Peptidase M60 domain-containing protein

Overview
NamePeptidase M60 domain-containing protein
Smed IDSMED30019854
Length (bp)3244
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase M60 domain-containing protein (SMED30019854) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase M60 domain-containing protein (SMED30019854) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2C (TRPM8 channel associated factor 2C [Source:HGNC Symbol;Acc:HGNC:53641])

HSP 1 Score: 146.362 bits (368), Expect = 2.068e-35
Identity = 104/373 (27.88%), Postives = 177/373 (47.45%), Query Frame = 2
Query: 1943 GLYLYPRLKTPVKIIQSK-STRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENND--KVEIIFKNVIQIPYY--DRRNKDEW-IQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQ-XXXXXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTI----ERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            GLYL       V + ++  S    + +  H  ++    ++++ PV      ++R +  ++   +GGL+ +   + +    V +  +  +  PYY   + + +EW  Q Q+  +PW  LA D ++  + +T ++ L DPE +L+++D M +    L    FPF R   + +D+QI  G+MHSGYPI   +             N+  ++  G WG +HE+GHN Q  G      T E T N++S+   E++             HE L+      R++ +L  G    +W  N + AL  Y Q++  FGWE + Q+F  Y  L+H  +      ++ LW+K  SE    NL P +E W WPI  +    L+ LP
Sbjct:  341 GLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKE------IINEMDMRSRGVWGPIHELGHNQQWHGWEFPPHTTEATCNLWSVYVHETVLG-----IPRAQAHEALSPPERERRIKAHLGKGAPLCDW--NVWTALETYLQLQQAFGWEPFTQLFAEYQTLSHLPK--DNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASLP 697          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 147.132 bits (370), Expect = 2.782e-35
Identity = 103/373 (27.61%), Postives = 176/373 (47.18%), Query Frame = 2
Query: 1943 GLYLYPRLKTPVKIIQSK-STRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENN--DKVEIIFKNVIQIPYY--DRRNKDEW-IQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTI----ERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            GLYL       V + ++  S    + +  H  ++    ++++ PV      ++R +  ++   +GGL+ +   + +    V +  +  +  PYY   + + +EW  Q Q+  +PW  LA D ++  + +T ++ L DPE +L+++D M +    L    FPF R   + +D+QI  G+MHSGYPI   +             N+  ++  G WG +HE+GHN Q         T E T N++S+   E++             HE L+      R++ +L  G    +W  N + AL  Y Q++  FGWE + Q+F  Y  L+H  +      ++ LW+K  SE    NL P +E W WPI  +    L+ LP
Sbjct:  548 GLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKE------IINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLG-----IPRAQAHEALSPPERERRIKAHLGKGAPLCDW--NVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHLPK--DNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASLP 904          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 146.747 bits (369), Expect = 3.214e-35
Identity = 103/373 (27.61%), Postives = 176/373 (47.18%), Query Frame = 2
Query: 1943 GLYLYPRLKTPVKIIQSK-STRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENND--KVEIIFKNVIQIPYY--DRRNKDEW-IQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTI----ERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            GLYL       V + ++  S    + +  H  ++    ++++ PV      ++R +  ++   +GGL+ +   + +    V +  +  +  PYY   + + +EW  Q Q+  +PW  LA D ++  + +T ++ L DPE +L+++D M +    L    FPF R   + +D+QI  G+MHSGYPI   +             N+  ++  G WG +HE+GHN Q         T E T N++S+   E++             HE L+      R++ +L  G    +W  N + AL  Y Q++  FGWE + Q+F  Y  L+H  +      ++ LW+K  SE    NL P +E W WPI  +    L+ LP
Sbjct:  444 GLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKE------IINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLG-----IPRAQAHEALSPPERERRIKAHLGKGAPLCDW--NVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHLPK--DNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASLP 800          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 146.747 bits (369), Expect = 3.214e-35
Identity = 103/373 (27.61%), Postives = 176/373 (47.18%), Query Frame = 2
Query: 1943 GLYLYPRLKTPVKIIQSK-STRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENND--KVEIIFKNVIQIPYY--DRRNKDEW-IQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTI----ERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            GLYL       V + ++  S    + +  H  ++    ++++ PV      ++R +  ++   +GGL+ +   + +    V +  +  +  PYY   + + +EW  Q Q+  +PW  LA D ++  + +T ++ L DPE +L+++D M +    L    FPF R   + +D+QI  G+MHSGYPI   +             N+  ++  G WG +HE+GHN Q         T E T N++S+   E++             HE L+      R++ +L  G    +W  N + AL  Y Q++  FGWE + Q+F  Y  L+H  +      ++ LW+K  SE    NL P +E W WPI  +    L+ LP
Sbjct:  444 GLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKE------IINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLG-----IPRAQAHEALSPPERERRIKAHLGKGAPLCDW--NVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHLPK--DNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASLP 800          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF1 (TRPM8 channel associated factor 1 [Source:HGNC Symbol;Acc:HGNC:22201])

HSP 1 Score: 137.502 bits (345), Expect = 2.705e-32
Identity = 101/370 (27.30%), Postives = 175/370 (47.30%), Query Frame = 2
Query: 1943 GLYLYPRLKTPVKIIQSK-STRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENN--DKVEIIFKNVIQIPYY--DRRNKDEWIQK-QKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTN-QNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            GLY+  R    V + ++  S    I +  H  ++   S++ + P+      +++   ++I   +GGL+ I   +N+    V +  K  +  PYY       +EW ++ Q+   PW  LA D ++  + +  +R L +PE +L+++D + +    L    FP      + +D+QI VG+MH+GYPI   +             N+++++  G WG +HE+G N Q         T E T N++ +   E++     S +  + W   R   +RV+ YL  G    NW  N + AL  Y Q++  FGWE + ++F  Y   T+        +K+ LW+K+ S     NL P +E W WPI  +    L+ LP
Sbjct:  548 GLYIPGRQIIEVSLPEAAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPT-KSITCLWGGLLYIIVPQNSKLGSVPVTVKGAVHAPYYKLGETTLEEWKRRIQENPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQE------LINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVRE--KRVRIYLSKGPNVKNW--NAWTALETYLQLQEAFGWEPFIRLFTEYRNQTN--LPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSLAYLP 904          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 63.929 bits (154), Expect = 6.028e-10
Identity = 37/88 (42.05%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  344 NWCKDSDKGTEYLGDISHTKSGKLCQPWI-----NFGTHRAYSFPERNLKFAGNKCRNPDMSKV-PWCYYSNNYQREDCNVPRCDKEI 589
            +WC   + GT+Y G ++ T SGK C PWI     +F  HR   FPE  L  + N CRNP   K  PWCY     Q E C+VP+C  ++
Sbjct:  193 HWCY-VNSGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHR---FPE--LMNSKNYCRNPGGKKSRPWCYSKPMGQEEYCDVPQCPSDM 274          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 63.929 bits (154), Expect = 6.103e-10
Identity = 37/88 (42.05%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  344 NWCKDSDKGTEYLGDISHTKSGKLCQPWI-----NFGTHRAYSFPERNLKFAGNKCRNPDMSKV-PWCYYSNNYQREDCNVPRCDKEI 589
            +WC   + GT+Y G ++ T SGK C PWI     +F  HR   FPE  L  + N CRNP   K  PWCY     Q E C+VP+C  ++
Sbjct:  326 HWCY-VNSGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHR---FPE--LMNSKNYCRNPGGKKSRPWCYSKPMGQEEYCDVPQCPSDM 407          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 63.929 bits (154), Expect = 6.331e-10
Identity = 37/88 (42.05%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  344 NWCKDSDKGTEYLGDISHTKSGKLCQPWI-----NFGTHRAYSFPERNLKFAGNKCRNPDMSKV-PWCYYSNNYQREDCNVPRCDKEI 589
            +WC   + GT+Y G ++ T SGK C PWI     +F  HR   FPE  L  + N CRNP   K  PWCY     Q E C+VP+C  ++
Sbjct:  352 HWCY-VNSGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHR---FPE--LMNSKNYCRNPGGKKSRPWCYSKPMGQEEYCDVPQCPSDM 433          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.3 (si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-13])

HSP 1 Score: 150.984 bits (380), Expect = 1.149e-36
Identity = 124/430 (28.84%), Postives = 200/430 (46.51%), Query Frame = 2
Query: 1805 LLSEIGKDLI-----PPALSLYPGKFQSTNPPFVNIKMKL--NLLYKYEVAPLGLYLYPRLKTPVKIIQSK-STRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENN--DKVEIIFKNVIQIPYYDRRNKD--EWIQK-QKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTI----ERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDE--KIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMF 3034
            ++  IGK++      P AL  Y  K +   P   N ++++  N     E    GLYL P +KT + I Q    T   + +     NI   + + + PV ++ F ++  K +     +GGL+       +  D VEI+ +  +Q PY+        +W+ K ++  +PWA L  + +V  L S  IRNL  P+ + +++D++ +    L  T   F R+     D+QI  G+MHSGYPI            +    N +   K   WG +H++GHN Q         T E T N++S+   E +   N         H  +T+    ER+++Y   G    NW  N + AL  Y Q++  FGW+ + +VF  Y    H  + +  D   K+ L+ K  S++   NL P +++W WPI   TEQELS LP +
Sbjct:  492 MMLHIGKEVYKVTPDPDALLPYIIKDRPNLPTVSNARVRITANTADSEEWISTGLYLCPGMKTYITIPQEIIGTNWQVQLGCQTNNIGGSNVLKRAPVVHERFPLDSEKVQVCNL-WGGLIYFVAPPESKVDGVEIVVQTAVQAPYFKSGETSVADWVGKIRQRPAPWAELEFENLVMTLPSDFIRNLERPDQVAKLWDAIMRSVSDLAATPAKFPRKERFVGDVQISAGFMHSGYPIMML------SSSASELLNVKEAHKHDFWGPLHKLGHNQQRKVWEFPPHTTECTCNLWSVYVHEKVLGVNKAKA-----HPCMTLQSRQERIKEYFSGGKDFENW--NTWTALETYMQLQEKFGWDAFKKVFSLY----HDMKDVPNDNAGKMNLYAKTFSKVVNHNLSPFFKVWGWPIQPNTEQELSHLPAW 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.2 (si:ch211-210b2.2 [Source:ZFIN;Acc:ZDB-GENE-131118-33])

HSP 1 Score: 147.517 bits (371), Expect = 1.398e-35
Identity = 115/398 (28.89%), Postives = 184/398 (46.23%), Query Frame = 2
Query: 1889 VNIKMKLNLLYKYEVAPLGLYLYPRLKT----PVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENN--DKVEIIFKNVIQIPYYDRRNKD--EWIQK-QKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIER----VQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDE--KIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMF 3034
              +++  N     E    GLYL P +KT    P +II    T+  + +     NI   + + + PV ++ F ++  K +     +GGL+       +  D VEI+ +  +Q PY+        +W+ K ++  +PWA L  + +V  L S  IRNL  P+ + +++D++ +    L  T   F R+     D+QI  G+MHSGYPI            +    N +   K   WG +HE+GHN Q         T E T N++S+   E +   N         H  +T+E     ++KY   G    NW +    AL  Y Q++  FGW+ + +VF  Y    H  + +  D   K+ L+ K  S++   NL P +++W WPI   TEQELS LP +
Sbjct:  523 ARVRITANTADSEEWISTGLYLSPGMKTYITIPPEII---GTKWQVQLGCQTDNIGGSNVLKRAPVVHERFPLDSEKVQVCNL-WGGLIYFVAPPESKVDGVEIVVQTAVQAPYFKSGETSVADWVGKIRQRPAPWAELEFENLVMTLPSDFIRNLERPDEVAKLWDAIMRSVSDLAATPAKFRRKERFVGDVQISAGFMHSGYPIMML------SSSASQLLNVKEAHKHDFWGPLHELGHNQQRKVWEFPPHTTECTCNLWSVYVHEKVLGVNKAKA-----HPCMTLESRQACIKKYFSGGKDLKNWTKA--TALETYMQLQEKFGWDAFKKVFSLY----HDMKDVPNDNAGKMNLYAKTFSKVVNHNLSPFFKVWGWPIQPNTEQELSHLPAW 899          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.4 (si:ch211-210b2.4 [Source:ZFIN;Acc:ZDB-GENE-131122-12])

HSP 1 Score: 143.28 bits (360), Expect = 3.199e-34
Identity = 119/419 (28.40%), Postives = 190/419 (45.35%), Query Frame = 2
Query: 1826 DLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKT----PVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENN--DKVEIIFKNVIQIPYYDRRNKD--EWIQK-QKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIER----VQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDE--KIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMF 3034
            DL+P  +   P     +N     +++  N     E    GLYL P +KT    P +II+ K     + +     +I     + + PV ++ F ++  K +     +GGL+       +  D VEI+ +  +Q PY+        +W+ K ++  +PWA L  + +V  L S  IRNL  P+ + +++D++ +    L  T   F R+     D+QI  G+MHSGYPI            +    N +   K   WG +HE+GHN Q         T E T N++S+   E +   N         H  +T+E     ++KY   G    NW +    AL  Y Q++  FGW+ + +VF  Y    H  + +  D   K+ L+ K  S++   NL P ++ W WPI   TEQELS LP +
Sbjct:  509 DLLPYIIKDRPNLPTVSN---ARVRITANTAGCEEWISTGLYLSPGMKTYITIPPEIIEKK---WQVQLGCQTDDIGRLKILKRAPVVHEQFPLDSEKVQVCNL-WGGLIYFVAPPKSKVDGVEIVVQTAVQAPYFKSGETSVADWVGKIRQRPAPWAELEFENLVMTLPSDLIRNLERPDEVAELWDAIMRSVSDLAATPAKFPRKERFVGDVQISAGFMHSGYPIMML------SSSASQLLNVKEAHKHDFWGPLHELGHNQQRKVWEFPPHTTECTCNLWSVYVHEKVLGVNRAKA-----HPCMTLESRQACIKKYFSGGKDLKNWTKA--TALETYMQLQEKFGWDAFKKVFSLY----HDMKDVPNDNAGKMNLYAKTFSKVVNHNLSPFFKTWGWPIQPNTEQELSHLPAW 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162193 (zgc:162193 [Source:NCBI gene;Acc:323315])

HSP 1 Score: 129.028 bits (323), Expect = 8.245e-30
Identity = 112/423 (26.48%), Postives = 187/423 (44.21%), Query Frame = 2
Query: 1835 PPALSLYPGKFQSTNPPFVNIKMKL--NLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCY-IYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQF--PFGGLMSISCNENN--DKVEIIFKNVIQIPYYDRRNKD--EWIQK-QKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXXXXXXXXXXXXXXIFSIIATESMTN-------QNSWSQTSGWFHERLTI----ERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDE--KIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMF 3034
            P AL  Y  K +   P   N ++++  N     E    GLYL P +KT + +      + + + +     NI   + + + PV +  F ++    E +Q    +GGL+ +        D VEI+ +  +Q PY+        +W+   ++  +PWA L  + ++    S  IRNL  P+ + +++D++ +    L        R+    +D+QI  G+MH+GYPI   ++  + P       N E   K G WG +HE+GHN Q G +            F    TE   N       +  +   S   H  +T      R + Y   G   N+W    ++AL  Y Q++  FGW+ + +VF  Y    H    +  D   K+ L+ +  S++  +NL P ++ W WPI   TEQ LS LP +
Sbjct:  507 PDALLPYIIKDRPNLPTLSNARVRITANTGGCEEWISTGLYLSPGMKTYIAVPPEIVGKNWQVQLGCQTDNIGGSNTLKRAPVVHARFPLDS---EMVQVWNLWGGLIYLIAPSQTKVDGVEIVVQTAVQAPYFKSGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLDRPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPI--MMHSGSAP----GLVNVEEAYKCGLWGAIHELGHNQQRGVWE-----------FPPHTTECTCNLWSLYVHEQVFGIKSANAHPAITPADRQARTKMYFDGGKDLNSW--CMWMALETYMQLQEKFGWDAFKKVFSLY----HDMTGVPNDNAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHLPAW 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162193 (zgc:162193 [Source:NCBI gene;Acc:323315])

