CCDC151

Overview
NameCCDC151 (AIJ50388.1)
Smed IDSMED30019836
Uniprot Best hitCoiled-coil domain-containing protein 151 OS=Bos taurus OX=9913 GN=CCDC151 PE=2 SV=1 (E=1.76124e-71)
Length (bp)2033
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CCDC151 (SMED30019836) t-SNE clustered cells

Violin plots show distribution of expression levels for CCDC151 (SMED30019836) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CCDC151 (SMED30019836) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CCDC151 (SMED30019836) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019836

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019836SMESG000007771.1 SmedASXL_012380SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30019836SMESG000007771.1 dd_Smed_v4_4526_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30019836SMESG000007771.1 dd_Smed_v4_4526_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019836SMESG000007771.1 dd_Smed_v4_4526_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30019836SMESG000007771.1 dd_Smed_v4_4526_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30019836SMESG000007771.1 dd_Smed_v4_4526_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019836SMESG000007771.1 dd_Smed_v6_4526_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30019836SMESG000007771.1 dd_Smed_v4_4526_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30019836SMESG000007771.1 dd_Smed_v4_4526_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30019836SMESG000007771.1 dd_Smed_v4_4526_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CCDC151 vs. Ensembl Human
Match: CCDC151 (coiled-coil domain containing 151 [Source:HGNC Symbol;Acc:HGNC:28303])

HSP 1 Score: 241.506 bits (615), Expect = 2.524e-70
Identity = 177/540 (32.78%), Postives = 304/540 (56.30%), Query Frame = 1
Query:   85 GALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEE---QQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLP-QVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            GA +  V  ++ E+  K+ LLEGDRKA+FESS+  +   ++ +++LR++   L L+L D L  D+ V+    +    E+  L N+T   A++ +D+++ +  K+ NAL+H    +Q+RL+ELQ Q++    + AEAQ       +  + +R+LENRL+KA +K  EAEHI + Y Q+KA L DE LN  N LD+MEAE+ R + E+  L +++Q+A  A+  A  +L   E  +  ER++R+  +   K+ A+EK+L  E++E++         ++D    ++   EE   Q+  +   E  F  +K+ATG  +   +V RF  QG+T   L  LK E ++ + +L++EK ++Q    ++KY+GE  + + QKL  E ++++ +EE R    KD LER+ + +   K  +EHL  KL HI V        ++D  +D +V ++L   EE+LL+L   L   D++  L  +   EF   +E ++P +N R+ LP    KD  ++ E E            ++D +++TR  +K +SQ+L++
Sbjct:   61 GAGKPSVHSQVAELHKKIQLLEGDRKAFFESSQWNIKKNQETISQLRKETKALELKLLDLLKGDEKVVQAVIREWKWEKPYLKNRTGQ-ALEHLDHRLREKVKQQNALRHQVVLRQRRLEELQLQHSLRLLEMAEAQNR---HTEVAKTMRNLENRLEKAQMKAQEAEHITSVYLQLKAYLMDESLNLENRLDSMEAEVVRTKHELEALHVVNQEALNARDIAKNQLQYLEETLVRERKKRERYISECKKRAEEKKLENERMERKTHREHLLLQSDDTIQDSLHAKEEELRQRWSMYQMEVIFGKVKDATGTDETHSLVRRFLAQGDTFAQLETLKSENEQTLVRLKQEKQQLQRELEDLKYSGEATLVSQQKLQAEAQERLKKEERRHAEAKDQLERALRAMQVAKDSLEHLASKLIHITVEDGRFAGKELDPQADNYVPNLLGLVEEKLLKLQAQLQGHDVQEMLCHIANREFLASLEGRLPEYNTRIALPLATSKDKFFDEESE------------EEDNEVVTRASLKIRSQKLIE 584          
BLAST of CCDC151 vs. Ensembl Human
Match: CCDC151 (coiled-coil domain containing 151 [Source:HGNC Symbol;Acc:HGNC:28303])

