.83%), Postives = 137/298 (45.97%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-----TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     VAV + I    I  ID + E+   Y    + Q  WR+ +L  +    N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ +     TT+  D E     D   ++ +   T ++  ++ + ++  ITK+++      S  S+P LS++ +  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +
Sbjct:   48 DIRLRPDFGGPPVAVGMNI---DIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTD--DIEFYWRGDDNAVTGV---TKIELPQFSIVDYKLITKKVVF-----STGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYI 329          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrg2 (gamma-aminobutyric acid (GABA) A receptor, subunit gamma 2 [Source:MGI Symbol;Acc:MGI:95623])

HSP 1 Score: 72.4034 bits (176), Expect = 6.249e-13
Identity = 74/297 (24.92%), Postives = 136/297 (45.79%), Query Frame = 1
Query:  709 NHSVIGNDNLKLRKDKVAVELRIVFL-----KIGEIDTLKELYHADAFIQAKWREPKLDGHTNEE---LATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACV 1560
            N+ + G DN KLR D + V+  ++        IG ++ +   Y  D F    W + +L  ++  +   L +  + K W P  +  N  S+  +A W+T   N  L +     V+   R+       L+L++FP+D     +  ++   P  EI     Q + S++ +    D + W+L++   +  R   +   ++   +  +SV    +RR GYF    ++   +I  LS+ +F ++ +    R  L  T VLT  T   +  +SLPK+SY+T MD +V      +C + ++ A V
Sbjct:   70 NNLLEGYDN-KLRPD-IGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITT-PNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVY---QWKRSSVEVG---DTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVS-----VCFIFVFSALV 350          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrg2 (gamma-aminobutyric acid (GABA) A receptor, subunit gamma 2 [Source:MGI Symbol;Acc:MGI:95623])

HSP 1 Score: 72.4034 bits (176), Expect = 8.861e-13
Identity = 74/297 (24.92%), Postives = 136/297 (45.79%), Query Frame = 1
Query:  709 NHSVIGNDNLKLRKDKVAVELRIVFL-----KIGEIDTLKELYHADAFIQAKWREPKLDGHTNEE---LATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACV 1560
            N+ + G DN KLR D + V+  ++        IG ++ +   Y  D F    W + +L  ++  +   L +  + K W P  +  N  S+  +A W+T   N  L +     V+   R+       L+L++FP+D     +  ++   P  EI     Q + S++ +    D + W+L++   +  R   +   ++   +  +SV    +RR GYF    ++   +I  LS+ +F ++ +    R  L  T VLT  T   +  +SLPK+SY+T MD +V      +C + ++ A V
Sbjct:   70 NNLLEGYDN-KLRPD-IGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITT-PNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVY---QWKRSSVEVG---DTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVS-----VCFIFVFSALV 350          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P27681|GBRG3_MOUSE (Gamma-aminobutyric acid receptor subunit gamma-3 OS=Mus musculus OX=10090 GN=Gabrg3 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 1.347e-12
Identity = 64/269 (23.79%), Postives = 121/269 (44.98%), Query Frame = 1
Query:  739 KLRKD----KVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKY---WSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            KLR D       +++ I    IG + ++   Y  D F    W + +L  ++  ++ T + +     W P     N  S+T EA W+T   N+ L +     ++   R+       L+L++FP+D     +T ++   P  E+     +  + A       DQ+ W+L++   +  R   +  ++S   +  +++    +RR GYF    ++   +   LS+ +F +  +    R  L  T VLT  T   +  +SLP++SY+T MD +V
Sbjct:   61 KLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNSNMVGLIWIPDTIFRN--SKTAEAHWITT-PNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDAHACPLTFSSYGYPKEEMIYRWRKNSVEA------ADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFV 320          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P28473|GBRG3_RAT (Gamma-aminobutyric acid receptor subunit gamma-3 OS=Rattus norvegicus OX=10116 GN=Gabrg3 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.551e-12
Identity = 64/269 (23.79%), Postives = 121/269 (44.98%), Query Frame = 1
Query:  739 KLRKD----KVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKY---WSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            KLR D       +++ I    IG + ++   Y  D F    W + +L  ++  ++ T + +     W P     N  S+T EA W+T   N+ L +     ++   R+       L+L++FP+D     +T ++   P  E+     +  + A       DQ+ W+L++   +  R   +  ++S   +  +++    +RR GYF    ++   +   LS+ +F +  +    R  L  T VLT  T   +  +SLP++SY+T MD +V
Sbjct:   61 KLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNSNMVGLIWIPDTIFRN--SKTAEAHWITT-PNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDAHACPLTFSSYGYPKEEMIYRWRKNSVEA------ADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFV 320          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|D1LYT2|GBRB2_MACMU (Gamma-aminobutyric acid receptor subunit beta-2 OS=Macaca mulatta OX=9544 GN=GABRB2 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.349e-12
Identity = 74/298 (24.83%), Postives = 137/298 (45.97%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-----TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     VAV + I    I  ID + E+   Y    + Q  WR+ +L  +    N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ +     TT+  D E     D   ++ +   T ++  ++ + ++  ITK+++      S  S+P LS++ +  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +
Sbjct:   48 DIRLRPDFGGPPVAVGMNI---DIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTD--DIEFYWRGDDNAVTGV---TKIELPQFSIVDYKLITKKVVF-----STGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYI 329          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P47870|GBRB2_HUMAN (Gamma-aminobutyric acid receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=GABRB2 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 2.349e-12
Identity = 74/298 (24.83%), Postives = 137/298 (45.97%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-----TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     VAV + I    I  ID + E+   Y    + Q  WR+ +L  +    N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ +     TT+  D E     D   ++ +   T ++  ++ + ++  ITK+++      S  S+P LS++ +  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +
Sbjct:   48 DIRLRPDFGGPPVAVGMNI---DIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTD--DIEFYWRGDDNAVTGV---TKIELPQFSIVDYKLITKKVVF-----STGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYI 329          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P63137|GBRB2_MOUSE (Gamma-aminobutyric acid receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Gabrb2 PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 3.079e-12
Identity = 74/298 (24.83%), Postives = 137/298 (45.97%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITM-----TTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     VAV + I    I  ID + E+   Y    + Q  WR+ +L  +    N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ +     TT+  D E     D   ++ +   T ++  ++ + ++  ITK+++      S  S+P LS++ +  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +
Sbjct:   48 DIRLRPDFGGPPVAVGMNI---DIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTD--DIEFYWRGDDNAVTGV---TKIELPQFSIVDYKLITKKVVF-----STGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYI 329          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A4S2MAS8 (Neur_chan_LBD domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002711 PE=3 SV=1)