HSP 1 Score: 129.028 bits (323), Expect = 8.245e-30
Identity = 112/423 (26.48%), Postives = 187/423 (44.21%), Query Frame = 2
Query: 1835 PPALSLYPGKFQSTNPPFVNIKMKL--NLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCY-IYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQF--PFGGLMSISCNENN--DKVEIIFKNVIQIPYYDRRNKD--EWIQK-QKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXXXXXXXXXXXXXXIFSIIATESMTN-------QNSWSQTSGWFHERLTI----ERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDE--KIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMF 3034
            P AL  Y  K +   P   N ++++  N     E    GLYL P +KT + +      + + + +     NI   + + + PV +  F ++    E +Q    +GGL+ +        D VEI+ +  +Q PY+        +W+   ++  +PWA L  + ++    S  IRNL  P+ + +++D++ +    L        R+    +D+QI  G+MH+GYPI   ++  + P       N E   K G WG +HE+GHN Q G +            F    TE   N       +  +   S   H  +T      R + Y   G   N+W    ++AL  Y Q++  FGW+ + +VF  Y    H    +  D   K+ L+ +  S++  +NL P ++ W WPI   TEQ LS LP +
Sbjct:  507 PDALLPYIIKDRPNLPTLSNARVRITANTGGCEEWISTGLYLSPGMKTYIAVPPEIVGKNWQVQLGCQTDNIGGSNTLKRAPVVHARFPLDS---EMVQVWNLWGGLIYLIAPSQTKVDGVEIVVQTAVQAPYFKSGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLDRPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPI--MMHSGSAP----GLVNVEEAYKCGLWGAIHELGHNQQRGVWE-----------FPPHTTECTCNLWSLYVHEQVFGIKSANAHPAITPADRQARTKMYFDGGKDLNSW--CMWMALETYMQLQEKFGWDAFKKVFSLY----HDMTGVPNDNAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHLPAW 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045101.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 153.295 bits (386), Expect = 3.240e-37
Identity = 111/377 (29.44%), Postives = 181/377 (48.01%), Query Frame = 2
Query: 1943 GLYLYPRLKTPVKIIQSKSTR--CYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNE--NNDKVEIIFKNVIQIPYY--DRRNKDEWIQK-QKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISED--EKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPD 3043
            GLYL P+ KT V +  + + +    + V  H  ++  K E  + P+  +  ++ R K +   + +GGL+ I   E  N   + +        P Y   + + D W+Q  + +  PWA L  + ++  + S AIR+L DPE +L  +D M      L      FSR   + +D+QI  G+MH+GYP+   +          Y  N   ++K+G WG +HE+GHN Q+        T E T N++S+   E++       + +           ++ YL +G    NW  N + AL  Y Q++  FGWE + Q+F+ Y +++     IS D   K+ LW +  SE    NL P +E W WPI  +T  +LS LP++  D
Sbjct:  533 GLYLSPK-KTAVLVFPASAVQQGLQVQVGCHSDDLGSKDEFYRAPIVVRKISVHREKVQVSCY-WGGLLYIIVKERSNLGTIPVQVYGAEPAPTYIKGKTSLDSWLQSLRDLPPPWAELITENIILTVPSDAIRSLNDPEELLGFWDRMMVAITELAAIPTTFSRPERIVADVQISAGWMHAGYPVMVHLASVK------YLTNLSCMQKEGLWGPIHELGHNQQQKVWEFPPHTTEATCNLWSVFVNETVVGVPR-DKANSALEPASRAACIEAYLKTGPKLENW--NVWTALETYLQLQEGFGWEPFKQLFKDYQSMS----GISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEETRSKLSALPVWEKD 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045059.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 140.969 bits (354), Expect = 1.971e-33
Identity = 107/379 (28.23%), Postives = 180/379 (47.49%), Query Frame = 2
Query: 1943 GLYLYPR----LKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSI--SCNENNDKVEIIFKNVIQIPYY--DRRNKDEWIQKQK-IESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISED--EKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPD 3043
            GLYL PR    L+ P  ++Q       + V     +++   +  + PV  +   ++R K     F +GGL+ I    N N   + +        P Y   + N D W+Q  + + +PWA L  + ++  + S AIR+L+DPE +L ++D +      L      F R     +D+QI  G+MH+GYPI   +        +    +  +++  G WG +HE+GHN Q+        T E T N++S+   E++      ++  G          +Q+Y+ +G+    W  + + AL  Y Q++  FGWE + Q+F+ Y +++     IS D   K+ LW +  SE    NL P +E W WPI  +T  +LS LP++  D
Sbjct:  533 GLYLAPRKTAVLEFPASVVQQG---LKVQVGCQADDLSSAEKYCRAPVVVRKCHVDRQKVSVSCF-WGGLLYIIVKANSNLGIIPVKVYGAEPAPVYIKGKTNLDSWLQSVRYLPAPWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVSITELAAIPKTFPRPERFVADVQISAGWMHAGYPIMCHL------ESAKELTDLNVMQTVGIWGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPR-NKAHGSLQPETRACYIQEYVKNGSNLEQW--DVWTALETYLQLQEGFGWEPFKQLFKDYQSMS----GISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEETRSKLSALPVWEKD 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045084.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 137.117 bits (344), Expect = 3.365e-32
Identity = 106/379 (27.97%), Postives = 179/379 (47.23%), Query Frame = 2
Query: 1943 GLYLYPR----LKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSI--SCNENNDKVEIIFKNVIQIPYY--DRRNKDEWIQKQK-IESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISED--EKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPD 3043
            GLYL PR    L+ P  ++Q       + V     +++   +  + PV  +   ++R K     F +GGL+ I    N N   + +        P Y   + N D W+Q  + + +PWA L  + ++  + S AIR+L+DPE +L ++D +      L      F R     +D+QI  G+MH+GYPI   +        +    +  +++  G WG +HE+GHN Q+        T E T N++S+   E++      ++  G          +Q+Y+ +G+    W  + + AL  Y Q++  FGWE + ++F+ Y +++     IS D   K+ LW +  SE    NL P +E W WPI   T  +LS LP++  D
Sbjct:  533 GLYLAPRKTAVLEFPASVVQQG---LKVQVGCQADDLSSAEKYCRAPVVVRKCHVDRQKVSVSCF-WGGLLYIIVKANSNLGIIPVKVYGAEPAPVYIKGKTNLDSWLQSVRYLPAPWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVSITELAAIPKTFPRPERFVADVQISAGWMHAGYPIMCHL------ESAKELTDLNVMQTVGIWGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPR-NKAHGSLQPETRACYIQEYVKNGSNLEQW--DVWTALETYLQLQEGFGWEPFKRLFKDYQSMS----GISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEATRIKLSALPVWEKD 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045039.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 136.346 bits (342), Expect = 5.651e-32
Identity = 106/379 (27.97%), Postives = 179/379 (47.23%), Query Frame = 2
Query: 1943 GLYLYPR----LKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSI--SCNENNDKVEIIFKNVIQIPYY--DRRNKDEWIQKQK-IESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISED--EKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPD 3043
            GLYL PR    L+ P  ++Q       + V     +++   +  + PV  +   ++R K     F +GGL+ I    N N   + +        P Y   + N D W+Q  + + +PWA L  + ++  + S AIR+L+DPE +L ++D +      L      F R     +D+QI  G+MH+GYPI   +        +    +  +++  G WG +HE+GHN Q+        T E T N++S+   E++      ++  G          +Q+Y+ +G+    W  + + AL  Y Q++  FGWE + ++F+ Y +++     IS D   K+ LW +  SE    NL P +E W WPI   T  +LS LP++  D
Sbjct:  533 GLYLAPRKTAVLEFPASVVQQG---LKVQVGCQADDLSSAEKYCRAPVVVRKCHVDRQKVSVSCF-WGGLLYIIVKANSNLGIIPVKVYGAEPAPVYIKGKTNLDSWLQSVRYLPAPWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVSITELAAIPKTFPRPERFVADVQISAGWMHAGYPIMCHL------ESAKELTDLNVMQTVGIWGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPR-NKAHGSLQPETRACYIQEYVKNGSNLEQW--DVWTALETYLQLQEGFGWEPFKRLFKDYQSMS----GISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEATRIKLSVLPVWEKD 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000002244.1 (TRPM8 channel-associated factor homolog [Source:NCBI gene;Acc:100489234])

HSP 1 Score: 130.183 bits (326), Expect = 4.577e-30
Identity = 98/374 (26.20%), Postives = 173/374 (46.26%), Query Frame = 2
Query: 1943 GLYLYPRLKTPVKIIQSKSTRCY-IYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSI--SCNENNDKVEIIFKNVIQIPYY--DRRNKDEWIQK-QKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPD 3043
            GLYL PR    ++   S   + + + V  H  + + K  + + PV  +   ++R K     F +GGL+ I    N N   V +        P Y   + + D W+   +++ +PWA L  + ++  + S A+R+L +PE +L ++D +      L      F R   + +D+QI  G+MH+GYPI   +        +    +   ++K+G WG +HE+GHN Q+        T E T N++++   E++       +  G     +   R++ YL +G     W  + + AL  Y Q++   GW+ + +++R  +       S     K+ LW +  S  +  NL P +E W WPI   T  +LS LP++  D
Sbjct:  511 GLYLPPRKAVVIEFPASAVQQGFQVQVGCHSDDPSAKETLNRAPVVVRRIHVDRQKVPVSSF-WGGLLYIIVRSNSNFGTVPVRVYGAEPAPIYIKGKTSLDSWLHSIRQLPAPWAELVTENIILTVPSDAVRSLKNPEALLSLWDRIMAAIADLAAKPKKFPRPERIVADVQISAGWMHAGYPIMCDL------ESAKELTDLHHMEKEGIWGPIHELGHNQQKTQWEFPPHTTEATCNLWAVYVHETVLGIPR-DRAHGNLQPNVRTSRIKSYLQNGANLEQW--DGWTALETYLQLQEGLGWDPFRRLYRDPSI---SGMSNENTFKMNLWAEKFSRAAQTNLVPFFEAWGWPIDQSTRSKLSALPVWEKD 871          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 148.673 bits (374), Expect = 6.739e-36
Identity = 117/422 (27.73%), Postives = 204/422 (48.34%), Query Frame = 2
Query: 1808 LSEIGKDL---IPPALSLYPGKF--QSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSK-STRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENN--DKVEIIFKNVIQIPYY--DRRNKDEWIQKQKIE--SPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTN-QNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISED-EKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            L+  G DL   IP    +Y  ++   S +P  VN+    N   +Y     GLY+  R    V + +S  S    I +  H  ++   S++ + P+      +++   ++I   +GGL+ I   +N+    V +  K  ++ P+Y     +K+EW +++ +E   PW  LA D ++  + +  +R L +PE +L+++D M +    L G +FP      + +D+QI VG+MH+GYPI   +             N+++++  G WG +HE+G N Q         T E T N++ +   E++     S +  + W   R   +RV+ YL  G    +W  N + AL  Y Q++  FGWE + ++F  Y   T      S++ +K+ LW+K+ S+    NL P +E W WPI  +    L+ LP
Sbjct:  499 LAHSGSDLSLLIPEIEDVYSSRYLRPSASPITVNVNCT-NPGTRYCWMSTGLYIPGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPT-KSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAPFYKLGETSKEEW-KRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQE------LINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVRE--KRVRIYLSKGPSVKHW--NAWTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYLP 907          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 148.673 bits (374), Expect = 6.739e-36
Identity = 117/422 (27.73%), Postives = 204/422 (48.34%), Query Frame = 2
Query: 1808 LSEIGKDL---IPPALSLYPGKF--QSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSK-STRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENN--DKVEIIFKNVIQIPYY--DRRNKDEWIQKQKIE--SPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTN-QNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISED-EKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            L+  G DL   IP    +Y  ++   S +P  VN+    N   +Y     GLY+  R    V + +S  S    I +  H  ++   S++ + P+      +++   ++I   +GGL+ I   +N+    V +  K  ++ P+Y     +K+EW +++ +E   PW  LA D ++  + +  +R L +PE +L+++D M +    L G +FP      + +D+QI VG+MH+GYPI   +             N+++++  G WG +HE+G N Q         T E T N++ +   E++     S +  + W   R   +RV+ YL  G    +W  N + AL  Y Q++  FGWE + ++F  Y   T      S++ +K+ LW+K+ S+    NL P +E W WPI  +    L+ LP
Sbjct:  499 LAHSGSDLSLLIPEIEDVYSSRYLRPSASPITVNVNCT-NPGTRYCWMSTGLYIPGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPT-KSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAPFYKLGETSKEEW-KRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQE------LINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVRE--KRVRIYLSKGPSVKHW--NAWTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYLP 907          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 148.673 bits (374), Expect = 6.739e-36
Identity = 117/422 (27.73%), Postives = 204/422 (48.34%), Query Frame = 2
Query: 1808 LSEIGKDL---IPPALSLYPGKF--QSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSK-STRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENN--DKVEIIFKNVIQIPYY--DRRNKDEWIQKQKIE--SPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTN-QNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISED-EKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            L+  G DL   IP    +Y  ++   S +P  VN+    N   +Y     GLY+  R    V + +S  S    I +  H  ++   S++ + P+      +++   ++I   +GGL+ I   +N+    V +  K  ++ P+Y     +K+EW +++ +E   PW  LA D ++  + +  +R L +PE +L+++D M +    L G +FP      + +D+QI VG+MH+GYPI   +             N+++++  G WG +HE+G N Q         T E T N++ +   E++     S +  + W   R   +RV+ YL  G    +W  N + AL  Y Q++  FGWE + ++F  Y   T      S++ +K+ LW+K+ S+    NL P +E W WPI  +    L+ LP
Sbjct:  499 LAHSGSDLSLLIPEIEDVYSSRYLRPSASPITVNVNCT-NPGTRYCWMSTGLYIPGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPT-KSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAPFYKLGETSKEEW-KRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQE------LINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVRE--KRVRIYLSKGPSVKHW--NAWTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYLP 907          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf3 (TRPM8 channel-associated factor 3 [Source:MGI Symbol;Acc:MGI:3042585])