HSP 1 Score: 181.8 bits (460), Expect = 2.882e-50
Identity = 129/391 (32.99%), Postives = 219/391 (56.01%), Query Frame = 1
Query:  532 LRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEE---QQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLP-QVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            +R+LENRL+KA +K  EAEHI + Y Q+KA L DE LN  N LD+MEAE+ R + E+  L +++Q+A  A+  A  +L   E  +  ER++R+  +   K+ A+EK+L  E++E++         ++D    ++   EE   Q+  +   E  F  +K+ATG  +   +V RF  QG+T   L  LK E ++ + +L++EK ++Q    ++KY+GE  + + QKL  E ++++ +EE R    KD LER+ + +   K  +EHL  KL HI V        ++D  +D +V ++L   EE+LL+L   L   D++  L  +   EF   +E ++P +N R+ LP    KD  +            +E+S ++D +++TR  +K +SQ+L++
Sbjct:   15 MRNLENRLEKAQMKAQEAEHITSVYLQLKAYLMDESLNLENRLDSMEAEVVRTKHELEALHVVNQEALNARDIAKNQLQYLEETLVRERKKRERYISECKKRAEEKKLENERMERKTHREHLLLQSDDTIQDSLHAKEEELRQRWSMYQMEVIFGKVKDATGTDETHSLVRRFLAQGDTFAQLETLKSENEQTLVRLKQEKQQLQRELEDLKYSGEATLVSQQKLQAEAQERLKKEERRHAEAKDQLERALRAMQVAKDSLEHLASKLIHITVEDGRFAGKELDPQADNYVPNLLGLVEEKLLKLQAQLQGHDVQEMLCHIANREFLASLEGRLPEYNTRIALPLATSKDKFF------------DEESEEEDNEVVTRASLKIRSQKLIE 393          
BLAST of CCDC151 vs. Ensembl Human
Match: CCDC151 (coiled-coil domain containing 151 [Source:HGNC Symbol;Acc:HGNC:28303])

HSP 1 Score: 174.866 bits (442), Expect = 1.098e-46
Identity = 154/540 (28.52%), Postives = 271/540 (50.19%), Query Frame = 1
Query:   85 GALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEE---QQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLP-QVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            GA +  V  ++ E+  K+ LLEGDRKA+FESS+  +   ++ +++LR++   L L+L D L A +H                           +D+++ +  K+ NAL+H    +Q+RL+ELQ Q++    + AEAQ                                  N + ++    +DE LN  N LD+MEAE+ R + E+  L +++Q+A  A+  A  +L   E  +  ER++R+  +   K+ A+EK+L  E++E++         ++D    ++   EE   Q+  +   E  F  +K+ATG  +   +V RF  QG+T   L  LK E ++ + +L++EK ++Q    ++KY+GE  + + QKL  E ++++ +EE R    KD LER+ + +   K  +EHL  KL HI V        ++D  +D +V ++L   EE+LL+L   L   D++  L  +   EF   +E ++P +N R+ LP    KD  ++ E E            ++D +++TR  +K +SQ+L++
Sbjct:   61 GAGKPSVHSQVAELHKKIQLLEGDRKAFFESSQWNIKKNQETISQLRKETKALELKLLDLLKALEH---------------------------LDHRLREKVKQQNALRHQVVLRQRRLEELQLQHSLRLLEMAEAQ----------------------------------NRHTEVA---KDESLNLENRLDSMEAEVVRTKHELEALHVVNQEALNARDIAKNQLQYLEETLVRERKKRERYISECKKRAEEKKLENERMERKTHREHLLLQSDDTIQDSLHAKEEELRQRWSMYQMEVIFGKVKDATGTDETHSLVRRFLAQGDTFAQLETLKSENEQTLVRLKQEKQQLQRELEDLKYSGEATLVSQQKLQAEAQERLKKEERRHAEAKDQLERALRAMQVAKDSLEHLASKLIHITVEDGRFAGKELDPQADNYVPNLLGLVEEKLLKLQAQLQGHDVQEMLCHIANREFLASLEGRLPEYNTRIALPLATSKDKFFDEESE------------EEDNEVVTRASLKIRSQKLIE 524          
BLAST of CCDC151 vs. Ensembl Fly
Match: CCDC151 (gene:FBgn0036219 transcript:FBtr0076037)