HSP 1 Score: 551.977 bits (1421), Expect = 4.975e-180
Identity = 314/538 (58.36%), Postives = 379/538 (70.45%), Query Frame = 1
Query:  508 TVNSASREAINKAEYSTISP-ADRLIEAIESLRYSIQDNTQ------------MHCRSQQRGKT-----RRRMSTYGNKS-QGRGENHSVI--------GNDNLKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV-PHVSKVTNGPXXXXXXXXXXXXXXXXKEF----------QKRLEEKSPFMKSVINTVNNDNDKKD----------EVQEDE-TGERVLTPGEIKLLRRIERDVLISFGCLYIIAHCIFIFWLYFDASXXXXXXXXXXXXXXEFLQKNREWQQNTKK 1974
            TV S   +    +E +  SP  + LI+A+E L  S+++N +            M  R +  G T     + R S   +++ + RG+ H  +          D+ + R DKVAVE+R+VFLKIGEIDTLKELY+ADAFIQAKWREPKLDG   EEL  T++++YW+PLL+IDNILSETKE QWL A  N++ EV ++ERRRIKGVFLETLELNDFPLDVQDLTIT+TTERPD+E+D+IPDQ EMSAINIQTFVDQQEWKLHEHVEITKRII QE+SSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATF+VSP+KAE RLRLSFTL+LTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCI+SIWHA VTL+ P    + NG     S   +        +F            + +   PF  +    +N DN  +D           V E E T   ++   E K ++++E+ V  SF  +YIIAH IFIFWLYFDASRRRR MRQKDRDYR FL++N +WQ+ + +
Sbjct:  506 TVQSPVCKEYQPSELTENSPETESLIQALELLCASVEENNRSYELELRELDPLMMLRRRFLGSTTSDNSQHRTSLLNSRTVRTRGQRHDQLRRAAGHRRSEDSGQNRTDKVAVEVRVVFLKIGEIDTLKELYYADAFIQAKWREPKLDGRVTEELTITELEQYWNPLLFIDNILSETKETQWLVAQENDAGEVFLVERRRIKGVFLETLELNDFPLDVQDLTITVTTERPDTEVDIIPDQNEMSAINIQTFVDQQEWKLHEHVEITKRIIKQEYSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFAVSPDKAELRLRLSFTLILTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIISIWHAVVTLLDPQHIAIRNGQSGELSDTFDFTTPKIPTQFADNTSRGTLGNSKWKAADPFRNTT--GINGDNSTEDFAWNNTIVAATVLEPECTPTNLMACKEWKEVQKVEQHVFTSFVIIYIIAHAIFIFWLYFDASRRRREMRQKDRDYRVFLRRNLQWQKQSHR 1041          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A1S8X8L4 (Neur_chan_LBD domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01065 PE=3 SV=1)

HSP 1 Score: 536.569 bits (1381), Expect = 5.698e-179
Identity = 282/451 (62.53%), Postives = 330/451 (73.17%), Query Frame = 1
Query:  598 LRYSIQDNTQMHCRSQQRGKT-RRRMSTYGNKSQGRGENHSVIGNDNLKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV-PHVSKVTNGPXXXXXXXXXXXXXXXXKEFQKRLE------EKSPFMKSVINTVNNDNDKKDE-------------VQEDETGERVLTPGEIKLLRRIERDVLISFGCLYIIAHCIFIFWLYFDAS 1887
            L  +I DN+Q H  S   G+T R R   +    +  G   S    D+ + R DKVAVE+R+VFLKIGEIDTLKELY+ADAFIQAKWREPKLDG   EEL  T++++YW+PLL+IDNILSETKE QWL A  N++ EV ++ERRRIKGVFLETLELNDFPLDVQDLTIT+TTERPD+E+D+IPDQ EMSAINIQTFVDQQEWKLHEHVEITKRII QE+SSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATF+VSP+KAE RLRLSFTL+LTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCI+SIWHA VTL+ P    + NG     S   +        +F            K     +  NT + + +   E             ++ + T   ++   E K ++++E+ V  SF  +YIIAH IFIFWLYFDAS
Sbjct:  210 LGSTISDNSQ-HRTSLLTGRTVRTRGQRHDQLRRAAGHRRS---EDSGQNRTDKVAVEVRVVFLKIGEIDTLKELYYADAFIQAKWREPKLDGRVTEELTITELEQYWNPLLFIDNILSETKETQWLVAQENDAGEVYLVERRRIKGVFLETLELNDFPLDVQDLTITVTTERPDTEVDIIPDQNEMSAINIQTFVDQQEWKLHEHVEITKRIIKQEYSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFAVSPDKAELRLRLSFTLILTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIISIWHAVVTLLDPQHIAIRNGQSGELSDTFDFTTPKIPTQFAHNASRGNLSNSKWKGADTFRNTTDMNGNSSTEDFAWNNTIVTGTVLEPECTPTNLMACKEWKEVQKVEQHVFTSFVIIYIIAHAIFIFWLYFDAS 656          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A4S2M997 (Neur_chan_LBD domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002711 PE=3 SV=1)

HSP 1 Score: 545.814 bits (1405), Expect = 8.780e-178
Identity = 306/546 (56.04%), Postives = 371/546 (67.95%), Query Frame = 1
Query:  508 TVNSASREAINKAEYSTISP-ADRLIEAIESLRYSIQDNTQ------------MHCRSQQRGKT-----RRRMSTYGNKS-QGRGENHSVI--------GNDNLKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV-PHVSKVTNGPXXXXXXXXXXXXXXXXKEF----------QKRLEEKSPFMKSVINTVNNDNDKKD----------EVQEDE-TGERVLTPGEIKLLRRIERDVLISFGCLYIIAHCIFIFWLYFDASXXXXXXXXXXXXXXEFLQKNREWQQNTKKRRDQMHAR 1998
            TV S   +    +E +  SP  + LI+A+E L  S+++N +            M  R +  G T     + R S   +++ + RG+ H  +          D+ + R DKVAVE+R+VFLKIGEIDTLKELY+ADAFIQAKWREPKLDG   EEL  T++++YW+PLL+IDNILSETKE QWL A  N++ EV ++ERRRIKGVFLETLELNDFPLDVQDLTIT+TTERPD+E+D+IPDQ EMSAINIQTFVDQQEWKLHEHVEITKRII QE+SSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATF+VSP+KAE RLRLSFTL+LTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCI+SIWHA VTL+ P    + NG     S   +        +F            + +   PF  +    +N DN  +D           V E E T   ++   E K ++++E+ V  SF  +YIIAH IFIFWLYFDAS          R  RE  QK+R++    +KR+ +M  R
Sbjct:  506 TVQSPVCKEYQPSELTENSPETESLIQALELLCASVEENNRSYELELRELDPLMMLRRRFLGSTTSDNSQHRTSLLNSRTVRTRGQRHDQLRRAAGHRRSEDSGQNRTDKVAVEVRVVFLKIGEIDTLKELYYADAFIQAKWREPKLDGRVTEELTITELEQYWNPLLFIDNILSETKETQWLVAQENDAGEVFLVERRRIKGVFLETLELNDFPLDVQDLTITVTTERPDTEVDIIPDQNEMSAINIQTFVDQQEWKLHEHVEITKRIIKQEYSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFAVSPDKAELRLRLSFTLILTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIISIWHAVVTLLDPQHIAIRNGQSGELSDTFDFTTPKIPTQFADNTSRGTLGNSKWKAADPFRNTT--GINGDNSTEDFAWNNTIVAATVLEPECTPTNLMACKEWKEVQKVEQHVFTSFVIIYIIAHAIFIFWLYFDAS----------RRRREMRQKDRDY----RKRKRKMVGR 1035          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A4S2MAZ8 (Neur_chan_LBD domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002711 PE=3 SV=1)