HSP 1 Score: 141.354 bits (355), Expect = 1.362e-33
Identity = 109/373 (29.22%), Postives = 177/373 (47.45%), Query Frame = 2
Query: 1943 GLYLYPRLKTPVKIIQSKST--RCYIYVNHHHFNIADKSEVTKWPV-TYKYFTIERGKWETIQFPFGGLMSISCNE--NNDKVEIIFKNVIQIPYY--DRRNKDEW---IQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            GLYL P  +    ++ S++T  +  + +  H  NI+      + PV TY Y         +I + +GGL+ I      N D V +  +  +  PY+   +  ++EW   I   K  +PW  LA D ++  + +  ++ L DP  +LQ++D M +    L    FPF R   V  D QI  G++HSGYPI   I             ++  ++  G WG++HE+GHN Q+        T E   N+++I   E++ N     Q     +  L  +R++ +L  G   +NW    + AL  Y Q++  FGWE + QVF  Y  L+   +  + ++K+ LW+K  SE    NL P +E W WP+     + L+ LP
Sbjct:  539 GLYL-PEGQVAQVLLPSEATHAKLKVLIGCHRDNISQARTYFRPPVMTYVYHLTSSQT--SISWLYGGLLYIMVPNKYNQDNVSVTIRGAVSAPYFRLGKTTQEEWKNLITHSK--APWGELATDNIILTIPTVNLKELQDPYPLLQLWDKMVRAVAKLAARPFPFQRAERVVLDKQISFGFLHSGYPIMGLISIVEG------IISEFKIRSHGIWGVIHELGHNHQKSGWTFPPHTTEALCNLWTIYVHETVLNIPR-EQAHPSLNPELRRQRIKYHLNKGAPLSNWI--MWTALETYLQLQEGFGWEPFIQVFADYRTLSGLPQ--NNEDKMNLWVKKFSEAVHKNLAPFFEAWGWPVKYAVAKSLASLP 895          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf2 (TRPM8 channel-associated factor 2 [Source:MGI Symbol;Acc:MGI:2385258])

HSP 1 Score: 135.576 bits (340), Expect = 8.938e-32
Identity = 103/371 (27.76%), Postives = 175/371 (47.17%), Query Frame = 2
Query: 1943 GLYLYPRLKTPVKIIQ-SKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENN--DKVEIIFKNVIQIPYY--DRRNKDEWIQK-QKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDE--KIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            GLYL     T + + + + S    + +  H  ++    ++ + PV      + R +  ++   +GGL+ I   +      V +   N +  PYY   + + +EW    QK   PW  LA D V+  + + +++ L +PE +LQ++D M +    L    FPF R   + +D+Q+  G+MHSGYPI   + H  +  +     N   ++  G WG +HE+GHN Q         T E T N++S+   E++      +Q           +R++++L  G    NW  N + AL  Y Q++  FGWE +  +F  Y  + +    I ED   K+ +W+K+ SE    NL P +E W WPI     ++L+  P
Sbjct:  549 GLYLLEGQSTEISVSEPAASAGLKVQIGCHTDDLTFAIKLFRAPVVTYQCCMNRTQ-RSVSCLWGGLLYIIVPKGCQLGPVSVTITNAVPAPYYKLGKTSLEEWKSCIQKNLGPWGELATDNVILTVPTASLKTLENPEPLLQLWDEMMQAVARLASQPFPFQRPERIVADVQLSAGWMHSGYPI---MCHMESVQELVSLAN---IRSKGLWGPIHELGHNQQCRGWEFPPHTTEATCNLWSVYVHETVLGIPR-AQAHPQLKPEEREKRIKEHLQKGAPLQNW--NVWTALETYLQLQEVFGWEPFITLFAEYQTIFY----IPEDNECKMNIWLKLFSEKVQKNLVPFFEAWGWPIQKDVAEDLACYP 905          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BNE1|TCAF1_MOUSE (TRPM8 channel-associated factor 1 OS=Mus musculus OX=10090 GN=Tcaf1 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 4.497e-35
Identity = 117/422 (27.73%), Postives = 204/422 (48.34%), Query Frame = 2
Query: 1808 LSEIGKDL---IPPALSLYPGKF--QSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSK-STRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENN--DKVEIIFKNVIQIPYY--DRRNKDEWIQKQKIE--SPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTN-QNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISED-EKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            L+  G DL   IP    +Y  ++   S +P  VN+    N   +Y     GLY+  R    V + +S  S    I +  H  ++   S++ + P+      +++   ++I   +GGL+ I   +N+    V +  K  ++ P+Y     +K+EW +++ +E   PW  LA D ++  + +  +R L +PE +L+++D M +    L G +FP      + +D+QI VG+MH+GYPI   +             N+++++  G WG +HE+G N Q         T E T N++ +   E++     S +  + W   R   +RV+ YL  G    +W  N + AL  Y Q++  FGWE + ++F  Y   T      S++ +K+ LW+K+ S+    NL P +E W WPI  +    L+ LP
Sbjct:  499 LAHSGSDLSLLIPEIEDVYSSRYLRPSASPITVNVNCT-NPGTRYCWMSTGLYIPGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPT-KSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAPFYKLGETSKEEW-KRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQE------LINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVRE--KRVRIYLSKGPSVKHW--NAWTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYLP 907          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|A6NFQ2|TCAF2_HUMAN (TRPM8 channel-associated factor 2 OS=Homo sapiens OX=9606 GN=TCAF2 PE=1 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 1.336e-34
Identity = 103/373 (27.61%), Postives = 176/373 (47.18%), Query Frame = 2
Query: 1943 GLYLYPRLKTPVKIIQSK-STRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENN--DKVEIIFKNVIQIPYY--DRRNKDEW-IQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTI----ERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            GLYL       V + ++  S    + +  H  ++    ++++ PV      ++R +  ++   +GGL+ +   + +    V +  +  +  PYY   + + +EW  Q Q+  +PW  LA D ++  + +T ++ L DPE +L+++D M +    L    FPF R   + +D+QI  G+MHSGYPI   +             N+  ++  G WG +HE+GHN Q         T E T N++S+   E++             HE L+      R++ +L  G    +W  N + AL  Y Q++  FGWE + Q+F  Y  L+H  +      ++ LW+K  SE    NL P +E W WPI  +    L+ LP
Sbjct:  548 GLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKE------IINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLG-----IPRAQAHEALSPPERERRIKAHLGKGAPLCDW--NVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHLPK--DNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASLP 904          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P6V7|TCAF3_RAT (TRPM8 channel-associated factor 3 OS=Rattus norvegicus OX=10116 GN=Tcaf3 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 3.872e-33
Identity = 109/373 (29.22%), Postives = 178/373 (47.72%), Query Frame = 2
Query: 1943 GLYLYPRLKTPVKIIQSKST--RCYIYVNHHHFNIADKSEVTKWPV-TYKYFTIERGKWETIQFPFGGLMSISCNE--NNDKVEIIFKNVIQIPYY--DRRNKDEWIQKQKIE---SPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            GLYL P  +     + +++T  +  + +  H  NI+      + PV TY Y         +I + +GGL+ I   +  N D V +     +  PY+   +  ++EW  K  IE   +PW  LA D ++  + +  ++ L DP  +LQ++D + K    L    FPF R   +  D QI  G++HSGYPI   I             N+  ++  G WG+ HE+GHN Q+        T E   N++SI   E++ N     Q     +  L  +R++ +L  G   +NW    + AL  Y Q++  FGWE + Q+F  Y  LT   +  + ++K+ LW+K  SE+   NL P ++ W WP+ +   + L+ LP
Sbjct:  539 GLYL-PEGQVAQVTLPTEATHAKLKVLIGCHIDNISQAKTYIRPPVMTYVYHLTSSQT--SISWLYGGLLYIMVPDKYNQDNVSVTISGAVSAPYFRLGKTTQEEW--KNLIEHSKAPWGELATDNIILTIPTVNLKVLQDPYPLLQLWDKIVKAVAKLAARPFPFQRPERIVLDKQISFGFLHSGYPIMGLIIIVEG------IINEFKIRSHGVWGVTHELGHNHQKPGWTFRPHTTEALCNLWSIYVHETVLNIPR-DQAHPSLNPELRKQRIKDHLNKGAPLSNWIV--WTALETYLQLQEGFGWEPFIQLFANYQTLTGLPQ--NNEDKMNLWVKKFSEVVQKNLAPFFKAWGWPVQHAVAKSLASLP 895          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6QR59|TCAF3_MOUSE (TRPM8 channel-associated factor 3 OS=Mus musculus OX=10090 GN=Tcaf3 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 9.525e-33
Identity = 109/373 (29.22%), Postives = 177/373 (47.45%), Query Frame = 2
Query: 1943 GLYLYPRLKTPVKIIQSKST--RCYIYVNHHHFNIADKSEVTKWPV-TYKYFTIERGKWETIQFPFGGLMSISCNE--NNDKVEIIFKNVIQIPYY--DRRNKDEW---IQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            GLYL P  +    ++ S++T  +  + +  H  NI+      + PV TY Y         +I + +GGL+ I      N D V +  +  +  PY+   +  ++EW   I   K  +PW  LA D ++  + +  ++ L DP  +LQ++D M +    L    FPF R   V  D QI  G++HSGYPI   I             ++  ++  G WG++HE+GHN Q+        T E   N+++I   E++ N     Q     +  L  +R++ +L  G   +NW    + AL  Y Q++  FGWE + QVF  Y  L+   +  + ++K+ LW+K  SE    NL P +E W WP+     + L+ LP
Sbjct:  539 GLYL-PEGQVAQVLLPSEATHAKLKVLIGCHRDNISQARTYFRPPVMTYVYHLTSSQT--SISWLYGGLLYIMVPNKYNQDNVSVTIRGAVSAPYFRLGKTTQEEWKNLITHSK--APWGELATDNIILTIPTVNLKELQDPYPLLQLWDKMVRAVAKLAARPFPFQRAERVVLDKQISFGFLHSGYPIMGLISIVEG------IISEFKIRSHGIWGVIHELGHNHQKSGWTFPPHTTEALCNLWTIYVHETVLNIPR-EQAHPSLNPELRRQRIKYHLNKGAPLSNWI--MWTALETYLQLQEGFGWEPFIQVFADYRTLSGLPQ--NNEDKMNLWVKKFSEAVHKNLAPFFEAWGWPVKYAVAKSLASLP 895          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5XHI4|TCAF_XENLA (TRPM8 channel-associated factor homolog OS=Xenopus laevis OX=8355 GN=tcaf PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 4.392e-32
Identity = 106/377 (28.12%), Postives = 175/377 (46.42%), Query Frame = 2
Query: 1943 GLYLYPR----LKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGL--MSISCNENNDKVEIIFKNVIQIPYY--DRRNKDEWIQK-QKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPD 3043
            GLYL PR    L+ P   +  +  +  +       + ADK    + PV  + F ++  +     F +GGL  +++  N N   + +        P Y   + + D WIQ  + + +PWA L  + ++  + S AIR+L+DPE +L ++D +      L        R     +D+QI  G+MH+GYPI   +        +    +  I++  G WG +HE+GHN Q+        T E T N++S+   E++      SQ             +Q+YL +G+    W  N + AL  Y Q++  FGWE + Q+F+ Y +++  +       K+ LW +  SE    NL P +E W WPI   T  +LS LP++  D
Sbjct:  530 GLYLAPRKTAVLEFPASAVH-QGLQVQVGCQSDDLSSADK--YCRAPVVVRRFHVDSQRVSVSCF-WGGLVYITVKANSNLGIIPVKVYEAEPAPIYIKGKTSLDTWIQSIRNLPAPWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVAITELAAIPKKLPRPERFVADVQISAGWMHAGYPIMCHLE------SAKELTDLNIMQTGGIWGPIHELGHNQQKTNWELPPHTTEATCNLWSVYVHETVLGIPR-SQAHCCLQAETRANHIQEYLRNGSNIEQW--NVWTALETYLQLQEGFGWEPFKQLFKDYQSMSGIRNE--NKSKMNLWAEKFSEAVQTNLVPFFEAWGWPIEEATHSKLSVLPVWEKD 891          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: V3ZHF7 (Peptidase M60 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_236481 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 2.392e-56
Identity = 166/610 (27.21%), Postives = 299/610 (49.02%), Query Frame = 2
Query: 1355 KVLLEYIKSGLRIIIGFESWSY--IDKIKPLLD-------SELKILFYAAGVW--PSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFD-DIYIERSLDKKDFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIP-PALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVA---PLGLYLYPRLKTPVKIIQSKSTRC--YIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKD---EWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXXXXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLT--IERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRGSIFRQ 3115
            K +LEYI++G  ++    +W +  I   K + D        E+ I++     W   S  ++       +QH IH +           ++  +++  +   ++ D  + + +S+ KK  + + K+I +             P     +S    K  +  F + +L++ G      P + L+PG F + +PP  + +    ++ + E+    P G Y+    +  ++I+  +S  C   I +  H  ++   + + +WP+  +   I +   + ++ P GGLM +   +   K+ I  KN I+ P +D    +    W   ++    WA L G  +VF L + ++ +L DP  +L+ +D +     HLRGT     RR  + +D+Q   GYMHSGYPI T +    +P KS +  N + L + G WGL HE+GHN+Q+ T+TF GTGE T NIF++ A + +      +Q S W H  L   + + ++++ S    + W+ +  +AL +YAQ+ N FGW  Y + FR+Y       +  +E+EKI  W +  S+ S  NL PL +LW  P+++   ++L   P FLPDD +T+ V ++++E+  K   + R+
Sbjct:  139 KEILEYIQNGGALLHAVCAWGWLQIRNTKNIHDIPLYEVLEEVGIIYTKGYFWLPKSGLHIAISKASESQHVIHAL-----------DHTHLDNCCSTLSQINDCPVKVLQSVMKKSGEKVHKIISEKE-------HECIPSEKRPVSSSIGKSVM--FLHDVLAKTGNGYKKMPGIDLFPGDF-TEDPPLSDGR----IIIESEIPAAHPTGFYVRAGEEVELEIVTEESLNCGWEIQIGCHSDHLQTSNAMKRWPIITEKQKITQKNLK-MKTPIGGLMYVWSPKMASKIIINVKNAIESPLFDLTQPETIINWKTNRQAPGLWADLGGHHIVFTLPAKSVGDLEDPTAVLESWDRVVCAHHHLRGTDPNSQRREWIVADVQPSCGYMHSGYPIVTHL-DVADPSKSSFLLNNKTLLESGNWGLFHELGHNMQKPTWTFRGTGEVTCNIFTLHAMDVI------AQKSPWIHSWLEGKVPKARQFIRSSAGFSKWQSDPGIALFVYAQLYNQFGWSVYKKTFRQYEEQDMPPQLKTEEEKIDYWFETMSKFSEYNLAPLADLWSIPLSDTCREQLKVFPSFLPDDEITQGVPEKVEELEKKYPKLVRK 715          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: R7UHN9 (Peptidase M60 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_195748 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 2.774e-55
Identity = 174/629 (27.66%), Postives = 309/629 (49.13%), Query Frame = 2
Query: 1244 LLNKSYLQEIISKNKSQSVLSEPFIWNAEQVFGQDLVKVLLEYIKSGLRIIIGFESWSYIDKIKPLLDSELKI--LFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAY--REVFDDI--YIERSLDKKDFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNL-LYKYEVAPLGLYLYPRLKTPVKIIQSKST---RCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWET--IQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKDEWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXXXXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICK 3094
            L N + + EI++K +++SV     I    Q F +  V +LL++I+ G  +I     W ++   K   + ++ +  +   AG+  +  Y+       T  SI + +        K  + + N  L AY    + +D+   I RS  +   D +++      TD++  +    P   Y +     KG L       LS   +    P +  +PG F+       +  +++NL   + ++ P  +YL P  +T    I   ST   +  +++  H  ++   S+  + P   K    +R   +T  I  P+GG +     +   ++++   NV++ P Y     D WI ++     WA LAG  ++  L S++I++L DP  +L  +DS+      +R T     R+  +  D+Q  VGYMHSGYPI T +    +P    +  N + LK +G WGL HE+GHN+Q   +TF GT E T N+F++ A + +     W     W + ++    +++YL++G     W++   +AL IYAQ+ ++ GW  Y  VFR+Y  ++++Q+  ++DEKI+LWI   +E  G NLC L+  W + I N  ++ L++LP+FLP D +T  V +RI +++ +
Sbjct:   97 LKNNASIHEILAK-ETESVAIVRII---GQKFDEIEVLMLLDFIEHGGGLIFAICPWGWLQLNKNYAEEDMPMYSILERAGIHFTGHYINGNADGFTVPSIPSTARVPTL-IQKCLSSSENLGLYAYDLASLLEDLPLRIVRSTFQDLLDEVEE------TDFYNLV---IPEEKYPLKDNRSKGLLLLSC---LSARVRGDKAPGVHAFPGDFEGD---VQHKCVRINLDSARRDIFPAAVYL-PAGETLEIEIHEGSTDPQKWKVWIGAHSDDLVRSSQWKRLP---KVHIKQRLSEDTNVIFSPYGGNVYFESPDEESQLDVTVSNVVESPCY----TDHWIGQRDAPGLWADLAGRHIMITLPSSSIKDLVDPSEVLAFWDSVVAAHHVVRTTDVSSHRKQWIVCDVQPVVGYMHSGYPIVTHM-DVADPTSDQFLLNHDKLKAEGNWGLYHELGHNMQRLEWTFQGTSEVTVNVFTLHAMDVVNGVKPWIHP--WLNNQMN--AIKRYLMAGADFTTWKKEPGIALGIYAQLAHHLGWGTYKAVFRKYEVMSNEQKPKTDDEKIRLWITTFAECCGQNLCALFRFWGFTIPNDLQRNLAELPLFLPMDEMTLFVPERIAKVVAE 692          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S3I0H4 (TRPM8 channel-associated factor 2-like OS=Lingula unguis OX=7574 GN=LOC106159184 PE=4 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 9.293e-54
Identity = 132/439 (30.07%), Postives = 228/439 (51.94%), Query Frame = 2
Query: 1838 PALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCY---IYVNHHHFNIADKSEV-TKWPVTYKYFTIERGKWET-IQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKD---EWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQ--IYHNNNPYKSG--YFFNKEILKKDGAWGLMHEMGHNLQXXXXXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDE--KIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRGSIFR 3112
            P + ++PG F S+ PP   +++ L   ++  ++  G Y+       V +   + T      I +  H  ++ +  E   +WP       +E  K  T +  P+GGL+     E N ++ +I  NV++ P++D    +   +W +++     WA LAG  +VF + ST++R + DP TIL ++DS    +  LRGT     +R  V +D Q   GYMH+GYPI T   +   N  Y     + F++  +K  G WGL HE+GHN+Q   +TF+G GE T NIF++   E++T  ++W+  +    ++   E++ + L S    ++W+++ F ALC+Y+Q+ + FGW  +  VFR Y     K+   ++D+  KI +W    SEI   NL P+ + W  P++      L+  P FLP+D +T + + R+ +++     I R
Sbjct:  286 PGIGVFPGDF-SSKPPLQTVRLNLTTKHRQRLS-TGYYVPAGQPVKVTVTSDQGTDLSGWKICIGAHDDSLVNVKEPWRRWP---DVAVLEELKATTALSSPYGGLLFFDSPERNAELTVIVCNVVEAPFFDLTKPEIVEDWSRRRNAPGLWAELAGRHIVFTVPSTSVREIDDPTTILALWDSAVAAQHDLRGTDRNLQKRERVVADEQPSAGYMHAGYPIVTHLDVVDPNFQYNGSDNFVFSESGMKSYGNWGLFHEIGHNMQRKAWTFSGMGEVTNNIFTLYTYEAVTGNDAWNNPT---MKKFRAEKLPRLLQSQPSLSDWKKDPFFALCVYSQLAHEFGWRSFKTVFRLYENSVKKEEESNQDDGAKIDMWFGRFSEIVRHNLSPMCDFWGIPLSTGVRNNLTLFPAFLPNDEITAAGQARVDQVLPNYPGIVR 716          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: V4A0M8 (Peptidase M60 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_165593 PE=4 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 9.087e-53
Identity = 158/603 (26.20%), Postives = 282/603 (46.77%), Query Frame = 2
Query: 1361 LLEYIKSGLRIIIGFESWSYI--DKIKPLLDSELKILFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFDDIYIERSL-DKK------DFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGK-DLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYD---RRNKDEWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXXXXXXXXXXXXXXIFSIIATESMTNQ----NSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICK-RGSIFRQ 3115
            +L ++ SG   +     W ++   K K   D     +  A G+  + +YV+    P     + +    ++    +  + ++ D   A  +V + + +   L DKK          +  V+     DY        P  +  +     K  +       L+++GK + I P ++ +PG F+ST P   ++ + L+  Y+ +V P G Y+       V ++        + +  H   ++ +SE+ +WP       +   +   ++  FGGL+  +   N   + +   NVIQ P +D       ++W  +++    WA +  + ++  L S +IRNL  P ++++ +D + K  FHL+G      R+  + +D+Q   GYMHSGYP+ T +    NP    +  N   L   G+WG+ HE GHN+QEG +TF GT E T NIF++ A +++  +    + W Q      +R      Q Y       ++W+ +  +AL IYAQI ++ GW  + +VFRRY  +        E+++I LW  + SE+S +NL  L + WK P++++  +E+SK   FLPDD V +   +R   I+ K   +  RQ
Sbjct:  351 VLNFVISGGAFVHTMCPWGWLMGHKGKSFDDQPFDPVLDAVGIGYTKRYVE---IPADGLDVQSCCSSEQCHLGRAVDASIGDA-RALSQVGESLQLLSELTDKKLHMFSGKLSKLSGVLESTDIDY-------VPSEHCPVKSSEGKALIGLCE--TLNKMGKVNQILPGIANFPGDFEST-PSKTSVTLTLSS-YQEDVHPTGYYVQAGDSLAVSVLSQNGKGWTVQIGAHSDCLSGQSELKRWPNVVCCKPLNE-QCTIVKATFGGLVYFTSPSNQQSITVQLDNVIQAPLFDLTLPTTIEQWNGRRQAPGLWADICSEFLIITLPSKSIRNLDGPVSVMKKWDEVLKAHFHLKGIDIRNHRKQWLVTDVQPSAGYMHSGYPVVTHL-DVANPSHEFFLLNSHNLNTKGSWGVFHEFGHNMQEGVWTFPGTTEVTVNIFTLHAMDTLIGKRPIVHEWLQNQMSNAKRYLYHNDQNY-------SHWKSDPGIALFIYAQIAHHLGWGVFKEVFRRYGRMNPSSYPNKENDQIDLWYTLLSEVSQLNLASLVDFWKIPLSDKARREMSKFQPFLPDDDVMRMAPERTHMILAKYHSNCLRQ 929          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S3KG34 (TRPM8 channel-associated factor 2 OS=Lingula unguis OX=7574 GN=LOC106181552 PE=4 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 5.357e-52
Identity = 131/439 (29.84%), Postives = 227/439 (51.71%), Query Frame = 2
Query: 1838 PALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCY---IYVNHHHFNIADKSEV-TKWPVTYKYFTIERGKWET-IQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKD---EWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQ--IYHNNNPYKSG--YFFNKEILKKDGAWGLMHEMGHNLQXXXXXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDE--KIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRGSIFR 3112
            P + ++PG F S  PP   +++ L   ++  ++  G Y+       V +   + T      I +  H  ++ +  E   +WP       +E  K  T +  P+GGL+     E N ++ +I  NV++ P++D    +   +W +++     W  LAG  +VF + ST++R + DP TIL ++DS    +  LRGT   F +R  V +D Q   GYMH+GYPI T   +   N  Y     + F++  +K  G WGL HE+GHN+Q   +TF+G GE T NIF++   E++T  ++W+  +    ++   E++ + L +    N+W+++ F ALC+Y+Q+ + FGW  +  VFR Y     K+   ++D+  KI ++    SEI   NL P+ + W  P++      L+  P FLP+D +T + + R+ +++     I R
Sbjct:  286 PGIDVFPGDF-SFKPPLQTVRLNLTTKHRQRLS-TGYYVPAGQPVKVAVTSDQGTDLSGWKICIGAHDDSLVNVKEPWRRWP---DVAVLEELKATTALSSPYGGLLFFDSPERNAELTVIVCNVVEAPFFDLTKPEIVEDWSRRRNAPGLWTELAGRHIVFTVPSTSVREIDDPTTILALWDSAVAAQHDLRGTDPNFQKRERVVADEQPSAGYMHAGYPIVTHLDVVDPNFQYNGSDNFVFSESGMKLYGNWGLFHEIGHNMQRKAWTFSGMGEVTNNIFTLYTYEAVTGNDAWNNPT---MKKFRAEKLPRLLQTQPSLNDWKKDPFFALCVYSQLAHEFGWGSFKTVFRLYENSVKKEEESNQDDGAKIDMYFGRFSEIVRHNLSPMCDFWGIPLSTGVRNNLTLFPAFLPNDEITAAGQARVDQVLPNYPGIVR 716          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-210b2.3 (si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-13])