HSP 1 Score: 71.633 bits (174), Expect = 1.402e-12
Identity = 106/462 (22.94%), Postives = 207/462 (44.81%), Query Frame = 1
Query:  112 EIDEIKAKLALLEGDRKA-YFESSRQALDDCKKRVTELRRD-------NNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPV-------AIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQY-----NELARDTAEAQATLEGANKEGQR--LRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAAREST--------SNAEDERTSAIGITEEQ-----QKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEF 1392
            +I+EIK ++ L EG + A   E  +Q   +C   ++ L++D        ++LR  L   +   +           T   ++   T PV       AI   D K+++  K+++ L+H   S+Q+   +L  +Y     N+ A++    +   E   ++  R  +  LEN + +  ++  EAEHI+  Y  I+A L  +   +  +L  +EA +   + E+  L+ +H +A   + AA   L RQE      ++ R+ +  + ++  + ++L  E++ +++ A   T        S++ D+ T+     EE+     +   +D E  FK + EA+G +   EV  RF  Q E+   L  L+  A+     L  E++ +       K++   +    Q+++E+ K  +  +E  R    D+  +S  VL   K  I  +  K++ +  S    P+ ++ VS  E 
Sbjct:   12 QINEIKKRILLAEGQKTANAAEWQKQNRINCDT-ISSLKKDIKEQTIRASRLRNPLQRPVVIKESTGESRRAQSCTPTLIVGKATYPVGAKNADDAIFLTDLKITESRKQMDLLRHRFKSRQQYFSKLVEKYRGLLANKEAQNQNMGEKPPETLEEDANRKLVCQLENEIHRTNVQWMEAEHIRKKYRSIEASLMTDAERFERSLRELEASLSDQKAEIERLQQVHNEAVEMRDAAKVILQRQEQQANVSQKTRERQALDFRKQVEARKLELERIGRKLFAETKTLVHQDSVGSSSGDQHTAKTENGEEEPVSQLESVTSDMESLFKQLMEASGATSPFEVFERFSAQKESAARLNYLRKAAEAEKANLEAEREALSSELEASKFSDVKESEVNQEVIEQIKNSIAAKEQDRKLDTDEAGKSMGVLKYLKERICEMIFKVQEVDESNIEIPERKLHVSVAEL 472          
BLAST of CCDC151 vs. Ensembl Zebrafish
Match: ccdc151 (coiled-coil domain containing 151 [Source:ZFIN;Acc:ZDB-GENE-061013-787])

HSP 1 Score: 307.375 bits (786), Expect = 6.511e-96
Identity = 201/538 (37.36%), Postives = 322/538 (59.85%), Query Frame = 1
Query:   85 GALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKR--IAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            G L+  + ++I E++ K+ LLEGDR AYFESS+ A+   ++ + +LR++N  L  +L++   +D+ VI   FQ    E+A   N     A   ++ +V D  KKLNA+KH T  +++RL++L+ QY  +           +    E ++LR LENRL+K  LKC+EAEHI   Y ++K  L++E L +   LD ME EI R  +   +L++M+ DA+L+K AA  EL  QE  V+ ER+ R+  L   K+   E+    E++++R   A       + + + SAI + EE +   T FEEAF+ IKEATGV+D  E+V RF +QGET  HL  +K E ++M+ +L+EE++ +Q    +MKY+ ET++S+ +++L+E + ++ +E+ RR   KD L+R   +L   ++G++ L DKL+HI   K   P+ Q+   SDE +L+++S  EE+L+ L E L   D+   + +M+EEEF   I  KIP +N R++L +  K + +           +EEDSGDD+ DI+TR  +K QSQ ++D
Sbjct:    8 GGLKVPIHDKISELQRKIQLLEGDRSAYFESSQSAIKKNRESILQLRQENKNLHKKLAE---SDEQVIKDVFQGHGVEKAPFRNMPVKAARTVLEKQVRDKMKKLNAMKHATQKQRQRLEDLKLQYQSMKPHNKSPLPDTQKQEDEEKKLRILENRLEKTQLKCHEAEHIMRGYLKLKEHLQEESLTFQPQLDRMETEIHRQTQVFKDLQVMNSDAHLSKDAAKAELQLQEEQVYRERKEREKILSRYKKQTVERMNQAERMKRRPQWATMHPDELSSEAQRSAIIVGEEAETTST-FEEAFQRIKEATGVTDSQEIVDRFVSQGETHGHLEKMKAENERMLQELKEERNTLQTQLQDMKYSRETELSSAEQMLQECELRLQQEQQRRDAAKDHLDRLTHILNTVRAGVQQLSDKLQHIPSMK--GPEPQLSPDSDEHILELMSEAEEKLMLLKEELQGNDLATIMKEMEEEEFHATIARKIPQYNTRIQLHEAHKQDPF----------DDEEDSGDDEGDIITRFSLKHQSQAIID 529          
BLAST of CCDC151 vs. Ensembl Zebrafish
Match: ccdc151 (coiled-coil domain containing 151 [Source:ZFIN;Acc:ZDB-GENE-061013-787])