HSP 1 Score: 544.658 bits (1402), Expect = 2.507e-177
Identity = 296/509 (58.15%), Postives = 355/509 (69.74%), Query Frame = 1
Query:  508 TVNSASREAINKAEYSTISP-ADRLIEAIESLRYSIQDNTQ------------MHCRSQQRGKT-----RRRMSTYGNKS-QGRGENHSVI--------GNDNLKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV-PHVSKVTNGPXXXXXXXXXXXXXXXXKEF----------QKRLEEKSPFMKSVINTVNNDNDKKD----------EVQEDE-TGERVLTPGEIKLLRRIERDVLISFGCLYIIAHCIFIFWLYFDAS 1887
            TV S   +    +E +  SP  + LI+A+E L  S+++N +            M  R +  G T     + R S   +++ + RG+ H  +          D+ + R DKVAVE+R+VFLKIGEIDTLKELY+ADAFIQAKWREPKLDG   EEL  T++++YW+PLL+IDNILSETKE QWL A  N++ EV ++ERRRIKGVFLETLELNDFPLDVQDLTIT+TTERPD+E+D+IPDQ EMSAINIQTFVDQQEWKLHEHVEITKRII QE+SSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATF+VSP+KAE RLRLSFTL+LTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCI+SIWHA VTL+ P    + NG     S   +        +F            + +   PF  +    +N DN  +D           V E E T   ++   E K ++++E+ V  SF  +YIIAH IFIFWLYFDAS
Sbjct:  506 TVQSPVCKEYQPSELTENSPETESLIQALELLCASVEENNRSYELELRELDPLMMLRRRFLGSTTSDNSQHRTSLLNSRTVRTRGQRHDQLRRAAGHRRSEDSGQNRTDKVAVEVRVVFLKIGEIDTLKELYYADAFIQAKWREPKLDGRVTEELTITELEQYWNPLLFIDNILSETKETQWLVAQENDAGEVFLVERRRIKGVFLETLELNDFPLDVQDLTITVTTERPDTEVDIIPDQNEMSAINIQTFVDQQEWKLHEHVEITKRIIKQEYSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFAVSPDKAELRLRLSFTLILTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIISIWHAVVTLLDPQHIAIRNGQSGELSDTFDFTTPKIPTQFADNTSRGTLGNSKWKAADPFRNTT--GINGDNSTEDFAWNNTIVAATVLEPECTPTNLMACKEWKEVQKVEQHVFTSFVIIYIIAHAIFIFWLYFDAS 1012          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A267EWJ2 (Neur_chan_LBD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010629g2 PE=3 SV=1)

HSP 1 Score: 525.783 bits (1353), Expect = 3.341e-175
Identity = 268/460 (58.26%), Postives = 331/460 (71.96%), Query Frame = 1
Query:  556 TISPADRLIEAIESLRYSIQDNTQMHCRSQQRGKTRRRMSTYGNKSQGRGENHSVIGNDNLKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANE-SLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLVPHVSKVTNGPXXXXXXXXXXXXXXXXKEFQKRLEEKSPFMKSVINTVNNDNDKKD-EVQED------------ETGE---RVLTPGEIKLLRRIERDVLISFGCLYIIAHCIFIFWLYFDA 1884
            ++ P  RLI+A+E+LR SI D+T +  + Q R + RRR ++ G  +   G    +  ++  ++R +KV VE+R+VFLKIGEIDTLKELYHADAFIQAKW+EP L+G   EEL + D++KYW+PLLYIDNILSETKEA W+ A  +  + +V ++ERRRIKGVFLETLELNDFPLDVQDLTIT+T+ERPD+EI+LIPD+ EMS INIQTFVDQQEW+LHEH+E+ KR + QEFSS+MKSHPCL+V CRAARRPGYFYWNVFLIMFMISGLSFATF+V P K EYRLRLSFTLVLTSVTFKYV+ QSLP+ISYLTYMDKYVLMSLAILCIVSIWHA VT++                                   + P +      VN  +  +D E+  D            E+GE   R L    ++++ +IE+DV ISF  LY++AH IFIFWLY+DA
Sbjct:  151 SLDPTQRLIDALETLRDSINDSTSVALQ-QSRVRNRRRGTSAGQVNYKGG---GLKNDERCRIRAEKVVVEIRVVFLKIGEIDTLKELYHADAFIQAKWKEPLLEGRGAEELKSIDLEKYWNPLLYIDNILSETKEATWVVAQHDPLNSDVYIVERRRIKGVFLETLELNDFPLDVQDLTITITSERPDTEIELIPDEAEMSGINIQTFVDQQEWRLHEHIEVEKRTLTQEFSSTMKSHPCLAVRCRAARRPGYFYWNVFLIMFMISGLSFATFAVEPHKCEYRLRLSFTLVLTSVTFKYVVAQSLPRISYLTYMDKYVLMSLAILCIVSIWHAVVTMI-----------------------------------QPPNLGGSAGRVNQTHTGRDGELGADSWQSMRECFLQAESGEPCSRHLR--RMEMVNKIEKDVFISFSVLYVLAHVIFIFWLYYDA 569          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:NCBI gene;Acc:103030074])

HSP 1 Score: 73.559 bits (179), Expect = 2.898e-13
Identity = 69/274 (25.18%), Postives = 123/274 (44.89%), Query Frame = 1
Query:  724 GNDNLKLRKD----KVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEE---LATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            G DN KLR D       ++  +    IG +D +   Y  D F    W + +L  +++ +   L +  + K W P  +  N  S   +A W+T   N  L +     V+   R+       L+L++FP+D     +  ++   P +EI+    +    A+ +    DQ+ W+L++   +  +       +    +  +S+    +RR GYF    ++   MI  LS+ +F ++ +    R  L  T VLT  T   +  +SLPK+SY+T MD +V
Sbjct:   64 GYDN-KLRPDIGVKPTLIDAAVYVNSIGPVDPINMEYTIDIFFAQSWYDSRLQFNSSMKVLMLNSNMVGKIWIPDTFFRN--SRKSDAHWITT-PNRLLRLWSNGRVMYTLRLTINAECYLKLHNFPMDEHSCPLEFSSYGYPKNEIEY---KWHSRAVQV---ADQRYWRLYQFAFVGLQNTTGIAHTQSGDYVVMSILFTLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYVTAMDLFV 327          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4-like [Source:NCBI gene;Acc:103032374])

HSP 1 Score: 72.0182 bits (175), Expect = 9.490e-13
Identity = 74/293 (25.26%), Postives = 134/293 (45.73%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKL---DGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     V V + I    I  ID++ E+   Y    + Q  WR+ +L   +   N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ + +    ++  +   Q   +A+   T VD+ E      VE+   ++ +E   +  S+P LS++ R  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  V
Sbjct:   49 DIRLRPDFGGPPVIVGMSI---NIASIDSISEVNMDYTITMYFQQSWRDKRLAYVEMPLNLTLDNRVADQLWLPDTYF---LNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGKNAV---TGVDKLELPQFSIVEL--HLVSREVRFTTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYV 330          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4-like [Source:NCBI gene;Acc:103032374])

HSP 1 Score: 72.0182 bits (175), Expect = 9.940e-13
Identity = 74/293 (25.26%), Postives = 134/293 (45.73%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKL---DGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     V V + I    I  ID++ E+   Y    + Q  WR+ +L   +   N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ + +    ++  +   Q   +A+   T VD+ E      VE+   ++ +E   +  S+P LS++ R  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  V
Sbjct:   49 DIRLRPDFGGPPVIVGMSI---NIASIDSISEVNMDYTITMYFQQSWRDKRLAYVEMPLNLTLDNRVADQLWLPDTYF---LNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGKNAV---TGVDKLELPQFSIVEL--HLVSREVRFTTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYV 330          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:NCBI gene;Acc:103041149])

HSP 1 Score: 71.2478 bits (173), Expect = 1.921e-12
Identity = 85/382 (22.25%), Postives = 162/382 (42.41%), Query Frame = 1
Query:  682 GNKSQGRGENHSVIGNDNLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGHT---NEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLVPHVSKVTNGPXXXXXXXXXXXXXXXXKEFQKRLEEKSPFMKSVINTVNNDNDKKDEVQEDETGERVLTPGEI 1785
            GN S  +     ++   +++LR D     VAV + I    +  ID + E+   Y    + Q  WR+ +L       N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ + +    ++      +   +A+   + ++  ++ + ++  +++ ++      S  ++P LS++ +  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +        GP                 + QK+L EK+          NND  K D  + D  G  +LT  EI
Sbjct:   53 GNMSFVKETVDKLLKGYDIRLRPDFGGAPVAVGMSI---DVASIDMVSEVNMDYTLTMYFQQYWRDKRLAYAGIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWKGGDNAVTGVSRIELPQFSIVDYKLVSRNVVF-----STGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYI----FFGRGP-----------------QMQKKLAEKA-------EKANNDRTKYDGNKVDSQGNILLTTLEI 395          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrb2a (gamma-aminobutyric acid type A receptor beta2 subunit [Source:NCBI gene;Acc:103045154])