HSP 1 Score: 130.183 bits (326), Expect = 3.283e-30
Identity = 142/587 (24.19%), Postives = 245/587 (41.74%), Query Frame = 2
Query: 1367 EYIKSGLRIIIGFESWSYIDKIKPLLD-----------SELKILFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMND----VLAAYREVFDDIYIERSLDKKDFDSMKKVIHDLYTDYWPFIQSLTP--CLNYAISKQSDKGFLKFFSYIL-LSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKI---IQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENN--DKVEIIFKNVIQIPYYDRRNKD--EWIQK-QKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIER----VQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMF 3034
            E++  G  ++IG  +W Y  +  P  +           S++ +    + +   L   Q      T  + H   L ++F         + D     L   R   ++    ++ D   + S+  ++ D+        ++  P  C +  I    DK  L   S +  + +    L+P  ++  P     +N     I++  N     E    GLYL P ++T V +   I  K  +  I     H   AD   + + PV ++ F +++   +     +GGL+ +        D VE+I +  I+ PYY         W+ + +   +PWA L  + ++  L S  IR L  P+ +                 +FP   R +  +D+QI  G+MH+GYPI   I   + P       N E  +K G WG +HE+GHN Q         T E T N++S+   E +   N  S      HE ++ ER     Q Y + G   + W  + + AL  Y Q+++ FGW+ + +VF  Y+ + +       + K+ L+ +  S++  MNL P ++ W WPI   TE  LS LP++
Sbjct:  346 EFVAEGGGLLIGGHAW-YWAQCNPNRNVMTECPANHILSKMGLCIMGSTLESGLYPAQQVTAEGTPQAYHFRDLLQRFAGHVTKGQELTDQDHECLKKLRHDCENYLRMQAHDSASYTSVVNLLTDMVK------EAGVPQVCNSCPIESAKDKLLLHVGSEVYKVCQNPDALLPFIITDIPNLPSVSN---ARIRVSANTGDGEEWISTGLYLSPGMRTFVAVPAEIMDKGWQLQIGCQTDHLGHADV--LRRAPVVHERFALDKDMLQVWNL-WGGLIYLIAPPKCKLDGVEVIVQTAIKAPYYKSGETSVANWMNEIRNAPAPWAELEFENIIITLQSEVIRQLDRPDEV-----------------AFPRKERFV--ADVQISHGFMHAGYPI--MILSCSAPE----LVNPESARKFGIWGAIHELGHNQQRWAWEFPPNTTECTCNLWSVYVHEEVLGVNRASA-----HENMSPERRWGRAQSYAMGGRQLDQW--SMWTALETYMQLQDRFGWDAFKKVFTAYHTINNVPGD--NNGKMNLYAETFSKVVNMNLAPFFKAWGWPIQPSTEDALSSLPVW 885          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000051129.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:5658439:5662219:-1 gene:ENSAMXG00000036822.1 transcript:ENSAMXT00000051129.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 4.264e-19
Identity = 66/213 (30.99%), Postives = 101/213 (47.42%), Query Frame = 2
Query: 2408 FSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNN---NPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEK--IQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            F R+    +D+QI  G+MHSGYPI           NPY SG         K   WG +HE+GHN Q         T E T N++S+   E +      +   G    +    R++KY+  G    +W    + AL  Y Q++  FGW+ + +VF  Y+ +T     + +D K  + L+ +  S++   NL P ++ W WPI   TE++L  LP
Sbjct:   14 FPRKERFVADVQILAGFMHSGYPIMMHTVSAPDLVNPYVSG---------KSDFWGPVHELGHNQQHSDWEFPPYTTECTCNLWSVYVHEVVLGVKK-ADAHGQMTPQRRQNRIKKYIEGGRNLKDW--TVWTALETYMQLQEEFGWDAFKKVFAAYHDMT----GVPQDNKGKMNLYAETFSKVVNRNLTPFFKAWGWPIQPSTEEQLCSLP 210          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: mst1 (macrophage stimulating 1 [Source:NCBI gene;Acc:103025427])

HSP 1 Score: 90.5077 bits (223), Expect = 4.738e-18
Identity = 64/195 (32.82%), Postives = 99/195 (50.77%), Query Frame = 2
Query:   77 IEKCRMTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPER--NLKFAGNKCRNPDMSKVPWCYYSN-NYQREDCNVPRCD---KEINQPEFFGTYDYLRGLGSN 643
            + KC +   G +Y GKV   +SG+ C  W +++ +    D  +    T+ +  NYCRNP     G WC   +    +E CNI  C KD   C + + G +Y G + HT +G+ CQ W     H+    PE+  +     N CRNPD S VPWCY ++ + +RE+C++ +C    K   +P +  T +  RG G +
Sbjct:  108 VRKC-IVGKGEDYRGKVSKTQSGKTCQQWWSKFPH----DHRWTPSPTNGLELNYCRNPDGDRIGPWCYTTDPERRYESCNIPLC-KDEV-CINCN-GEDYRGQVDHTVNGRECQRWDQQYPHQHIYQPEKYPDKSLDDNYCRNPDASPVPWCYTTDPDVERENCDIRKCSGIPKRRLRPSY--TTNCFRGRGED 292          

HSP 2 Score: 75.8702 bits (185), Expect = 1.761e-13
Identity = 50/159 (31.45%), Postives = 73/159 (45.91%), Query Frame = 2
Query:   92 MTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKC--IKDRNWCKD------SDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPE--RNLKFAGNKCRNPDMSKVPWCYYS 538
            +  +G +Y G+VD   +G+ C  W  +Y +Q +       D +  + +NYCRNP   P   WC   +  +E E+C+I KC  I  R             +G +Y G ++ T SG  CQ W     H    +P          N CRNPD S+ PWC+ S
Sbjct:  193 INCNGEDYRGQVDHTVNGRECQRWDQQYPHQHIYQPEKYPDKS--LDDNYCRNPDASPV-PWCYTTDPDVERENCDIRKCSGIPKRRLRPSYTTNCFRGRGEDYRGKVNETTSGIACQKWDAQFPHEHPFYPHTYECKGLVENYCRNPDGSEAPWCFTS 348          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: hgfb (hepatocyte growth factor [Source:NCBI gene;Acc:103033838])