HSP 1 Score: 305.834 bits (782), Expect = 2.155e-95
Identity = 201/538 (37.36%), Postives = 321/538 (59.67%), Query Frame = 1
Query:   85 GALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKR--IAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            G L   + ++I E++ K+ LLEGDR AYFESS+ A+   ++ + +LR++N  L  +L++   +D+ VI   FQ    E+A   N     A   ++ +V D  KKLNA+KH T  +++RL++L+ QY  +           +    E ++LR LENRL+K  LKC+EAEHI   Y ++K  L++E L +   LD ME EI R  +   +L++M+ DA+L+K AA  EL  QE  V+ ER+ R+  L   K+   E+    E++++R   A       + + + SAI + EE +   T FEEAF+ IKEATGV+D  E+V RF +QGET  HL  +K E ++M+ +L+EE++ +Q    +MKY+ ET++S+ +++L+E + ++ +E+ RR   KD L+R   +L   ++G++ L DKL+HI   K   P+ Q+   SDE +L+++S  EE+L+ L E L   D+   + +M+EEEF   I  KIP +N R++L +  K + +           +EEDSGDD+ DI+TR  +K QSQ ++D
Sbjct:    8 GGLMVPIHDKISELQRKIQLLEGDRSAYFESSQSAIKKNRESILQLRQENKNLHKKLAE---SDEQVIKDVFQGYGVEKAPFRNMPVKAARTVLEKQVRDKMKKLNAMKHTTQKQRQRLEDLKLQYQSMKPHNKSPLPDTQKQEDEEKKLRILENRLEKTQLKCHEAEHIMRGYLKLKEHLQEESLTFQPQLDRMETEIHRQTQVFKDLQVMNSDAHLSKDAAKAELQLQEEQVYRERKEREKILSRYKKQTVERMNQAERMKRRPQWATMHPDELSSEAQRSAIIVGEEAETTST-FEEAFQRIKEATGVTDSQEIVDRFVSQGETHGHLERMKAENERMLQELKEERNTLQTQLQDMKYSRETELSSAEQMLQECELRLQQEQQRRDAAKDHLDRLTHILNTVRAGVQQLSDKLQHIPPMK--GPEPQLSPDSDEHILELMSEAEEKLMLLKEELQGNDLATIMKEMEEEEFHATIARKIPQYNTRIQLHEAHKQDPF----------DDEEDSGDDEGDIITRFSLKHQSQAIID 529          
BLAST of CCDC151 vs. Ensembl Xenopus
Match: CCDC151 (uncharacterized loc100135382 [Source:Xenbase;Acc:XB-GENE-5961370])