HSP 1 Score: 68.1662 bits (165), Expect = 1.669e-11
Identity = 68/293 (23.21%), Postives = 132/293 (45.05%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKLDGH---TNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     VAV + I    I  ID + E+   Y    + Q  WR+ +L       N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ + +    ++      +    A++    ++  ++ + ++  I+K ++      S  S+P LS++ +  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  +
Sbjct:   47 DIRLRPDFGGAPVAVGMNI---DIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSEIPLNLTLDNRVADQLWVPDTYF---LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDGAVSGVERIELPQFSIVDYKLISKNVVF-----STGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYI 328          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 58.151 bits (139), Expect = 3.142e-9
Identity = 67/284 (23.59%), Postives = 120/284 (42.25%), Query Frame = 1
Query:  757 VAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLD----GHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESL-----EVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEI-DLIPDQTEMSAINIQTFVDQQEWKLHEH---VEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            V V   I     G I      Y  + F++ +W +P+L        + +L  + +D  W P L+  N     K A +     +  L     +  V+   R+       ++L +FP+DVQ  T  M  E     + DLI +  +  A+ +   +   ++ L +    V  TK     +F+       C+ V     R+ GY+   +++   +I  LS+ +F ++ + A  R+ L  T VLT  T       SLPK+SY+  +D ++ + L  +    + +A V  V
Sbjct:    6 VNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFAN----EKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQ--TCAMQLESFGYTMNDLIFEWKQEGAVQVAEGLTLPQFVLKDEKDLVYCTKHYNTGKFT-------CIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFV 276          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002305.1 (pep scaffold:Pmarinus_7.0:GL478144:76380:93696:1 gene:ENSPMAG00000002075.1 transcript:ENSPMAT00000002305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 3.279e-9
Identity = 61/264 (23.11%), Postives = 114/264 (43.18%), Query Frame = 1
Query:  757 VAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLD-----GHTNEE---LATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLE-----TLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            V V   ++    G I+     Y    ++Q  W + +++     GH  ++   LA   +D  W+P L+ +N     K A +       S+ V     +    + L       + L  +PLD Q+  I + +    ++ DLI    E   + + T +   ++KL  H E+      +E+ +   +H C++ T    R  GY+   V+    ++  +S+ +F +S E    R+ L  T +LT  T       +LPK+SY+  MD ++
Sbjct:   57 VLVNCSVLVKSFGPIEENTMDYMMLIYLQQSWIDSRIESIYSAGHYQKDFLDLANNYIDTVWTPDLFFEN----EKSAAFHEIHCRFSIIVHATNNKTCFSLVLSLTLACPMNLEYYPLDTQECRINLESFGYTTQ-DLIFQWDENEPLVVATNLYTPKFKLSNHTELGD--CSKEYLTG--THSCINATFYLHRDMGYYLIQVYFPSCLLVIISWLSFWLSVESTPARVSLGITTILTVTTQMTSANAALPKMSYIKAMDVWM 311          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: gabra6a (gamma-aminobutyric acid (GABA) A receptor, alpha 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1692])

HSP 1 Score: 56.6102 bits (135), Expect = 1.534e-8
Identity = 68/274 (24.82%), Postives = 115/274 (41.97%), Query Frame = 1
Query:  763 VELRIVFLKIGEIDTLKELYHADAFIQAKWREPKL--DGHTN-EELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACV 1560
            V+  I     G +  ++  Y  D F +  W + +L  DG      L    +++ W+P  Y  N   +   A  +TA  N+   +    TV+   R+       + L DFP+D     +   +   P SEI  I   T+ +  +++  V Q+   L ++      +  +E  S +  +  ++V+    R+ GYF    ++   M   LS  +F ++ E    R     T VLT  T       SLPK+SY T MD ++ +S A +    I  A V
Sbjct:   71 VKTDIYVTSFGPVSDVEMDYTMDVFFRQTWVDERLKFDGPIEILRLNNLMVNRIWTPDTYFRN--GKKSIAHNMTA-PNKLFRIMQNGTVLYTMRLTINAECPMRLMDFPMDGHTCPLKFGSYAYPKSEI--IYSWTKGANNSVE--VPQESSSLLQYDLTGHNVSSEELKSKIGDYVVMTVSFYLKRKMGYFIVQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTQSISARGSLPKVSYATAMDWFIAVSFAFVFSALIEFAAV 337          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 53.5286 bits (127), Expect = 7.214e-8
Identity = 31/123 (25.20%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1192 EWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACV 1560
            ++ + +H ++++ +   +F++   S+P LS++ R  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V
Sbjct:   49 QFTIVKHNQVSRNV---QFATG--SYPRLSLSFRLKRNIGYFILQTYMPTILITILSWVSFWINYDASAARVALGVTTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFCFVFLALLEYAAV 166          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 53.5286 bits (127), Expect = 1.038e-7
Identity = 57/266 (21.43%), Postives = 111/266 (41.73%), Query Frame = 1
Query:  757 VAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKL-------DGHTNE-ELATTDMDKYWSPLLYIDNILSETKEAQWLTA----VANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHV---EITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            V V   I+    G ++     Y  + F++  W +P++       + +T+  +L  + +D  W P L+ +N  S   +   L      +   ++ +T     R+  V    + L  +P+D Q  +I + +    +  DLI    +   ++    V   ++ L       E TK      FS       C+  T    R  GY+   V++   ++  +S+ +F ++ E A  R+ L  T +LT  T       +LPK+SY+  +D ++
Sbjct:   69 VVVNCSILVKGFGPVEEATMDYSINIFLRQTWNDPRILNVLKSIEYNTDFLDLGNSFVDSVWKPDLFFENEKSAAFQMYQLVTGFKYMYTFAMWITCFLCFRLSLVLACPMSLEVYPMDAQYCSIYLESYGYTTN-DLIFQWNDTEPVSFGAGVSTPKFTLSNETFLGECTKEYTYGTFS-------CVKATFFLDRDMGYYLIQVYIPSCLLVIISWLSFWLNVEAAPARVGLGITTILTVTTQMTSANAALPKVSYIKAIDVWM 326          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO32790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU26])

HSP 1 Score: 140.969 bits (354), Expect = 2.627e-36
Identity = 82/268 (30.60%), Postives = 148/268 (55.22%), Query Frame = 1
Query:  751 DKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDN--ILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEI-TKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSI 1545
            DKV V +R     +G+ID +++ +  + ++ A WREPKL G  NEE+     D  WSP +   N  +L    + + L    N ++ +   E  +I+G F E   L  FP+D+Q+L+I ++++  D  +    D  +   +  QTF   ++W L+ HV   T     +    + +S+P   +T    RR  +++WN  ++M +++ LSFA+F++ P++   RL ++  L+L SV +K+V +  LP+ SYLT++DKY L +L  +  +++
Sbjct:   14 DKVTVLIRCGISFLGDIDVIRQQFTCELWMTASWREPKLAGKKNEEV---KWDNEWSPKISFSNSLLLDRVYKGRRLYYEENSTVPLAQ-EVYKIRGTFKEQFSLEQFPVDLQELSIIISSDWSDRTVTFEKDMAKPDYLRQQTFSSPRDWVLYPHVHTDTATQEGEGLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAV 277          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO26859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAV8])