HSP 1 Score: 85.5001 bits (210), Expect = 1.732e-16
Identity = 72/258 (27.91%), Postives = 112/258 (43.41%), Query Frame = 2
Query:   92 MTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDS------DKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPE--RNLKFAGNKCRNPDMSKVPWCYYSN-NYQREDC-NVPRCDKEINQPE--FFGTYDYLRG--LGSNKTIV-----KLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEYCSI 808
            MT +G  Y G +D  +SG+ C  W  +  ++ L       DN   + +NYCRNP       WC   +  + WE+C+I +C  D     ++      D G  Y G ++  + G  CQ W     H     P+  R    + N CRNPD    PWC+ ++ N     C N+PRC     +PE  + G+ +  RG  + +   I+        +  +   VTLS +LE    R  +K       Y     S L  ++YC++
Sbjct:  196 MTCNGESYRGPMDHTESGRECQRWDLDEPHKHLFHPKRYPDNG--LKDNYCRNPDGRQR-PWCFTTDPDVPWEYCSIKQCDSDNQSNIETTTTCFRDNGAGYRGTVAVPREGLTCQRWDAQFPHSHSYMPQKYRCKDLSENFCRNPDGRDAPWCFTTDPNIPWAFCKNIPRCGAAATEPEECYKGSEETYRGKQMKTRSGILCAPWRDHSERNKREVVTLSEELEGNFCRNPDKDKHGPWCYT---NSSLVPWDYCTV 447          

HSP 2 Score: 75.8702 bits (185), Expect = 1.465e-13
Identity = 58/200 (29.00%), Postives = 93/200 (46.50%), Query Frame = 2
Query:   77 IEKCRMTTHGREYMGKVDFVKSGQRCIVW--KNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPER--NLKFAGNKCRNPDMSKVPWCYYSN-NYQREDCNVPRCDKEINQPEFFGTYDYLR--GLGSNKTIV 655
            +++C + T G  Y GK+   ++G+ C  W     + +  L       D    + +N CRNP N   G WC      + +++CNI +C +    C   + G  Y G + HT+SG+ CQ W     H+    P+R  +     N CRNPD  + PWC+ ++ +   E C++ +CD + NQ     T    R  G G   T+ 
Sbjct:  109 VKECIIGT-GLNYKGKISKTETGEECQKWDLNTPHEHHFLPRRHKKKD----LRDNLCRNPDNSTTGPWCFTKNPNIRYQNCNIPQCSEVE--CMTCN-GESYRGPMDHTESGRECQRWDLDEPHKHLFHPKRYPDNGLKDNYCRNPDGRQRPWCFTTDPDVPWEYCSIKQCDSD-NQSNIETTTTCFRDNGAGYRGTVA 299          

HSP 3 Score: 64.3142 bits (155), Expect = 5.633e-10
Identity = 56/200 (28.00%), Postives = 83/200 (41.50%), Query Frame = 2
Query:  104 GREYMGKVDFVKSGQRCIVWKNEYVN-QILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHC-NIIKCIKDRNWCKDSDKGTE--YLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAGNKCRNPDMSK-VPWCYYSNNYQRED-CNVPRCD---------KEINQPEFFGTYDYLRGLGSNKTIVK 658
            G  Y G V   + G  C  W  ++ +    M   +   + S    N+CRNP    +  WC   +  + W  C NI +C       ++  KG+E  Y G    T+SG LC PW +            + +  GN CRNPD  K  PWCY +++    D C V  CD          E++Q   F  +  +R +G     +K
Sbjct:  291 GAGYRGTVAVPREGLTCQRWDAQFPHSHSYMPQKYRCKDLS---ENFCRNPDGR-DAPWCFTTDPNIPWAFCKNIPRCGAAATEPEECYKGSEETYRGKQMKTRSGILCAPWRDHSERNKREVVTLSEELEGNFCRNPDKDKHGPWCYTNSSLVPWDYCTVKLCDPLPNALPQKAEVSQASCF-VHKQVRIVGGGPVPIK 485          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000018418.2 (plasminogen [Source:NCBI gene;Acc:103036400])

HSP 1 Score: 83.9593 bits (206), Expect = 6.037e-16
Identity = 59/178 (33.15%), Postives = 79/178 (44.38%), Query Frame = 2
Query:   95 TTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIG--NNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKC----------IKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHR----AYSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQR-EDCNVPRC 577
            T  G  Y G V   +SG+ C  W     +Q+    +   DN    G   NYCRNP N     WC   +    WE+CN+  C          I     C + D G+ Y G ++ T SGK CQ W +   H       +FP  +L+   N CRNPD  + PWCY ++   R E C + RC
Sbjct:  285 TGDGNTYRGTVSVTESGKTCQSW----ASQLPHKHSRTPDNYPCKGLDQNYCRNPDNE-RKPWCYTTDPETRWEYCNVESCGNEPRPDEPVIAPNEDCYE-DNGSSYRGVMTETISGKKCQAWASMEPHSHVKTPQNFPTADLRR--NLCRNPDGDRAPWCYTTDPSVRWEYCRIERC 454          

HSP 2 Score: 81.2629 bits (199), Expect = 3.602e-15
Identity = 54/163 (33.13%), Postives = 78/163 (47.85%), Query Frame = 2
Query:  104 GREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHR----AYSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQR-EDCNVPRC 577
            G +Y G     KSG  C  W++ + ++  +  T      + + +N+CRNP     G WC   +    WE+C+I  C ++   C     G  Y G IS T+SG  CQ W +   H        FPE+ L+   N CRNPD    PWC+  +  +R E C+V RC
Sbjct:  116 GTDYRGTKSKTKSGTLCQRWESTFPHKPNI--TPRSHPKADLESNFCRNPDGDKGGPWCYTTDPAKRWENCDIQDCTEECMHC----SGENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYLEE--NYCRNPDGEPKPWCFTESPAKRWEFCSVSRC 270          

HSP 3 Score: 62.003 bits (149), Expect = 3.521e-9
Identity = 50/190 (26.32%), Postives = 77/190 (40.53%), Query Frame = 2
Query:  101 HGREYMGKVDFVKSGQRCIVWKN-EYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKC--------------------------IKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLK--FAGNKCRNPDMS-KVPWCYYSNNYQRED-CNVPRC 577
            +G  Y G +    SG++C  W + E  + +     F    T+ +  N CRNP +     WC   + ++ WE+C I +C                            +   CK +  G  Y G +S T +G  CQ W     H +   P+ +       NKCRNPD     PWCY ++  ++ D C +P C
Sbjct:  381 NGSSYRGVMTETISGKKCQAWASMEPHSHVKTPQNFP---TADLRRNLCRNP-DGDRAPWCYTTDPSVRWEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCK-TGSGISYRGSVSKTVAGVTCQAWSASTPHLSSFTPQAHPDKGLDSNKCRNPDGDVNGPWCYTTDPNKKWDYCQIPEC 565          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000976.1 (pep scaffold:Pmarinus_7.0:GL479898:35358:38300:-1 gene:ENSPMAG00000000885.1 transcript:ENSPMAT00000000976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 6.623e-24
Identity = 83/336 (24.70%), Postives = 153/336 (45.54%), Query Frame = 2
Query: 2012 IYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWET----IQFPFGGLMSISCNENND--KVEIIFKNVIQIPYY--DRRNKDEWIQ-KQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSI-IATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKW 2986
            I +  H   + D   + + P   +   + RG+ +     +   +GGL+ +   E     K+ +  +   + PY+     +   W + ++   +PW+ LA D+++  + S A R LADPE +++++D M     +L     P +R   +  D QI  G+MH+GYPI   + H  +  K     N++ ++ +G WG +HE+GHN Q         T E T N+F++ +  E +    + +       ER    R++ ++ +G     W    F  L  Y Q++  FGW+ + ++F  Y        ++  + K+  W +  S   G NL P +  W W
Sbjct:  553 IQLGCHTDQLYDSKTMKRHPEVTRSMPVVRGEMDRGAMEVASSWGGLLYLLVPEGVSLGKIRVRVRGAARAPYFKLGETSLQHWQEFERHYPAPWSELACDSLILTVPSEAARGLADPERLMRLWDRMTGAIAYLAAEPHPSARPERIVVDEQISHGWMHAGYPI---MVHRASIPK---LLNEQEMRAEGMWGPLHELGHNRQRPAWNFPPHTTEATNNLFAVYVHEEVLGVARARAHPDLRPAERE--RRLRDHVDAGCPLAAW--TVFTCLETYLQLQEAFGWDPFVRLFGDYQRAASTPSTM--EAKMSEWAERFSRCVGRNLAPFFSAWGW 876          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003778.1 (pep scaffold:Pmarinus_7.0:GL482904:4425:14035:-1 gene:ENSPMAG00000003419.1 transcript:ENSPMAT00000003778.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 3.125e-15
Identity = 54/188 (28.72%), Postives = 84/188 (44.68%), Query Frame = 2
Query:   92 MTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNW----------CKDSDK---------GTEYLGDISHTKSGKLCQPWINFGTH--RAYSFPERNLKFAGNKCRNPDM-SKVPWCYYSNNYQRED-CNVPRCDKE 586
            MT +G +Y+G V F KSG++C +W + + +Q+      V      +  N+CRNP    +G WC   +  +  E C++  C KD N            K + +         G +Y G ++ T+SG+ CQ W     H  R      R     G  CRNPD   +  WCY ++     D C +  CD++
Sbjct:  108 MTGNGEQYIGNVSFTKSGRQCQLWTSNFPHQVRFKP--VDHPEKQLVENFCRNPDASQDGPWCYTRDPLVPREPCSVPTCDKDPNQHVPVSPRVTPTKPAPRPQGPCVPGAGEDYRGPVNVTRSGRHCQAWSAQTPHVSRYSPLTHRAAGLEGAACRNPDGDEEGAWCYTTDPGLTIDYCALHYCDED 293          

HSP 2 Score: 63.929 bits (154), Expect = 1.310e-10
Identity = 36/82 (43.90%), Postives = 48/82 (58.54%), Query Frame = 2
Query:  368 GTEYLGDISHTKSGKLCQPWINFGTH----RAYSFPERNLKFAGNKCRNPDMSK-VPWCYYSNNY-QREDCNVPRCDKEINQ 595
            G +Y+G++S TKSG+ CQ W +   H    +    PE+ L    N CRNPD S+  PWCY  +    RE C+VP CDK+ NQ
Sbjct:  112 GEQYIGNVSFTKSGRQCQLWTSNFPHQVRFKPVDHPEKQL--VENFCRNPDASQDGPWCYTRDPLVPREPCSVPTCDKDPNQ 191          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: hgfb (hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GENE-041014-3])

HSP 1 Score: 71.2478 bits (173), Expect = 6.174e-13
Identity = 79/306 (25.82%), Postives = 123/306 (40.20%), Query Frame = 2
Query:  104 GREYMGKVDFVKSGQRCIVWKNEYV-NQILMDDTFVFDNTSIIGNNYCRNPTNFPNGL---WCIIDEMTLEWEHCNI---------IKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAG---NKCRNPD-MSKVPWCY-YSNNYQREDC-NVPRCDKEINQPEFF---GTYDYLRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQS-DLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQKSDFTIKHAGAKYPKPSP 952
            G  Y G VD   S + C  W  ++  N     D F     + + +NYCRNP    NG    WC   +    WE+C+I          +   +   C + ++G +Y G  +HTK G  CQ W     HR +++ E N   +G   N CRNPD   + PWC+    + +R+ C ++PRC +     + +   GT  Y  G+ + +  ++     Q  N T        K     KS   A      C++ D D +     TS  +   DY     C         +     + F   + G K+P  +P
Sbjct:  139 GEHYRGLVDHTDSQRECQRWDLQHPHNHNYTPDRFP---NAGLDDNYCRNP----NGRMRPWCFTTDPHQPWEYCSIKPGCCASKATRPAMEGRPCLE-ERGEDYRGRANHTKGGIPCQHWAAQQPHR-HTYLEHNYPCSGLDRNYCRNPDGREEAPWCFTLDPSVRRQLCSHIPRCAQPTAGSQCYSGSGTA-YRGGVATTRHGLQC----QAWNAT-----SPHKPWYTPKSHPGAGLEGHSCRNPDGDPWGPWCFTSDPHLPWDYCSVEACGDNFPLSSLLDSPPGTQFGKHNCGLKHPSKAP 425          

HSP 2 Score: 67.781 bits (164), Expect = 5.962e-12
Identity = 53/188 (28.19%), Postives = 77/188 (40.96%), Query Frame = 2
Query:    5 FMLSAQLSVIFSLQYVIFAGYFEEIEKCR--MTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTF--VFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPER--NLKFAGNKCRNPDMSKVPWCYYSNNYQ 550
             + S   S   ++   I    +E  E  R   T +G  Y G  ++ +SG  C  W +   +      +F   FD    +  N CRNP   P   WC   +     E C I +C  D   C +  +G  Y G + HT S + CQ W     H     P+R  N     N CRNP+    PWC+ ++ +Q
Sbjct:   21 LLDSTSRSQGVTVHCDILTDLYERKEYVRGCYTGNGSGYRGDKNYTESGLPCQAWGDSEPHDSRYLPSFYPAFD----LEGNSCRNPAQEPGEPWCYTMDSNRRRERCGIPRC--DEVPCVEC-RGEHYRGLVDHTDSQRECQRWDLQHPHNHNYTPDRFPNAGLDDNYCRNPNGRMRPWCFTTDPHQ 201          

HSP 3 Score: 54.299 bits (129), Expect = 1.190e-7
Identity = 36/93 (38.71%), Postives = 48/93 (51.61%), Query Frame = 2
Query:  368 GTEYLGDISHTKSGKLCQPWINFGTHRAYSFPE--RNLKFAGNKCRNPDMSK-VPWCY-YSNNYQREDCNVPRCDKEINQPEFFGTYDYLRGL 634
            G+ Y GD ++T+SG  CQ W +   H +   P         GN CRNP      PWCY   +N +RE C +PRCD E+   E  G  ++ RGL
Sbjct:   56 GSGYRGDKNYTESGLPCQAWGDSEPHDSRYLPSFYPAFDLEGNSCRNPAQEPGEPWCYTMDSNRRRERCGIPRCD-EVPCVECRG--EHYRGL 145          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001728.1 (pep scaffold:Pmarinus_7.0:GL477419:32233:56220:-1 gene:ENSPMAG00000001561.1 transcript:ENSPMAT00000001728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 4.869e-8
Identity = 28/90 (31.11%), Postives = 43/90 (47.78%), Query Frame = 2
Query:   71 EEIEKCRMTTHGREYMGKVDFVKSGQRCIVWKNEYVN-QILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIK 337
            E ++ C  T  G  Y G      SG +C  W ++  +      + F     + + NNYCRNP + PNG WCI  +  + WE+C + +C  
Sbjct:    6 EWVDHC-YTGSGTGYRGLQTLTASGHQCQTWASKTPHLHAYTPEGFP---EAGLENNYCRNPDSDPNGPWCITQDPNVLWEYCALQRCAS 91          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Match: EDO39763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S935])

HSP 1 Score: 51.2174 bits (121), Expect = 5.615e-8
Identity = 34/79 (43.04%), Postives = 41/79 (51.90%), Query Frame = 2
Query:  365 KGTEYLGDISHTKSGKLCQPWINFGTHRAY--SFPERNLKFAGNKCRNPD--MSKVPWCYYSNNYQR-EDCNVPRCDKE 586
            +G  Y G+I+ TKSG  CQPW +   HR Y  S     L  A N CRNP       PWCY +N   R E C+VP+C   
Sbjct:   15 EGVGYHGNINVTKSGISCQPWSSQCPHRHYHNSTQYTELINASNFCRNPGGMGPDGPWCYTTNMMVRWEYCDVPKCPPP 93          