HSP 1 Score: 318.931 bits (816), Expect = 3.749e-100
Identity = 214/539 (39.70%), Postives = 335/539 (62.15%), Query Frame = 1
Query:   88 ALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANK-EGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKR---IAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            A++  + E+I E+  KL LL+GD KAY E S+  ++  + R+  LR++N KL  +L+D L+ D+ VI +AFQ   +E+A + NK+   AI+ MD K+ D  K+LNAL H    K+K L+ELQ +Y +   +        EG ++ E Q +R LENRL+KA LK  EAEHI + Y +++  +++E L +   LD +EAEI + R E+ EL+ M++DA  A+  A  +L +QE  V  ERR R+  LQN K+ A+E+++  E+VE+R   +A     +  + ++T +    E+++K I  F+EAF+ IKEATGV+D  E+V RF  QGET  HL +LKIE ++ + +L+E+K++++  +   KY+GE K+S GQ+ LEE +  + +EE R    K++LE+ +K+L + K+G+EHL  K+KHIKV K   P       SDE VLD++   EE+L +LLE L   D+   + +M EEEFQ  IE K+P HN+R+ LP   K +++E EE+      +          ++TR  +K+QSQQ+++
Sbjct:    9 AVKPPIHEQISELHKKLQLLDGDHKAYVERSQSDIEKNEDRIQSLRQENKKLHKKLADMLAGDEKVIKEAFQRHASEKAAMKNKSGQAAIELMDQKLCDKMKRLNALHHQAERKRKHLEELQTEYKQRELEMQGKMVAEEGPSQDEQQAMRLLENRLEKAQLKNQEAEHIFSVYQKLREHMQEESLTFQTQLDLIEAEIIKQRSELKELQKMNRDAVQARDEARTDLQQQEEEVTRERRERERTLQNYKKQAEERRIHAERVERRAQRVALPGDDATVDTQQTPS---GEDEEKVIRTFQEAFQRIKEATGVTDTQEIVRRFIAQGETSKHLEELKIENERTLVRLKEQKEKLEEEFRNQKYSGEAKLSRGQQDLEELQSHLQKEEKRCEKTKEELEQMSKILNETKAGVEHLASKVKHIKVPKVYFPALDGSPLSDEQVLDLMGITEEKLQKLLEELEGQDLGQIIKQMDEEEFQASIEGKLPAHNIRISLPAPSKQDMFEDEEDSGEDEGD----------VVTRATLKRQSQQIIE 534          
BLAST of CCDC151 vs. Ensembl Xenopus
Match: CCDC151 (uncharacterized loc100135382 [Source:Xenbase;Acc:XB-GENE-5961370])

HSP 1 Score: 314.309 bits (804), Expect = 2.458e-98
Identity = 216/551 (39.20%), Postives = 337/551 (61.16%), Query Frame = 1
Query:   88 ALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNE---------LARDTAEAQATLEGANKE----GQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKR---IAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            A++  + E+I E+  KL LL+GD KAY E S+  ++  + R+  LR++N KL  +L+D L+ D+ VI +AFQ   +E+A + NK+   AI+ MD K+ D  K+LNAL H    K+K L+ELQ +Y +         +A +        E A+KE     Q +R LENRL+KA LK  EAEHI + Y +++  +++E L +   LD +EAEI + R E+ EL+ M++DA  A+  A  +L +QE  V  ERR R+  LQN K+ A+E+++  E+VE+R   +A     +  + ++T +    E+++K I  F+EAF+ IKEATGV+D  E+V RF  QGET  HL +LKIE ++ + +L+E+K++++  +   KY+GE K+S GQ+ LEE +  + +EE R    K++LE+ +K+L + K+G+EHL  K+KHIKV K   P       SDE VLD++   EE+L +LLE L   D+   + +M EEEFQ  IE K+P HN+R+ LP   K +++E EE+      +          ++TR  +K+QSQQ+++
Sbjct:    9 AVKPPIHEQISELHKKLQLLDGDHKAYVERSQSDIEKNEDRIQSLRQENKKLHKKLADMLAGDEKVIKEAFQRHASEKAAMKNKSGQAAIELMDQKLCDKMKRLNALHHQAERKRKHLEELQTEYKQRELEMQGKMVAEEGPSQDEQDEAADKEEVPEQQAMRLLENRLEKAQLKNQEAEHIFSVYQKLREHMQEESLTFQTQLDLIEAEIIKQRSELKELQKMNRDAVQARDEARTDLQQQEEEVTRERRERERTLQNYKKQAEERRIHAERVERRAQRVALPGDDATVDTQQTPS---GEDEEKVIRTFQEAFQRIKEATGVTDTQEIVRRFIAQGETSKHLEELKIENERTLVRLKEQKEKLEEEFRNQKYSGEAKLSRGQQDLEELQSHLQKEEKRCEKTKEELEQMSKILNETKAGVEHLASKVKHIKVPKVYFPALDGSPLSDEQVLDLMGITEEKLQKLLEELEGQDLGQIIKQMDEEEFQASIEGKLPAHNIRISLPAPSKQDMFEDEEDSGEDEGD----------VVTRATLKRQSQQIIE 546          
BLAST of CCDC151 vs. Ensembl Mouse
Match: Ccdc151 (coiled-coil domain containing 151 [Source:MGI Symbol;Acc:MGI:1924859])