HSP 1 Score: 77.7962 bits (190), Expect = 1.537e-16
Identity = 41/126 (32.54%), Postives = 76/126 (60.32%), Query Frame = 1
Query: 1171 QTFVDQQEWKLHEHVEI-TKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSI 1545
            QTF   ++W L+ HV   T     +    + +S+P   +T    RR  +++WN  ++M +++ LSFA+F++ P++   RL ++  L+L SV +K+V +  LP+ SYLT++DKY L +L  +  +++
Sbjct:   10 QTFSSPRDWVLYPHVHTDTATQEGEGLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAV 135          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO37555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG6])

HSP 1 Score: 76.6406 bits (187), Expect = 9.995e-15
Identity = 68/270 (25.19%), Postives = 121/270 (44.81%), Query Frame = 1
Query:  751 DKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTD--MDKYWSPLLY-IDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRI------------ILQEFSSSMKSH-PCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVL 1512
            D V V +    L I  I+ +   Y  D F++  WR+P+L    ++ LA ++  +DK W P  Y +++ +S+      +  + + S +  V    R+       + L  FP DVQ+  I +             +    SA N+Q    Q E +    + + K+I            + + F+  +  +   L+ T R  RR GYF  +++    +I  LS+ +F + PE    R+ L  T VLT  T   ++  S+PK+SY+  +D Y++
Sbjct:   28 DPVTVTVGFWVLSIDAINVIDMDYRMDFFLRQLWRDPRLKHRFDDTLALSNTMLDKIWVPDTYFVNSKMSKFHSVTTINKMLSISPDGLVHYNSRVTVKASCAMNLRMFPKDVQNCNIDI-------------ESYGYSADNVQY---QWENRSDNGIAVNKKIRDMPQYNLSDINVSRHFTMYVAGNWSGLTATFRFRRRSGYFIIHIYAPCALIVILSWISFCIPPESTAARIALGITSVLTITTILNMLNNSMPKVSYVKAVDWYLI 281          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO37396 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFV7])

HSP 1 Score: 69.3218 bits (168), Expect = 1.771e-12
Identity = 67/277 (24.19%), Postives = 126/277 (45.49%), Query Frame = 1
Query:  757 VAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEE--LATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV---TVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRP-GYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            V V++    L +  ID +   +  D F++ +W +P+LD   NE   L    M K W+P  Y  N  ++T +   +T     +L      V    R+      T++L  FP+D Q+  + + +   D     I    E +A +   FV  +  ++     + +  + +E+   +  +    V   +  R   YF  +V+    +I  +S+  F + P++   R+ +  T +LT VT   ++  S+PK+SY+  +DK+ L+S  I   +S+   CV L+
Sbjct:   59 VVVKVGYWILSVDSIDVVNMDFTVDLFLRQEWVDPRLDHGLNETIYLGHRVMQKIWTPDSYFLN--AKTAKMHHVTTPNQMTLIAPMGVVKYNTRVTVKAACTIDLRSFPMDQQNCPLVLESYGYDRS--HIVYHWEGNATDGLPFVPNRM-RIMPQYSLVRLTLSREWHQYIIGNFSAVVAVFSIERSYTYFLTHVYGTSCVIVFISWMGFVIPPDQTAARIAVGVTTLLTQVTVINILNSSMPKVSYVKSIDKF-LISCLIFVFLSLIEYCVILI 329          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO35410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK4])

HSP 1 Score: 62.3882 bits (150), Expect = 2.094e-10
Identity = 72/295 (24.41%), Postives = 128/295 (43.39%), Query Frame = 1
Query:  745 RKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELA----TTDMDK-YWSPLLYI-------------DNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTE----MSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVT 1563
            + + V V + +    I  +  +   +  D +++  WR+ +L   T    A    ++D++K  W P  Y              DN L + K    L      S+ +T+    R        L+L DFP D Q  ++++ +    S  D++    E     SAI I    D  E    E + +++   + +++  + +H  L    R  RR GYF  + ++   +I  +S+ +F + PE A  R+ L  T VLT  T       +LPK+SY+  +D Y+L+ L  +    + + CVT
Sbjct:   42 KGEPVVVYVDMYVSNIWAMQEMNMDFTIDIYLRQYWRDERLQFETQTPGAMLTLSSDINKQIWVPSTYFLATKKAYFHDVTTDNYLLQVKPDGSLF----YSIRLTITTSCR--------LDLRDFPHDTQSCSLSLESYGYQST-DVLYVWNERLDNTSAIYIH---DDLELPQFEVLGVSRSAKMNKYN--IGNHSSLVANFRMKRRIGYFLIDTYIPSTIIVIISWISFWIDPETAPARVALGITTVLTMTTLISSARANLPKVSYVKAIDWYLLLCLIFVFGSILEYTCVT 318          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:NCBI gene;Acc:101155813])

HSP 1 Score: 73.9442 bits (180), Expect = 2.156e-13
Identity = 70/274 (25.55%), Postives = 123/274 (44.89%), Query Frame = 1
Query:  724 GNDNLKLRKD----KVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTD---MDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTT-ERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYV 1509
            G DN KLR D       +E  +    IG +D +   Y  D F    W + +L  +++ +L   +   + K W P  +  N  S   +A W+T   N  L +     V+   R+       L+L++FP+D     +  ++   P +EI     + +  A+ +    DQ+ W+L++   +  R       +    +  +++    +RR GYF    ++   MI  LS+ +F ++ +    R  L  T VLT  T   +  +SLPK+SY+T MD +V
Sbjct:   63 GYDN-KLRPDIGVRPTVIETAVYVNSIGPVDPINMEYTIDIFFAQTWYDSRLKFNSSMKLLMLNSNMVGKIWIPDTFFRN--SRKSDAHWITT-PNRLLRLWSNGRVMYTLRLTINAECYLKLHNFPMDEHSCPLEFSSYGYPRNEIMY---RWQRRAVEV---ADQRYWRLYQFAFVGMRNTSDVAHTQSGEYVIMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYITAMDLFV 326          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4 [Source:NCBI gene;Acc:101160433])

HSP 1 Score: 72.7886 bits (177), Expect = 4.309e-13
Identity = 78/315 (24.76%), Postives = 138/315 (43.81%), Query Frame = 1
Query:  706 ENHSVIGNDNLKLRKDKVA-------VELRIVF----------LKIGEIDTLKEL---YHADAFIQAKWREPKL---DGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
             +HS  GN  + + K  V        + LR  F          + I  ID++ E+   Y    + Q  W + +L   +   N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ + +    ++  +   Q   SA+   T VD+ E      VE+  R++ +E   +  S+P LS++ R  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  V
Sbjct:    7 RSHSSTGNTGMSVAKTTVDKLLKGYDIRLRPDFGGPPVIVGMSINIASIDSISEVNMDYTITMYFQQSWTDKRLAYGELDLNLTLDNRVADQLWLPDTYF---LNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGNSAV---TGVDKLELPQFSIVEL--RLVSREVRFATGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYV 313          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4 [Source:NCBI gene;Acc:101160433])

HSP 1 Score: 72.4034 bits (176), Expect = 6.394e-13
Identity = 75/293 (25.60%), Postives = 134/293 (45.73%), Query Frame = 1
Query:  733 NLKLRKD----KVAVELRIVFLKIGEIDTLKEL---YHADAFIQAKWREPKL---DGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            +++LR D     V V + I    I  ID++ E+   Y    + Q  W + +L   +   N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ + +    ++  +   Q   SA+   T VD+ E      VE+  R++ +E   +  S+P LS++ R  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  V
Sbjct:   50 DIRLRPDFGGPPVIVGMSI---NIASIDSISEVNMDYTITMYFQQSWTDKRLAYGELDLNLTLDNRVADQLWLPDTYF---LNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGNSAV---TGVDKLELPQFSIVEL--RLVSREVRFATGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYV 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4 [Source:NCBI gene;Acc:101160433])