HSP 2 Score: 49.6766 bits (117), Expect = 2.133e-7
Identity = 25/77 (32.47%), Postives = 40/77 (51.95%), Query Frame = 2
Query:  104 GREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNF-PNGLWCIIDEMTLEWEHCNIIKC 331
            G  Y G ++  KSG  C  W ++  ++   + T   +   I  +N+CRNP    P+G WC    M + WE+C++ KC
Sbjct:   16 GVGYHGNINVTKSGISCQPWSSQCPHRHYHNSTQYTE--LINASNFCRNPGGMGPDGPWCYTTNMMVRWEYCDVPKC 90          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Match: EDO28926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T536])

HSP 1 Score: 50.447 bits (119), Expect = 7.364e-8
Identity = 34/78 (43.59%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  365 KGTEYLGDISHTKSGKLCQPWINFGTHRAY----SFPERNLKFAGNKCRNPD--MSKVPWCYYSNNYQR-EDCNVPRC 577
            +G  Y G+I+ TKSG  CQPW +   H  Y     +PE  L  A N CRNP       PWCY +N   R E C+VP+C
Sbjct:    6 EGVGYHGNINVTKSGISCQPWSSQCPHHHYHNSTQYPE--LINASNFCRNPGGMGPDGPWCYTTNKLVRWEYCDVPKC 81          

HSP 2 Score: 46.595 bits (109), Expect = 1.399e-6
Identity = 24/77 (31.17%), Postives = 38/77 (49.35%), Query Frame = 2
Query:  104 GREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNF-PNGLWCIIDEMTLEWEHCNIIKC 331
            G  Y G ++  KSG  C  W ++  +    + T   +   I  +N+CRNP    P+G WC      + WE+C++ KC
Sbjct:    7 GVGYHGNINVTKSGISCQPWSSQCPHHHYHNSTQYPE--LINASNFCRNPGGMGPDGPWCYTTNKLVRWEYCDVPKC 81          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Match: EDO30193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1H4])

HSP 1 Score: 49.6766 bits (117), Expect = 1.460e-7
Identity = 25/82 (30.49%), Postives = 38/82 (46.34%), Query Frame = 2
Query:  104 GREYMGKVDFVKSGQRCIVWKNEYVNQ-ILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRN 346
            GR+Y G ++F   G  C  W  ++ +Q   M D  V     +  +NYCRNP    +  WC        W++C I  C K ++
Sbjct:    2 GRDYRGTMNFTAKGVTCQPWNEQWPHQHTEMADPLVAAREGLGKHNYCRNPGGRKHRPWCYTTLEKTRWQYCEIRSCRKTKS 83          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: si:ch211-210b2.3 (TRPM8 channel-associated factor homolog [Source:NCBI gene;Acc:101159605])

HSP 1 Score: 137.117 bits (344), Expect = 2.398e-32
Identity = 110/375 (29.33%), Postives = 173/375 (46.13%), Query Frame = 2
Query: 1943 GLYLYPRLKT----PVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENND--KVEIIFKNVIQIPYYDR--RNKDEWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXX-XXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIE----RVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLP 3028
            GLYL P +KT    P +++Q K  +  I       N     E+ + P  ++ F +     +     +GGL+ +      D   VE+I +  +  PYY       + W   +   SPWA L  D ++  + S A+R L  PE + Q+++ + K    L      F R+    +D+QI  G+MH+GYPI  Q    N         N + +K  G WG +HE+GHN Q G       T E T N++S+   E +   +         H  +++E    R + Y+  G   N+W    +VAL  Y Q+++ FGW+ + +VF  Y  L   Q       K+ L+ +  S+  GM+L   ++ W WPI   TEQ+LS LP
Sbjct:  551 GLYLSPGMKTYISIPAQMVQ-KGWQIQIGCQTDQLN---AEELKRPPRVHEQFAVTSEMMQVWNL-WGGLIYLVAPPQADVHGVEVIVQMAVPAPYYKSGVTTAEAWSLLRTAPSPWAELEFDNIILTVPSEAVRTLERPEELAQLWNKIMKAIADLAAKPEKFPRKERFVADVQISHGWMHAGYPIMGQKSAVNE------LVNVDHMKSCGLWGPIHELGHNQQRGCWEFPPNTTECTCNLWSVYVHEEVLGIDRAKA-----HPNMSLENRKSRARNYVTQGRNLNSWE--MWVALETYMQLQDKFGWDAFKKVFAAY--LQMSQFPGDNPGKMNLYTETFSQTVGMDLTAFFKAWGWPIQASTEQKLSNLP 905          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: mst1 (hepatocyte growth factor-like protein [Source:NCBI gene;Acc:101168450])

HSP 1 Score: 91.6633 bits (226), Expect = 2.002e-18
Identity = 70/208 (33.65%), Postives = 98/208 (47.12%), Query Frame = 2
Query:  104 GREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKD----SDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPER--NLKFAGNKCRNPDMSKVPWCYYSNN-YQREDCNVPRCDK---EINQPEFFGTYDYLRGLGSNKTIVKLDDIYQTVNVTLS 697
            G +Y GKV   KSG  C  W +++ +    D  +    ++ +  NYCRNP     G WC   +    +E CNI +       CKD    +  G +Y G + HT +GK CQ W     H+    PE+  +     N CRNPD S VPWCY ++   +RE+CN+ +C +   E  Q   F T +  RG G        +D    VN TLS
Sbjct:  114 GEDYRGKVFTTKSGLNCQQWWSKFPH----DHWWTPTASNGLELNYCRNPDGDNIGPWCYTTDPERRYESCNIPQ-------CKDEVCITCNGEDYRGQVDHTATGKECQRWDQQHPHQHIYQPEKYPDKSLDDNYCRNPDASPVPWCYTTDPLVERENCNISKCPEVPVEKRQRSSF-TTNCFRGRG--------EDYRGKVNETLS 301          

HSP 2 Score: 76.2554 bits (186), Expect = 1.305e-13
Identity = 74/290 (25.52%), Postives = 119/290 (41.03%), Query Frame = 2
Query:   92 MTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKC----IKDRNWCKDS-------DKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPE--RNLKFAGNKCRNPDMSKVPWCYYSNNYQRED--CNVPRCDKEINQPEFFGTYDY-LRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQKSDFT 913
            +T +G +Y G+VD   +G+ C  W  ++ +Q +       D +  + +NYCRNP   P   WC   +  +E E+CNI KC    ++ R   + S        +G +Y G ++ T SG  CQ W     H     P          N CRNPD S+ PWC+ S    R      + RC+ +I   + +       RG+   KT   +      VN     K+  L     N +  +          D D++     T+   T  DY     C+G  + +     ++K +F+
Sbjct:  191 ITCNGEDYRGQVDHTATGKECQRWDQQHPHQHIYQPEKYPDKS--LDDNYCRNPDASPV-PWCYTTDPLVERENCNISKCPEVPVEKRQ--RSSFTTNCFRGRGEDYRGKVNETLSGIPCQRWNAQFPHEHPFHPNIYECKGLEENYCRNPDGSEAPWCFTSAPEMRTALCLQIKRCEDDIEAEDCYQENGKNYRGI-VRKTRKGVTCQRWNVNTPHRTKINPLTHPEANLTENYCR------NPDGDQHGPWCYTTDPKTEFDYCAIKQCAG--EKVSLTEQIEKVEFS 466          

HSP 3 Score: 56.225 bits (134), Expect = 1.866e-7
Identity = 33/92 (35.87%), Postives = 48/92 (52.17%), Query Frame = 2
Query:  365 KGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAGNKCRNPDMSKV-PWCYYSNNYQR-EDCNVPRCDKEI----NQPEFFGTYDY 622
            KG +Y G +  TKSG  CQ W +   H  +  P  +     N CRNPD   + PWCY ++  +R E CN+P+C  E+    N  ++ G  D+
Sbjct:  113 KGEDYRGKVFTTKSGLNCQQWWSKFPHDHWWTPTASNGLELNYCRNPDGDNIGPWCYTTDPERRYESCNIPQCKDEVCITCNGEDYRGQVDH 204          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: plat (plasminogen activator, tissue type [Source:NCBI gene;Acc:100049466])

HSP 1 Score: 76.6406 bits (187), Expect = 6.757e-14
Identity = 63/192 (32.81%), Postives = 84/192 (43.75%), Query Frame = 2
Query:   56 FAGYFEEI---EKCRMTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIG-----NNYCRNPTNFPNGLWCIIDEMT-LEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHR----AYSFPERNLKFAG-NKCRNPDMSKVPWCYYSNNYQR--EDCNVPRCDK 583
            F G   EI   EKC +   G  Y G +    SG+ CI W +      L    F    T   G     +N+CRNP +  +  WC I + T + WE C++ KC  DRN       G  Y G  + TKSG  C PW      R    A+     +L  +  N CRNPD    PWC+     Q   E C++P+C +
Sbjct:   65 FKGAQCEINSNEKC-IVGKGEGYRGTLSVTHSGEECINWNSTS----LRGKKFTARKTDASGLGLGNHNFCRNP-DQDSAPWCYIYKGTQVIWELCSLPKCSGDRNRECVQGLGKSYRGTAAVTKSGSACLPWDAPAVRRKRNNAWKSNALDLGLSNHNFCRNPDGDSGPWCHTYKKMQLTWELCDIPKCSR 250          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: plat (plasminogen activator, tissue type [Source:NCBI gene;Acc:100049466])

HSP 1 Score: 76.2554 bits (186), Expect = 9.107e-14
Identity = 63/192 (32.81%), Postives = 84/192 (43.75%), Query Frame = 2
Query:   56 FAGYFEEI---EKCRMTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIG-----NNYCRNPTNFPNGLWCIIDEMT-LEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHR----AYSFPERNLKFAG-NKCRNPDMSKVPWCYYSNNYQR--EDCNVPRCDK 583
            F G   EI   EKC +   G  Y G +    SG+ CI W +      L    F    T   G     +N+CRNP +  +  WC I + T + WE C++ KC  DRN       G  Y G  + TKSG  C PW      R    A+     +L  +  N CRNPD    PWC+     Q   E C++P+C +
Sbjct:  137 FKGAQCEINSNEKC-IVGKGEGYRGTLSVTHSGEECINWNSTS----LRGKKFTARKTDASGLGLGNHNFCRNP-DQDSAPWCYIYKGTQVIWELCSLPKCSGDRNRECVQGLGKSYRGTAAVTKSGSACLPWDAPAVRRKRNNAWKSNALDLGLSNHNFCRNPDGDSGPWCHTYKKMQLTWELCDIPKCSR 322          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: plat (plasminogen activator, tissue type [Source:NCBI gene;Acc:100049466])

HSP 1 Score: 76.2554 bits (186), Expect = 9.902e-14
Identity = 63/192 (32.81%), Postives = 84/192 (43.75%), Query Frame = 2
Query:   56 FAGYFEEI---EKCRMTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIG-----NNYCRNPTNFPNGLWCIIDEMT-LEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHR----AYSFPERNLKFAG-NKCRNPDMSKVPWCYYSNNYQR--EDCNVPRCDK 583
            F G   EI   EKC +   G  Y G +    SG+ CI W +      L    F    T   G     +N+CRNP +  +  WC I + T + WE C++ KC  DRN       G  Y G  + TKSG  C PW      R    A+     +L  +  N CRNPD    PWC+     Q   E C++P+C +
Sbjct:   97 FKGAQCEINSNEKC-IVGKGEGYRGTLSVTHSGEECINWNSTS----LRGKKFTARKTDASGLGLGNHNFCRNP-DQDSAPWCYIYKGTQVIWELCSLPKCSGDRNRECVQGLGKSYRGTAAVTKSGSACLPWDAPAVRRKRNNAWKSNALDLGLSNHNFCRNPDGDSGPWCHTYKKMQLTWELCDIPKCSR 282          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026361.1 (SMESG000026361.1)

HSP 1 Score: 2077.75 bits (5382), Expect = 0.000e+0
Identity = 1034/1038 (99.61%), Postives = 1035/1038 (99.71%), Query Frame = 2
Query:   92 MTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCDKEINQPEFFGTYDYLRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQKSDFTIKHAGAKYPKPSPSKQFNEYEKKMKEYYQNKNKNKFNLTLGEYPGYFYLLKDNAIAYAMNAKNKISMTLSTVGKGRIAFMGSDDLINVKPYKILLDFFQDVFDKPVESPTLLNKSYLQEIISKNKSQSVLSEPFIWNAEQVFGQDLVKVLLEYIKSGLRIIIGFESWSYIDKIKPLLDSELKILFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFDDIYIERSLDKKDFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKDEWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXXXXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRGSIFRQXXXXXXXXXXXXXXFTVEGAKIIEQIQILN 3205
            MTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCDKEINQPEFFGTYDYLRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQKSDFTIKHAGAKYPKPSPSKQFNEYEKKMKEYYQNKNKNKFNLTLGEYPGYFYLLKDNAIAYAMNAKNKISMTLSTVGKGRIAFMGSDDLINVKPYKILLDFFQDVFDKPVESPTLLNKSYLQEIISKNKSQSVLSEPFIWNAEQVFGQDLVKVLLEYIKSGLRIIIGFESWSYIDKIKPLLDSELKILFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFDDIYIERSLDK DFD MKKVI+DLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKDEWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQEGTFTFNGTGETTTNIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRGSIFRQPLPVPVKVGPVKNKFTVEGAKIIE IQILN
Sbjct:    1 MTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCDKEINQPEFFGTYDYLRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQKSDFTIKHAGAKYPKPSPSKQFNEYEKKMKEYYQNKNKNKFNLTLGEYPGYFYLLKDNAIAYAMNAKNKISMTLSTVGKGRIAFMGSDDLINVKPYKILLDFFQDVFDKPVESPTLLNKSYLQEIISKNKSQSVLSEPFIWNAEQVFGQDLVKVLLEYIKSGLRIIIGFESWSYIDKIKPLLDSELKILFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFDDIYIERSLDKIDFDLMKKVINDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKDEWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQEGTFTFNGTGETTTNIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRGSIFRQPLPVPVKVGPVKNKFTVEGAKIIEHIQILN 1038          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026361.1 (SMESG000026361.1)

HSP 1 Score: 2058.88 bits (5333), Expect = 0.000e+0
Identity = 1026/1030 (99.61%), Postives = 1027/1030 (99.71%), Query Frame = 2
Query:  116 MGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCDKEINQPEFFGTYDYLRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQKSDFTIKHAGAKYPKPSPSKQFNEYEKKMKEYYQNKNKNKFNLTLGEYPGYFYLLKDNAIAYAMNAKNKISMTLSTVGKGRIAFMGSDDLINVKPYKILLDFFQDVFDKPVESPTLLNKSYLQEIISKNKSQSVLSEPFIWNAEQVFGQDLVKVLLEYIKSGLRIIIGFESWSYIDKIKPLLDSELKILFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFDDIYIERSLDKKDFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKDEWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXXXXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRGSIFRQXXXXXXXXXXXXXXFTVEGAKIIEQIQILN 3205
            MGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCDKEINQPEFFGTYDYLRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQKSDFTIKHAGAKYPKPSPSKQFNEYEKKMKEYYQNKNKNKFNLTLGEYPGYFYLLKDNAIAYAMNAKNKISMTLSTVGKGRIAFMGSDDLINVKPYKILLDFFQDVFDKPVESPTLLNKSYLQEIISKNKSQSVLSEPFIWNAEQVFGQDLVKVLLEYIKSGLRIIIGFESWSYIDKIKPLLDSELKILFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFDDIYIERSLDK DFD MKKVI+DLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKDEWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQEGTFTFNGTGETTTNIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRGSIFRQPLPVPVKVGPVKNKFTVEGAKIIE IQILN
Sbjct:    1 MGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCDKEINQPEFFGTYDYLRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQKSDFTIKHAGAKYPKPSPSKQFNEYEKKMKEYYQNKNKNKFNLTLGEYPGYFYLLKDNAIAYAMNAKNKISMTLSTVGKGRIAFMGSDDLINVKPYKILLDFFQDVFDKPVESPTLLNKSYLQEIISKNKSQSVLSEPFIWNAEQVFGQDLVKVLLEYIKSGLRIIIGFESWSYIDKIKPLLDSELKILFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFDDIYIERSLDKIDFDLMKKVINDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKDEWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQEGTFTFNGTGETTTNIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRGSIFRQPLPVPVKVGPVKNKFTVEGAKIIEHIQILN 1030          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026376.1 (SMESG000026376.1)

HSP 1 Score: 1909.81 bits (4946), Expect = 0.000e+0
Identity = 947/1069 (88.59%), Postives = 996/1069 (93.17%), Query Frame = 2
Query:    8 MLSAQLSVIFSLQYVIFAGYFEEIEKCRMTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCDKEINQPEFFGTYDYLRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQKSDFTIKHAGAKYPKPSPSKQFNEYEKKMKEYYQNKNKNKFNLTLGEYPGYFYLLKDNAIAYAMNAKNKISMTLSTVGKGRIAFMGSDDLINVKPYKILLDFFQDVFDKPVESPTLLNKSYLQEIISKNKSQSVLSEPFIWNAEQVFGQDLVKVLLEYIKSGLRIIIGFESWSYIDKIKPLLDSELKILFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFDDIYIERSLDKKDFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKD---EWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXXXXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRGSIFRQXXXXXXXXXXXXXXFTVEGAKIIEQIQILN 3205
            ML  QLS IF LQ VIFAGYFEEIEKC+++THG EYMGKV++ KSGQRCI WKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNG WCIIDEMTLEWEHCNIIKC+KDRNWCKDSDKGTEYLGDISHTKSGK+C+PWINF  H A SFPE N+  AGNKCRNPDMSKVPWCYYSNNYQREDCNV RCD+ INQPE+FGTYDYLRGLGS+KTIVKLDDIY TV VTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYE+CS+   T TS+DYIITYLCSGPLKYLMFISLLQKSDFTIKH G KYPKPSPSKQFNEY+KKMKEYYQNKNK +   +L  YPGYFYLLKDNAIAYA+NA NKISMT+STVGKGRI FM  +D IN+  YK LL++FQDVFDKPV  P LL KSYLQEIIS+NKS SVLSEPFIWNA Q FGQ LV VLLEYIKSGLRIIIGF+ WSY   +KP+LDSE+KILFYAAG+WPSL Y++D+F+PVTQHSI+TMSLDKKFEYAKIN   MNDVLAAYREVFDDIYIERSLDKKDFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPAL+LYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKT VKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTI+RGKWETIQFPFGGLMSISC+ENNDKVEIIFKNVIQIPYYDRRNK+   +WI+KQKIESPWAVLAGDAV+FILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFP SRRGIVSSDIQIG GYMHSGYPIGTQIY+NNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQEGTFTFNGTGETTTNIFSIIATESMTNQNSWSQTSGWFHERLTIE VQ+YLI+GTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEIS MNLCPLYELWKWPI++ TEQELSK PMFLPDDFVTKSVEKR   II +RGS+ RQPLPVPVKVGPVKNKFTVEGAKIIE IQILN
Sbjct:    1 MLIVQLSAIFYLQCVIFAGYFEEIEKCKISTHGGEYMGKVNYGKSGQRCIFWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGPWCIIDEMTLEWEHCNIIKCVKDRNWCKDSDKGTEYLGDISHTKSGKMCKPWINFRKHTANSFPENNVHLAGNKCRNPDMSKVPWCYYSNNYQREDCNVSRCDEAINQPEYFGTYDYLRGLGSSKTIVKLDDIYHTVTVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEFCSVKKLTKTSEDYIITYLCSGPLKYLMFISLLQKSDFTIKHVGTKYPKPSPSKQFNEYDKKMKEYYQNKNKKEVTFSLARYPGYFYLLKDNAIAYAVNANNKISMTISTVGKGRIGFMAGEDSINLGSYKNLLNYFQDVFDKPVVKPKLLRKSYLQEIISENKSLSVLSEPFIWNAHQTFGQGLVNVLLEYIKSGLRIIIGFKPWSYESYVKPILDSEIKILFYAAGIWPSLHYIEDKFKPVTQHSIYTMSLDKKFEYAKINIKNMNDVLAAYREVFDDIYIERSLDKKDFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALALYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTSVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIKRGKWETIQFPFGGLMSISCDENNDKVEIIFKNVIQIPYYDRRNKENSKDWIRKQKIESPWAVLAGDAVIFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPLSRRGIVSSDIQIGAGYMHSGYPIGTQIYYNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQEGTFTFNGTGETTTNIFSIIATESMTNQNSWSQTSGWFHERLTIESVQEYLINGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISKMNLCPLYELWKWPISDATEQELSKFPMFLPDDFVTKSVEKRTNNIIRRRGSVIRQPLPVPVKVGPVKNKFTVEGAKIIEHIQILN 1069          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026362.1 (SMESG000026362.1)

HSP 1 Score: 1776.14 bits (4599), Expect = 0.000e+0
Identity = 871/1069 (81.48%), Postives = 956/1069 (89.43%), Query Frame = 2
Query:    8 MLSAQLSVIFSLQYVIFAGYFEEIEKCRMTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCDKEINQPEFFGTYDYLRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQKSDFTIKHAGAKYPKPSPSKQFNEYEKKMKEYYQNKNKNKFNLTLGEYPGYFYLLKDNAIAYAMNAKNKISMTLSTVGKGRIAFMGSDDLINVKPYKILLDFFQDVFDKPVESPTLLNKSYLQEIISKNKSQSVLSEPFIWNAEQVFGQDLVKVLLEYIKSGLRIIIGFESWSYIDKIKPLLDSELKILFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFDDIYIERSLDKKDFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKD---EWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKKDGAWGLMHEMGHNLQXXXXXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRGSIFRQXXXXXXXXXXXXXXFTVEGAKIIEQIQILN 3205
            ML  QLSVIFSLQYV FAGYFEEIEKCRMTTHG EYMGKV+F KSGQRCI WKNEYVN I+MDDTFVF NTSIIGNNYCRNPTNFP G WCIIDE+TLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGK+C+PWINF  H A SFPE N+  AGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCD+ INQPE+FGTY+YL+G+ + KTIVKLDDIY TV VTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYE+CS+   T TS+DYIITYLCSGPLKYLMFISLLQKSDFTIKH G KYPKPSPSKQFNEY++KM EYYQ K+K +  ++LG +PG+FYLLKDNAI YAMNA NKISMT+STVGKGRIAFMGS+DLIN KPYK LLDFFQDVFDKPVE+P LLNK YLQ+IIS+NKS+S+LS+PFIW+  ++ G  LV +LLEYIKSGLRIIIGF+ WSY D  +PL  SEL ILF+AAGVWPSLKYVQD+FQPVTQHSI+TMSLDK+FEYAK NN  MNDV   +++VFDDI IERSLDK++FD MK  IHDLY DYWPFIQSLTPCL   +S QSD+ FLKFFSYILL+E GKDL+PPALSLYPGKFQSTNPP VNIKMKLNLLYK EVAPLGLYLYPR KTPVKIIQSKSTRCYIYVNHH F++ADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNK+   +WI+KQKI++PWAVLAGD +VF+++S AIRNLADPET+LQMYDSMFKEE HLRGTSFP SRR I++SDIQI  GYMHSGYPIGTQI++NNNP++ GYFFNK++LKK+GAWGL+HE+GHNLQ   FTF+GT ETT NIFSIIAT SMTN++SWS TSGWF ERLTIERVQ+YLISGTFD NWR NHFVALCIYAQ+ N FGWEFYAQVFRRYN L ++   IS+D  IQLWIK TSEIS MNLCPLYELWKWPI+N  E+ELSK PMFLPDDFVTKSVE RI +II KRGS+ RQPLPVPVKVGPVKNKFTVEGAKIIEQIQILN
Sbjct:    1 MLIVQLSVIFSLQYVTFAGYFEEIEKCRMTTHGGEYMGKVNFGKSGQRCIFWKNEYVNHIVMDDTFVFVNTSIIGNNYCRNPTNFPRGPWCIIDEITLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKMCKPWINFRKHTANSFPENNVHLAGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCDRTINQPEYFGTYNYLKGIYNYKTIVKLDDIYHTVTVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEFCSVKKLTKTSEDYIITYLCSGPLKYLMFISLLQKSDFTIKHVGTKYPKPSPSKQFNEYDRKMNEYYQKKSKKELQISLGRFPGHFYLLKDNAIVYAMNANNKISMTISTVGKGRIAFMGSEDLINAKPYKSLLDFFQDVFDKPVENPKLLNKYYLQKIISENKSESILSQPFIWSPYRLLGPKLVGILLEYIKSGLRIIIGFKPWSYDDDKRPLSSSELTILFHAAGVWPSLKYVQDKFQPVTQHSIYTMSLDKRFEYAKKNNEIMNDVTEMFQKVFDDISIERSLDKRNFDLMKNSIHDLYADYWPFIQSLTPCLEVPVSAQSDRYFLKFFSYILLTEFGKDLMPPALSLYPGKFQSTNPPVVNIKMKLNLLYKNEVAPLGLYLYPRHKTPVKIIQSKSTRCYIYVNHHQFHVADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKENSKDWIRKQKIKAPWAVLAGDTMVFVISSIAIRNLADPETLLQMYDSMFKEELHLRGTSFPLSRRDILTSDIQIKAGYMHSGYPIGTQIFYNNNPHRPGYFFNKKLLKKEGAWGLVHELGHNLQHDIFTFSGTIETTNNIFSIIATVSMTNESSWSPTSGWFKERLTIERVQEYLISGTFDKNWRGNHFVALCIYAQLINNFGWEFYAQVFRRYNVLANELGGISDDAIIQLWIKTTSEISKMNLCPLYELWKWPISNTNEKELSKFPMFLPDDFVTKSVENRINDIIRKRGSVIRQPLPVPVKVGPVKNKFTVEGAKIIEQIQILN 1069          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026355.1 (SMESG000026355.1)