HSP 1 Score: 72.4034 bits (176), Expect = 6.907e-13
Identity = 69/272 (25.37%), Postives = 125/272 (45.96%), Query Frame = 1
Query:  784 LKIGEIDTLKEL---YHADAFIQAKWREPKL---DGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEV----TVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV 1569
            + I  ID++ E+   Y    + Q  W + +L   +   N  L     D+ W P  Y    L++ K       V N  + +    TV+   RI       ++L  +PLD Q+ T+ + +    ++  +   Q   SA+   T VD+ E      VE+  R++ +E   +  S+P LS++ R  R  GYF    ++   +I+ LS+ +F ++ + +  R+ L  T VLT  T    + ++LPKI Y+  +D Y++     + +  + +A V  V
Sbjct:   68 INIASIDSISEVNMDYTITMYFQQSWTDKRLAYGELDLNLTLDNRVADQLWLPDTYF---LNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGNSAV---TGVDKLELPQFSIVEL--RLVSREVRFATGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYV 331          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: glra2 (glycine receptor alpha 2 [Source:NCBI gene;Acc:101169154])

HSP 1 Score: 70.8626 bits (172), Expect = 1.782e-12
Identity = 71/294 (24.15%), Postives = 127/294 (43.20%), Query Frame = 1
Query:  742 LRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLD----GHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESL-----EVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEI-DLIPDQTEMSAINIQTFVDQQEWKLHEHVEI---TKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLVPHVSK 1584
             +   V V   I     G I      Y  + F++ KW +P+L       ++ +L  + +D  W P L+  N     K A +     +  L     + TV+   R+  +    ++L +FP+DVQ  T TM  E     + DL+ +  E  A+ +   +   ++ + E  E+   TK     +F+       C+ V     R+ GY+   +++   +I  LS+ +F ++ + A  R+ L  T VLT  T       SLPK+SY+  +D ++ + L  +    + +A V  V    K
Sbjct:   67 FKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSKYPDSSLDLDPSMLDSIWKPDLFFAN----EKGANFHDVTTDNKLLRIFKDGTVLYSIRLTLILSCPMDLKNFPMDVQ--TCTMQLESFGYTMNDLVFEWLEYGAVQVSEGLTLPQFIMKEEKELGYCTKHYNTGKFT-------CIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAGVNFVSRQQK 347          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000008589.1 (SMESG000008589.1)

HSP 1 Score: 1160.59 bits (3001), Expect = 0.000e+0
Identity = 610/610 (100.00%), Postives = 610/610 (100.00%), Query Frame = 1
Query:  196 MSLLETVDEDESSLLVKDTKFINKHEVKWMPLKRFKKDIYRXXXXXXXXXXXXXXYELNRKQSDLSELVDIDIYELEGLSNKSHNRNPNGTILNESPLTPTMRRTVNSASREAINKAEYSTISPADRLIEAIESLRYSIQDNTQMHCRSQQRGKTRRRMSTYGNKSQGRGENHSVIGNDNLKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLVPHVSKVTNGPXXXXXXXXXXXXXXXXKEFQKRLEEKSPFMKSVINTVNNDNDKKDEVQEDETGERVLTPGEIKLLRRIERDVLISFGCLYIIAHCIFIFWLYFDASXXXXXXXXXXXXXXEFLQKNREWQQNTKKRRDQMHARRCSVPMHVL 2025
            MSLLETVDEDESSLLVKDTKFINKHEVKWMPLKRFKKDIYRAIDQDDDDSFISQAYELNRKQSDLSELVDIDIYELEGLSNKSHNRNPNGTILNESPLTPTMRRTVNSASREAINKAEYSTISPADRLIEAIESLRYSIQDNTQMHCRSQQRGKTRRRMSTYGNKSQGRGENHSVIGNDNLKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLVPHVSKVTNGPISNSSSIINRINSSYSKEFQKRLEEKSPFMKSVINTVNNDNDKKDEVQEDETGERVLTPGEIKLLRRIERDVLISFGCLYIIAHCIFIFWLYFDASRRRRLMRQKDRDYREFLQKNREWQQNTKKRRDQMHARRCSVPMHVL
Sbjct:    1 MSLLETVDEDESSLLVKDTKFINKHEVKWMPLKRFKKDIYRAIDQDDDDSFISQAYELNRKQSDLSELVDIDIYELEGLSNKSHNRNPNGTILNESPLTPTMRRTVNSASREAINKAEYSTISPADRLIEAIESLRYSIQDNTQMHCRSQQRGKTRRRMSTYGNKSQGRGENHSVIGNDNLKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLVPHVSKVTNGPISNSSSIINRINSSYSKEFQKRLEEKSPFMKSVINTVNNDNDKKDEVQEDETGERVLTPGEIKLLRRIERDVLISFGCLYIIAHCIFIFWLYFDASRRRRLMRQKDRDYREFLQKNREWQQNTKKRRDQMHARRCSVPMHVL 610          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000008589.1 (SMESG000008589.1)

HSP 1 Score: 1098.19 bits (2839), Expect = 0.000e+0
Identity = 564/564 (100.00%), Postives = 564/564 (100.00%), Query Frame = 1
Query:  196 MSLLETVDEDESSLLVKDTKFINKHEVKWMPLKRFKKDIYRXXXXXXXXXXXXXXYELNRKQSDLSELVDIDIYELEGLSNKSHNRNPNGTILNESPLTPTMRRTVNSASREAINKAEYSTISPADRLIEAIESLRYSIQDNTQMHCRSQQRGKTRRRMSTYGNKSQGRGENHSVIGNDNLKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLVPHVSKVTNGPXXXXXXXXXXXXXXXXKEFQKRLEEKSPFMKSVINTVNNDNDKKDEVQEDETGERVLTPGEIKLLRRIERDVLISFGCLYIIAHCIFIFWLYFDAS 1887
            MSLLETVDEDESSLLVKDTKFINKHEVKWMPLKRFKKDIYRAIDQDDDDSFISQAYELNRKQSDLSELVDIDIYELEGLSNKSHNRNPNGTILNESPLTPTMRRTVNSASREAINKAEYSTISPADRLIEAIESLRYSIQDNTQMHCRSQQRGKTRRRMSTYGNKSQGRGENHSVIGNDNLKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLVPHVSKVTNGPISNSSSIINRINSSYSKEFQKRLEEKSPFMKSVINTVNNDNDKKDEVQEDETGERVLTPGEIKLLRRIERDVLISFGCLYIIAHCIFIFWLYFDAS
Sbjct:    1 MSLLETVDEDESSLLVKDTKFINKHEVKWMPLKRFKKDIYRAIDQDDDDSFISQAYELNRKQSDLSELVDIDIYELEGLSNKSHNRNPNGTILNESPLTPTMRRTVNSASREAINKAEYSTISPADRLIEAIESLRYSIQDNTQMHCRSQQRGKTRRRMSTYGNKSQGRGENHSVIGNDNLKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLVPHVSKVTNGPISNSSSIINRINSSYSKEFQKRLEEKSPFMKSVINTVNNDNDKKDEVQEDETGERVLTPGEIKLLRRIERDVLISFGCLYIIAHCIFIFWLYFDAS 564          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000012532.1 (SMESG000012532.1)