HSP 1 Score: 1219.14 bits (3153), Expect = 0.000e+0
Identity = 600/1057 (56.76%), Postives = 790/1057 (74.74%), Query Frame = 2
Query:   59 AGYFEEIEKCRMTTHGREYMGKVDFVKSGQRCIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTLEWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRAYSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCDKEINQPEFFGTYDYLRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWATAYNVECQSDLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQKSDFTIKHAGAKYP-KPSPSKQFNEYEKKMKEYYQNKNKNKFNLTLGEYPGYFYLLKDNAIAYAMNAKNKISMTLSTVGKGRIAFMGSDDLINVKPYKILLDFFQDVFDKPVESPTLLNKSYLQEIISKNKSQSVLSEPFIWNAEQVFGQDLVKVLLEYIKSGLRIIIGFESWSYIDKIKPLLDSELKILFYAAGVWPSLKYVQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFDDIYIERSLDKKDFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNK---DEWIQKQKIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPY-KSGYFFNKEILKKDGAWGLMHEMGHNLQXXXXXXXXXXXXXXXIFSIIATESMTNQNSWSQTSGWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRG---SIFRQXXXXXXXXXXXXXXFTVEGAKIIEQIQILN 3205
            + YF +IE C++TTHGRE++G+    K+GQ+CI WK E++N++       +D+ S+IGNNYCRNPTNFPNG WCIIDE TL+WE+CNI  CIKDRNWCKD++ G EYLGD+++TKSGK C PWIN  TH   SFPE+NL   GNKCRNPDMS+ PWCYYS   +RE+C+VP+CDK+ +Q E+FG YD+L+ +    TI+ LD+IYQ V  T+SIKLESL S  LNK+S+WAT YN +CQ+DLDEYEYC+I  S +  ++YII+Y C  PL++LMFIS L+K+++TIK++G  Y     PS++F EYE K+ EY Q KNKN+  +   + PG+F+L  +NAIAYA NA N+I +T+STVGKGRIAF+ +D +++   +  L D F DV++K VESPT L K YLQEIISKN  +S L EPFIWNA    G++LV  LL+ + SGLRIIIG + W+Y+   K +LDSELKILF AAGVWPSL Y  + ++ VT+HS++TM L ++ EYAK+N  T+ +V  A  ++   I +E+ L + +F+ +++ I DLY++Y P I+ L PC    ++ +S+K  L+FF++IL S  GK +I P LS YPGKF S + P  +IKM+LNL+Y  EVA LGLY  PR+   VKI QSKS  C I++N+HHF++++K E+ KWP TY  F+IER K ET  F FGGL+SISC+E+NDKVEI F NV++IP +DRRNK    +WI KQ + SPWAV+A D +VF+L+S AIRNLADP + L+++D M KEEFHL G +   SRR +VS+DIQIG GYMHSGYPIGT+I+   NP  +  YFF+   L  DG WGLMHE+GHNLQE  FTFNG GE T NIF+++A ESMTN++SWS T+GW  E+L ++ +  ++ +GTF  NW+EN F+AL IYAQ +N FGWEF+AQVFRRYN L ++  +IS+++KIQLWIK TSEISGMNLCPLYELW+WPI+ +TE ELSKL MFLPDDF+TK VEKR+ EII K G   S+ R PL +P K+GP+ N+F +EGA+IIE+IQILN
Sbjct:   18 SSYFTDIENCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTENGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEKNLNLVGNKCRNPDMSEGPWCYYSTENKREECDVPKCDKKFSQIEYFGGYDFLKLIPDQMTIISLDNIYQDVKATVSIKLESLNSDILNKTSLWATDYNPKCQTDLDEYEYCTIVESKSEDENYIISYSCLEPLRHLMFISPLKKTEYTIKYSGKLYKINWKPSERFTEYENKVNEYLQKKNKNELKIQSDQIPGHFFLFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNSHESALLEPFIWNAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYVTYHKKILDSELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGLYAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVETFSFSFGGLLSISCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQ-NWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTENELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFAIEGAQIIEEIQILN 1073          
The following BLAST results are available for this feature:
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCAF2C2.068e-3527.88TRPM8 channel associated factor 2C [Source:HGNC Sy... [more]
TCAF22.782e-3527.61TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF23.214e-3527.61TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF23.214e-3527.61TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF12.705e-3227.30TRPM8 channel associated factor 1 [Source:HGNC Sym... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cam-16.028e-1042.05Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-16.103e-1042.05Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-16.331e-1042.05Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-210b2.31.149e-3628.84si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
si:ch211-210b2.21.398e-3528.89si:ch211-210b2.2 [Source:ZFIN;Acc:ZDB-GENE-131118-... [more]
si:ch211-210b2.43.199e-3428.40si:ch211-210b2.4 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
zgc:1621938.245e-3026.48zgc:162193 [Source:NCBI gene;Acc:323315][more]
zgc:1621938.245e-3026.48zgc:162193 [Source:NCBI gene;Acc:323315][more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000045101.13.240e-3729.44TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000045059.11.971e-3328.23TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000045084.13.365e-3227.97TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000045039.15.651e-3227.97TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000002244.14.577e-3026.20TRPM8 channel-associated factor homolog [Source:NC... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tcaf16.739e-3627.73TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf16.739e-3627.73TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf16.739e-3627.73TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf31.362e-3329.22TRPM8 channel-associated factor 3 [Source:MGI Symb... [more]
Tcaf28.938e-3227.76TRPM8 channel-associated factor 2 [Source:MGI Symb... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BNE1|TCAF1_MOUSE4.497e-3527.73TRPM8 channel-associated factor 1 OS=Mus musculus ... [more]
sp|A6NFQ2|TCAF2_HUMAN1.336e-3427.61TRPM8 channel-associated factor 2 OS=Homo sapiens ... [more]
sp|Q6P6V7|TCAF3_RAT3.872e-3329.22TRPM8 channel-associated factor 3 OS=Rattus norveg... [more]
sp|Q6QR59|TCAF3_MOUSE9.525e-3329.22TRPM8 channel-associated factor 3 OS=Mus musculus ... [more]
sp|Q5XHI4|TCAF_XENLA4.392e-3228.12TRPM8 channel-associated factor homolog OS=Xenopus... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZHF72.392e-5627.21Peptidase M60 domain-containing protein OS=Lottia ... [more]
R7UHN92.774e-5527.66Peptidase M60 domain-containing protein OS=Capitel... [more]
A0A1S3I0H49.293e-5430.07TRPM8 channel-associated factor 2-like OS=Lingula ... [more]
V4A0M89.087e-5326.20Peptidase M60 domain-containing protein OS=Lottia ... [more]
A0A1S3KG345.357e-5229.84TRPM8 channel-associated factor 2 OS=Lingula ungui... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-210b2.33.283e-3024.19si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
ENSAMXT00000051129.14.264e-1930.99pep primary_assembly:Astyanax_mexicanus-2.0:1:5658... [more]
mst14.738e-1832.82macrophage stimulating 1 [Source:NCBI gene;Acc:103... [more]
hgfb1.732e-1627.91hepatocyte growth factor [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000018418.26.037e-1633.15plasminogen [Source:NCBI gene;Acc:103036400][more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000976.16.623e-2424.70pep scaffold:Pmarinus_7.0:GL479898:35358:38300:-1 ... [more]
ENSPMAT00000003778.13.125e-1528.72pep scaffold:Pmarinus_7.0:GL482904:4425:14035:-1 g... [more]
hgfb6.174e-1325.82hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000001728.14.869e-831.11pep scaffold:Pmarinus_7.0:GL477419:32233:56220:-1 ... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO397635.615e-843.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289267.364e-843.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301931.460e-730.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-210b2.32.398e-3229.33TRPM8 channel-associated factor homolog [Source:NC... [more]
mst12.002e-1833.65hepatocyte growth factor-like protein [Source:NCBI... [more]
plat6.757e-1432.81plasminogen activator, tissue type [Source:NCBI ge... [more]
plat9.107e-1432.81plasminogen activator, tissue type [Source:NCBI ge... [more]
plat9.902e-1432.81plasminogen activator, tissue type [Source:NCBI ge... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026361.10.000e+099.61SMESG000026361.1[more]
SMESG000026361.10.000e+099.61SMESG000026361.1[more]
SMESG000026376.10.000e+088.59SMESG000026376.1[more]
SMESG000026362.10.000e+081.48SMESG000026362.1[more]
SMESG000026355.10.000e+056.76SMESG000026355.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019854 ID=SMED30019854|Name=Peptidase M60 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3244bp
TATATTCATGCTCTCTGCTCAATTGTCCGTAATTTTCTCTTTGCAATATG
TAATTTTTGCTGGTTATTTCGAAGAAATAGAGAAATGTAGAATGACAACG
CACGGACGAGAATATATGGGAAAAGTGGATTTTGTGAAAAGTGGACAACG
ATGCATCGTTTGGAAAAATGAATATGTAAATCAAATACTTATGGACGATA
CATTTGTTTTTGACAATACCTCCATTATTGGTAACAATTATTGCAGAAAT
CCGACGAACTTTCCAAACGGTCTGTGGTGCATTATCGATGAGATGACATT
GGAATGGGAGCACTGTAATATTATAAAGTGCATAAAAGATCGAAATTGGT
GCAAAGATTCTGATAAAGGGACAGAGTATCTTGGTGACATAAGTCATACA
AAATCTGGTAAACTGTGCCAGCCATGGATTAATTTCGGAACACATAGGGC
GTACTCCTTTCCAGAAAGGAATCTAAAATTTGCTGGGAACAAATGTCGTA
ATCCAGATATGTCTAAAGTTCCCTGGTGCTATTATTCGAATAACTATCAA
AGGGAGGACTGCAATGTTCCAAGATGCGATAAAGAAATCAATCAGCCGGA
ATTTTTTGGAACTTATGATTACTTGAGAGGACTGGGCAGCAACAAGACAA
TAGTTAAACTGGATGACATATATCAAACAGTGAATGTTACCTTGTCCATC
AAACTTGAGTCATTGAAATCACGTACGTTGAATAAGTCATCAATGTGGGC
AACGGCTTATAATGTTGAATGTCAATCTGATTTAGACGAATATGAATATT
GTTCAATAACCTCCTCGACAAATACTAGTCAAGATTACATTATTACCTAT
TTGTGTTCGGGGCCATTGAAATATTTGATGTTCATTTCCTTGCTACAGAA
ATCAGATTTCACAATCAAGCACGCGGGAGCAAAATATCCAAAACCTAGTC
CTAGTAAACAGTTTAATGAATATGAAAAAAAGATGAAAGAATATTATCAA
AATAAAAATAAAAATAAATTTAATTTAACATTGGGCGAATATCCAGGTTA
CTTTTACCTGTTGAAGGATAACGCAATTGCTTACGCAATGAATGCCAAGA
ATAAAATTTCCATGACTCTTTCAACAGTTGGAAAAGGCCGCATTGCATTT
ATGGGATCTGATGATTTGATTAATGTTAAACCCTATAAAATTCTACTGGA
TTTTTTTCAAGATGTTTTTGACAAGCCTGTAGAAAGTCCAACGTTGTTGA
ACAAATCATATTTACAAGAAATAATTTCAAAGAACAAATCACAATCCGTA
TTATCAGAACCTTTCATATGGAATGCTGAACAGGTATTCGGACAAGACTT
AGTTAAGGTTTTACTTGAATATATAAAATCAGGATTAAGGATTATCATTG
GGTTCGAATCGTGGTCATACATAGACAAAATAAAACCGCTTTTAGACAGT
GAACTTAAAATCCTGTTCTATGCTGCAGGAGTTTGGCCGTCATTGAAATA
TGTTCAGGACCAATTTCAACCTGTCACTCAACACTCCATACATACGATGT
CCTTAGATAAAAAGTTTGAATATGCTAAAATTAATAATGTAACCATGAAC
GATGTACTAGCTGCGTATCGCGAAGTATTTGATGATATATATATCGAGAG
GTCATTAGACAAAAAAGACTTTGACTCGATGAAAAAAGTTATTCATGATT
TATATACAGATTACTGGCCGTTTATTCAAAGTCTCACACCTTGTTTAAAT
TACGCAATTTCAAAACAGTCCGACAAAGGTTTTCTTAAATTTTTCAGTTA
CATTTTACTTTCCGAAATCGGAAAAGATTTGATTCCTCCTGCATTGTCAC
TTTATCCTGGTAAGTTTCAATCAACTAATCCTCCGTTTGTAAATATCAAG
ATGAAGCTCAATCTACTTTATAAATATGAAGTCGCCCCTCTTGGCCTTTA
TCTTTATCCTAGACTAAAGACCCCAGTCAAAATTATTCAATCTAAATCAA
CACGATGCTATATATATGTAAATCATCACCATTTTAATATCGCTGATAAA
TCTGAGGTTACGAAATGGCCAGTCACATATAAGTATTTCACAATTGAAAG
AGGCAAATGGGAAACTATTCAGTTTCCATTTGGAGGATTGATGTCAATTT
CCTGTAATGAAAATAATGATAAAGTCGAAATAATCTTTAAAAATGTAATA
CAAATACCGTACTATGATAGACGAAACAAGGATGAATGGATTCAAAAACA
AAAAATAGAATCGCCATGGGCAGTCTTAGCTGGCGATGCAGTTGTATTTA
TATTAGCATCAACTGCTATTCGTAATTTAGCCGATCCGGAAACGATTTTA
CAGATGTACGATTCAATGTTCAAGGAAGAATTTCATTTGAGAGGAACATC
ATTTCCTTTTAGTCGCAGAGGCATAGTGTCTAGTGATATACAGATTGGAG
TAGGATATATGCATTCGGGATACCCTATAGGTACACAAATATACCATAAC
AATAATCCATACAAGTCAGGATACTTTTTTAACAAAGAAATATTGAAAAA
GGATGGTGCTTGGGGTTTAATGCATGAAATGGGACACAATTTACAAGAAG
GAACATTTACTTTTAATGGAACAGGTGAAACTACGACTAACATATTTTCT
ATCATAGCTACTGAATCTATGACTAACCAAAATTCTTGGTCGCAAACCAG
TGGTTGGTTTCATGAGCGGTTGACAATTGAACGTGTTCAAAAATATCTGA
TTAGTGGAACGTTTGATAACAACTGGAGAGAAAACCATTTTGTAGCGTTA
TGTATTTATGCTCAAATAAAAAATTATTTTGGATGGGAGTTTTATGCTCA
AGTTTTTCGGCGGTATAATGCGCTTACACACAAGCAAAGAAGTATTTCTG
AAGATGAGAAAATTCAACTTTGGATCAAAATAACCTCTGAAATATCCGGA
ATGAATTTGTGTCCCTTATATGAGCTGTGGAAATGGCCTATTACTAACCA
AACTGAACAAGAATTATCTAAACTTCCAATGTTTCTTCCGGATGATTTTG
TTACGAAATCTGTCGAAAAGAGAATTAAAGAAATAATTTGTAAAAGAGGA
TCAATTTTTCGTCAACCATTGCCAGTACCCGTAAAGGTTGGACCAGTGAA
AAACAAATTTACAGTTGAAGGAGCTAAAATAATTGAACAAATTCAAATAT
TGAACTGATTTAAATAATGTCGTTTGAAAAATAAAACTCCGAAA
back to top

protein sequence of SMED30019854-orf-1

>SMED30019854-orf-1 ID=SMED30019854-orf-1|Name=SMED30019854-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1069bp
IFMLSAQLSVIFSLQYVIFAGYFEEIEKCRMTTHGREYMGKVDFVKSGQR
CIVWKNEYVNQILMDDTFVFDNTSIIGNNYCRNPTNFPNGLWCIIDEMTL
EWEHCNIIKCIKDRNWCKDSDKGTEYLGDISHTKSGKLCQPWINFGTHRA
YSFPERNLKFAGNKCRNPDMSKVPWCYYSNNYQREDCNVPRCDKEINQPE
FFGTYDYLRGLGSNKTIVKLDDIYQTVNVTLSIKLESLKSRTLNKSSMWA
TAYNVECQSDLDEYEYCSITSSTNTSQDYIITYLCSGPLKYLMFISLLQK
SDFTIKHAGAKYPKPSPSKQFNEYEKKMKEYYQNKNKNKFNLTLGEYPGY
FYLLKDNAIAYAMNAKNKISMTLSTVGKGRIAFMGSDDLINVKPYKILLD
FFQDVFDKPVESPTLLNKSYLQEIISKNKSQSVLSEPFIWNAEQVFGQDL
VKVLLEYIKSGLRIIIGFESWSYIDKIKPLLDSELKILFYAAGVWPSLKY
VQDQFQPVTQHSIHTMSLDKKFEYAKINNVTMNDVLAAYREVFDDIYIER
SLDKKDFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSY
ILLSEIGKDLIPPALSLYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLY
LYPRLKTPVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIER
GKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKDEWIQKQ
KIESPWAVLAGDAVVFILASTAIRNLADPETILQMYDSMFKEEFHLRGTS
FPFSRRGIVSSDIQIGVGYMHSGYPIGTQIYHNNNPYKSGYFFNKEILKK
DGAWGLMHEMGHNLQEGTFTFNGTGETTTNIFSIIATESMTNQNSWSQTS
GWFHERLTIERVQKYLISGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQ
VFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQ
TEQELSKLPMFLPDDFVTKSVEKRIKEIICKRGSIFRQPLPVPVKVGPVK
NKFTVEGAKIIEQIQILN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005575cellular_component
Vocabulary: INTERPRO
TermDefinition
IPR038178Kringle_sf
IPR042279Pep_M60_3
IPR035423M60-like_N
IPR031161Peptidase_M60_dom
IPR000001Kringle
IPR018056Kringle_CS
IPR013806Kringle-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00018KRINGLEcoord: 134..146
score: 39.91
coord: 158..178
score: 43.94
coord: 118..133
score: 31.13
coord: 181..192
score: 35.22
NoneNo IPR availableGENE3DG3DSA:1.10.1740.210coord: 738..863
e-value: 3.3E-5
score: 26.3
NoneNo IPR availablePANTHERPTHR15730EXPERIMENTAL AUTOIMMUNE PROSTATITIS ANTIGEN 2-RELATEDcoord: 622..1010
NoneNo IPR availablePANTHERPTHR15730:SF5SI:CH211-210B2.2-RELATEDcoord: 622..1010
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.588
IPR031161Peptidase family M60 domainSMARTSM01276M60_like_2coord: 642..944
e-value: 6.9E-42
score: 155.2
IPR031161Peptidase family M60 domainPFAMPF13402Peptidase_M60coord: 732..994
e-value: 1.0E-42
score: 146.5
IPR031161Peptidase family M60 domainPROSITEPS51723PEPTIDASE_M60coord: 642..944
score: 52.311
IPR000001KringleSMARTSM00130KR_2coord: 27..112
e-value: 3.9E-9
score: 46.2
coord: 115..194
e-value: 3.1E-12
score: 56.7
IPR000001KringlePFAMPF00051Kringlecoord: 121..192
e-value: 1.7E-12
score: 47.5
coord: 31..110
e-value: 1.5E-13
score: 50.8
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 34..110
score: 13.859
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 122..192
score: 16.021
IPR038178Kringle superfamilyGENE3DG3DSA:2.40.20.10coord: 114..200
e-value: 1.5E-17
score: 65.9
IPR038178Kringle superfamilyGENE3DG3DSA:2.40.20.10coord: 19..113
e-value: 8.4E-17
score: 63.1
IPR042279Peptidase M60, enhancin-like domain 3GENE3DG3DSA:1.10.390.30coord: 865..1028
e-value: 7.3E-28
score: 99.5
IPR035423M60-like domain, N-terminalPFAMPF17291M60-like_Ncoord: 646..724
e-value: 1.0E-5
score: 25.4
IPR018056Kringle, conserved sitePROSITEPS00021KRINGLE_1coord: 80..93
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 30..111
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 120..209