HSP 1 Score: 468.003 bits (1203), Expect = 1.069e-156
Identity = 262/507 (51.68%), Postives = 340/507 (67.06%), Query Frame = 1
Query:  568 ADRLIEAIESLRYSIQDNTQMH------CRSQQRGKT-----RRRMSTYGNKSQGRGENHSVIGND-NLKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLVPHVSKVTNGPXXXXXXXXXXXXXXXXKEFQKRLEE------KSPFMKSVINTVNND---------------------NDKKDEVQEDETGERVLTPGEI--KLLRRIERDVLISFGCLYIIAHCIFIFWLYFDASXXXXXXXXXXXXXXEFLQKNREWQQN 1965
             D+LI A+E LR +I  NT ++       RS+  G+      RR  + Y ++S+ + +N  V+ +D  +  RK+KV VE+R+VFLKIGEIDTLKE+YHADAFIQ+KWRE KLD   N+EL   D+D+ W+PLL+IDNIL+ETK+  WLTA  NE  E  +IERR++KGVFLETLELNDFPLDVQDLTIT+++ERPDSEID++PD  E+S INIQTFVDQQEWKLHEHVE+TKR++ QE++SS + HPCLSVTCRA+RRPGYFYWNVFL+MF I+GLSFATF+V   +AE RL+LSFTL LTSV FK+VI QSLP+ISYLTYMDKYVLMSLAILCI+SIWH+ V  +   +           ++   +NS  +  ++K  E       K+  +KS +N   N                        K  E+   E   R+     I  K  +++ERD+ ISF  LY  AH +FI WLYFDAS          +  RE ++K+R+++ N
Sbjct:  108 VDKLISALELLRINIDQNTIVYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAK-KNFDVLNHDERMMKRKEKVVVEVRVVFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFIKPPNMGITITTIKPITVQTPVNSDNNTSYRKLFEPNKNTLLKTILLKSRMNPSFNKRSTDKSNKLLLTEAKHIPIVARSKSTELPISEEKNRLALELRITAKFQKKVERDIFISFVMLYFFAHFMFILWLYFDAS----------KRRREMIEKDRQYKVN 603          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000012532.1 (SMESG000012532.1)

HSP 1 Score: 403.29 bits (1035), Expect = 5.852e-134
Identity = 205/322 (63.66%), Postives = 256/322 (79.50%), Query Frame = 1
Query:  568 ADRLIEAIESLRYSIQDNTQMH------CRSQQRGKT-----RRRMSTYGNKSQGRGENHSVIGNDN-LKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYM 1497
             D+LI A+E LR +I  NT ++       RS+  G+      RR  + Y ++S+ + +N  V+ +D  +  RK+KV VE+R+VFLKIGEIDTLKE+YHADAFIQ+KWRE KLD   N+EL   D+D+ W+PLL+IDNIL+ETK+  WLTA  NE  E  +IERR++KGVFLETLELNDFPLDVQDLTIT+++ERPDSEID++PD  E+S INIQTFVDQQEWKLHEHVE+TKR++ QE++SS + HPCLSVTCRA+RRPGYFYWNVFL+MF I+GLSFATF+V   +AE RL+LSFTL LTSV FK+VI QSLP+ISYLTYM
Sbjct:  108 VDKLISALELLRINIDQNTIVYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAK-KNFDVLNHDERMMKRKEKVVVEVRVVFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYM 428          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000012532.1 (SMESG000012532.1)

HSP 1 Score: 402.905 bits (1034), Expect = 8.225e-134
Identity = 205/322 (63.66%), Postives = 256/322 (79.50%), Query Frame = 1
Query:  568 ADRLIEAIESLRYSIQDNTQMH------CRSQQRGKT-----RRRMSTYGNKSQGRGENHSVIGNDN-LKLRKDKVAVELRIVFLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYM 1497
             D+LI A+E LR +I  NT ++       RS+  G+      RR  + Y ++S+ + +N  V+ +D  +  RK+KV VE+R+VFLKIGEIDTLKE+YHADAFIQ+KWRE KLD   N+EL   D+D+ W+PLL+IDNIL+ETK+  WLTA  NE  E  +IERR++KGVFLETLELNDFPLDVQDLTIT+++ERPDSEID++PD  E+S INIQTFVDQQEWKLHEHVE+TKR++ QE++SS + HPCLSVTCRA+RRPGYFYWNVFL+MF I+GLSFATF+V   +AE RL+LSFTL LTSV FK+VI QSLP+ISYLTYM
Sbjct:  104 VDKLISALELLRINIDQNTIVYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAK-KNFDVLNHDERMMKRKEKVVVEVRVVFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYM 424          
The following BLAST results are available for this feature:
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRB24.891e-1324.83gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB24.891e-1324.83gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB25.563e-1324.83gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB25.563e-1324.83gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB38.158e-1322.34gamma-aminobutyric acid type A receptor beta3 subu... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lgc-462.230e-821.17Probable ligand-gated ion channel 46 [Source:UniP... [more]
gab-19.653e-825.70Gamma-aminobutyric acid receptor subunit beta [So... [more]
lgc-482.018e-721.17Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL... [more]
acc-27.979e-723.21Acetylcholine-gated chloride channel subunit acc-2... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG89161.280e-823.86gene:FBgn0030707 transcript:FBtr0301233[more]
CG89161.324e-823.86gene:FBgn0030707 transcript:FBtr0301232[more]
CG69271.409e-726.42gene:FBgn0029733 transcript:FBtr0070721[more]
HisCl12.766e-721.80gene:FBgn0037950 transcript:FBtr0301826[more]
HisCl16.592e-721.35gene:FBgn0037950 transcript:FBtr0082471[more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrb42.353e-1325.37gamma-aminobutyric acid type A receptor beta4 subu... [more]
gabrg13.122e-1325.18gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrb43.187e-1325.37gamma-aminobutyric acid type A receptor beta4 subu... [more]
gabrg14.139e-1325.18gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrg28.423e-1224.05gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRG23.961e-1325.45gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
GABRG24.787e-1325.45gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
dusp56.192e-1323.97dual specificity phosphatase 5 [Source:Xenbase;Acc... [more]
ENSXETT00000020814.14.044e-1223.30gamma-aminobutyric acid type A receptor theta subu... [more]
ENSXETT00000020832.15.381e-1223.30gamma-aminobutyric acid type A receptor theta subu... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gabrg31.926e-1323.79gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb24.402e-1324.83gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb25.474e-1324.83gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrg26.249e-1324.92gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrg28.861e-1324.92gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P27681|GBRG3_MOUSE1.347e-1223.79Gamma-aminobutyric acid receptor subunit gamma-3 O... [more]
sp|P28473|GBRG3_RAT1.551e-1223.79Gamma-aminobutyric acid receptor subunit gamma-3 O... [more]
sp|D1LYT2|GBRB2_MACMU2.349e-1224.83Gamma-aminobutyric acid receptor subunit beta-2 OS... [more]
sp|P47870|GBRB2_HUMAN2.349e-1224.83Gamma-aminobutyric acid receptor subunit beta-2 OS... [more]
sp|P63137|GBRB2_MOUSE3.079e-1224.83Gamma-aminobutyric acid receptor subunit beta-2 OS... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MAS84.975e-18058.36Neur_chan_LBD domain-containing protein OS=Opistho... [more]
A0A1S8X8L45.698e-17962.53Neur_chan_LBD domain-containing protein (Fragment)... [more]
A0A4S2M9978.780e-17856.04Neur_chan_LBD domain-containing protein OS=Opistho... [more]
A0A4S2MAZ82.507e-17758.15Neur_chan_LBD domain-containing protein OS=Opistho... [more]
A0A267EWJ23.341e-17558.26Neur_chan_LBD domain-containing protein OS=Macrost... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrg12.898e-1325.18gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrb49.490e-1325.26gamma-aminobutyric acid receptor subunit beta-4-li... [more]
gabrb49.940e-1325.26gamma-aminobutyric acid receptor subunit beta-4-li... [more]
gabrb31.921e-1222.25gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb2a1.669e-1123.21gamma-aminobutyric acid type A receptor beta2 subu... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra23.142e-923.59glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000002305.13.279e-923.11pep scaffold:Pmarinus_7.0:GL478144:76380:93696:1 g... [more]
gabra6a1.534e-824.82gamma-aminobutyric acid (GABA) A receptor, alpha 6... [more]
gabrb37.214e-825.20gamma-aminobutyric acid type A receptor beta3 subu... [more]
glra4a1.038e-721.43glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327902.627e-3630.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268591.537e-1632.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375559.995e-1525.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373961.771e-1224.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354102.094e-1024.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrg12.156e-1325.55gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrb44.309e-1324.76gamma-aminobutyric acid receptor subunit beta-4 [S... [more]
gabrb46.394e-1325.60gamma-aminobutyric acid receptor subunit beta-4 [S... [more]
gabrb46.907e-1325.37gamma-aminobutyric acid receptor subunit beta-4 [S... [more]
glra21.782e-1224.15glycine receptor alpha 2 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008589.10.000e+0100.00SMESG000008589.1[more]
SMESG000008589.10.000e+0100.00SMESG000008589.1[more]
SMESG000012532.11.069e-15651.68SMESG000012532.1[more]
SMESG000012532.15.852e-13463.66SMESG000012532.1[more]
SMESG000012532.18.225e-13463.66SMESG000012532.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019864 ID=SMED30019864|Name=Neur_chan_LBD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2224bp
CTGAACTCTACAATTCTGTATTCGTTCGAGGTGTTGGTGTGCCAAGTTAC
TCATGAGACTCGTTGCTGCCATGACAACCATTACAACAATGCTGGTGTGT
GTTAGTCATCTTGTTTCTCATTTCATTTAAACTAACTCATCTTTGTTTTT
CTTCCCGATTTTATATTGATTCATCTTGTAATAAATAATTATTCAATGTC
TTTACTGGAAACTGTAGATGAAGATGAAAGTTCTTTATTAGTTAAAGATA
CAAAATTCATAAATAAACACGAAGTTAAGTGGATGCCGTTAAAACGATTT
AAAAAAGACATTTATCGAGCAATCGATCAAGACGATGATGACAGCTTCAT
TAGTCAGGCTTATGAACTAAATCGCAAACAATCGGATCTTAGTGAACTAG
TGGATATTGACATTTACGAATTGGAGGGTTTGTCAAATAAAAGTCACAAT
CGTAATCCCAATGGAACAATTTTAAATGAATCGCCTTTAACACCAACGAT
GAGACGGACAGTAAATTCTGCCAGTCGTGAAGCAATAAATAAAGCTGAAT
ATTCAACAATCAGTCCCGCAGATCGATTAATAGAAGCCATTGAATCTTTG
AGATATTCCATTCAGGATAATACACAGATGCATTGCCGGTCACAGCAACG
AGGAAAAACTAGACGTCGAATGTCAACATATGGAAACAAAAGTCAGGGCA
GAGGAGAAAATCACAGCGTAATAGGAAATGATAATTTGAAATTGAGGAAA
GATAAGGTAGCGGTTGAGCTTAGAATCGTGTTTTTGAAAATTGGTGAAAT
TGACACTCTAAAAGAACTTTATCACGCTGATGCTTTCATTCAAGCAAAAT
GGCGAGAACCGAAATTAGATGGCCACACTAATGAGGAACTTGCAACTACG
GATATGGACAAATATTGGAGTCCATTGCTTTATATAGATAATATTTTAAG
TGAAACTAAAGAGGCTCAGTGGTTGACAGCAGTAGCTAATGAGAGTTTGG
AGGTAACAGTAATAGAGAGACGACGTATAAAGGGAGTTTTCTTAGAAACT
TTAGAGTTAAATGATTTCCCATTAGATGTGCAGGATTTAACGATTACTAT
GACAACAGAGCGCCCGGATTCTGAGATAGATTTGATTCCAGATCAGACGG
AAATGAGTGCAATCAATATACAAACCTTTGTAGATCAGCAGGAATGGAAG
CTGCATGAACATGTTGAAATAACAAAAAGGATCATTTTACAAGAATTTTC
CAGTTCAATGAAAAGTCATCCATGTCTTTCTGTGACATGTAGAGCTGCTC
GGAGACCAGGTTATTTCTACTGGAACGTTTTTCTTATAATGTTCATGATC
TCAGGATTATCCTTTGCAACCTTTTCCGTGTCACCAGAGAAAGCAGAATA
TAGACTTAGATTATCATTTACTTTGGTTCTTACTTCAGTTACATTCAAAT
ATGTTATCACTCAAAGCCTCCCAAAAATATCATATCTGACATATATGGAC
AAATATGTTTTAATGTCTCTAGCTATATTATGCATTGTCAGTATTTGGCA
TGCTTGTGTAACACTAGTGCCGCATGTTTCTAAAGTAACTAATGGCCCAA
TATCTAATTCCAGCAGTATTATAAATCGAATTAATTCTTCTTACAGCAAA
GAATTCCAAAAAAGATTGGAGGAAAAGAGTCCTTTTATGAAATCAGTAAT
TAACACCGTCAACAACGATAATGATAAAAAAGATGAAGTGCAAGAAGACG
AAACAGGCGAAAGGGTTTTAACTCCTGGAGAAATAAAACTTTTAAGAAGA
ATCGAACGAGACGTACTAATTTCTTTTGGTTGTCTATACATCATCGCACA
TTGTATATTCATATTCTGGTTATATTTTGATGCTAGTAGAAGACGCCGAT
TAATGAGGCAAAAGGATCGGGATTATAGGGAATTTTTGCAAAAAAACCGA
GAATGGCAACAGAATACTAAGAAACGACGCGATCAAATGCATGCTCGTAG
ATGCAGTGTCCCAATGCATGTGCTATAACATAATGCATGAGCCTTTACTA
CTTATAAATTAATTATCATCATTTTAAAACAAAGGATATCAGTATGATGC
CAAAACTTTCAAAATGAAATTGTGATAATATTTTCATGTCGAATTTGTTA
ATTAAATTTAAATATAAAAACTAATATATTTTAATATTATTTTTAACGGA
ATGTTTTTTAATTTAAAATATTAC
back to top

protein sequence of SMED30019864-orf-1

>SMED30019864-orf-1 ID=SMED30019864-orf-1|Name=SMED30019864-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=611bp
MSLLETVDEDESSLLVKDTKFINKHEVKWMPLKRFKKDIYRAIDQDDDDS
FISQAYELNRKQSDLSELVDIDIYELEGLSNKSHNRNPNGTILNESPLTP
TMRRTVNSASREAINKAEYSTISPADRLIEAIESLRYSIQDNTQMHCRSQ
QRGKTRRRMSTYGNKSQGRGENHSVIGNDNLKLRKDKVAVELRIVFLKIG
EIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNI
LSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTI
TMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQE
FSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKA
EYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSI
WHACVTLVPHVSKVTNGPISNSSSIINRINSSYSKEFQKRLEEKSPFMKS
VINTVNNDNDKKDEVQEDETGERVLTPGEIKLLRRIERDVLISFGCLYII
AHCIFIFWLYFDASRRRRLMRQKDRDYREFLQKNREWQQNTKKRRDQMHA
RRCSVPMHVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR006201Neur_channel
IPR036719Neuro-gated_channel_TM_sf
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 570..590
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 371..485
e-value: 1.6E-20
score: 75.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..170
NoneNo IPR availablePANTHERPTHR18945:SF768coord: 162..507
NoneNo IPR availableCDDcd19050LGIC_TM_bactcoord: 373..444
e-value: 4.67764E-19
score: 81.1006
NoneNo IPR availableCDDcd18988LGIC_ECD_bactcoord: 188..370
e-value: 6.38805E-17
score: 76.9478
NoneNo IPR availableTMHMMTMhelixcoord: 437..459
NoneNo IPR availableTMHMMTMhelixcoord: 373..395
NoneNo IPR availableTMHMMTMhelixcoord: 540..561
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 184..355
e-value: 3.9E-8
score: 33.0
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 180..366
e-value: 1.1E-17
score: 66.1
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 186..367
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 162..507
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 371..558