HSP 1 Score: 245.358 bits (625), Expect = 5.880e-72
Identity = 166/501 (33.13%), Postives = 288/501 (57.49%), Query Frame = 1
Query:   76 PKPG----ALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQ-ATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEE---QQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLP 1554
            PK      A++  V  ++ E++ K+ LLEGDRKA++ESS+  +   +  + +L+ +   L +QL D L  D  VI    Q   +E+  L N+T   A++ +++++ +   +LNAL+H    +QKRL++L+ Q++    + AE Q + +E A    + +R+LENRL+KA +K  EAEHI N Y Q+K+ L++E LN  + LD+MEAE+   + EV ELK+++Q+A  A+  A  +L   E     +R++R+  + + K+ A+EK+L  E++E++         +ED         EE   Q+  +   E  F  +K+ATGV++   VV RF  Q ET   L +LK + +  + KL+EEK R+Q     +KY+G+  + + ++L EE ++   +EE R   V + LE ++++L   K  +EHL +KL H+K+  +     ++D  S+++  ++L   +E+LL+L + L   D+   L  + + EF   +E K+PL+N R+ LP
Sbjct:   49 PKSATSFHAMKSSVHAQVLELQRKIQLLEGDRKAFYESSQWNMKKNQDTINQLQEETKALHVQLKDLLQGDSKVIQAIIQEWKSEKPFLKNRTCEQALEHLEHQLREKMNQLNALRHQVILRQKRLEDLRLQHSLRQLEMAEVQDSNMEAA----KTMRNLENRLEKARMKAEEAEHITNVYLQLKSYLQEESLNLESRLDSMEAEVMNTKHEVQELKVVNQEAINARDIAKNQLQYLEESAIRDRKKREHYITDCKKRAEEKKLQTERMERKTHRDHVLLQSEDTIQDHQRHREEELRQRWSMYQMEVMFGKVKDATGVAESHAVVRRFLAQDETFTQLENLKKDNELALAKLKEEKQRLQRELENLKYSGDATLVSQRRLHEEMQKTFKKEEQRHNDVHERLEHTSRILQLVKDCLEHLANKLSHVKLDDTVLAGKKLDRDSEDYAYNLLVVVQEKLLKLQDQLESQDVPELLRHIADREFLATLEGKLPLYNTRILLP 545          
BLAST of CCDC151 vs. Ensembl Mouse
Match: Ccdc151 (coiled-coil domain containing 151 [Source:MGI Symbol;Acc:MGI:1924859])

HSP 1 Score: 244.588 bits (623), Expect = 1.082e-71
Identity = 167/502 (33.27%), Postives = 290/502 (57.77%), Query Frame = 1
Query:   76 PKPG----ALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQ-ATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTS-NAEDERTSAIGITEE---QQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLP 1554
            PK      A++  V  ++ E++ K+ LLEGDRKA++ESS+  +   +  + +L+ +   L +QL D L  D  VI    Q   +E+  L N+T   A++ +++++ +   +LNAL+H    +QKRL++L+ Q++    + AE Q + +E A    + +R+LENRL+KA +K  EAEHI N Y Q+K+ L++E LN  + LD+MEAE+   + EV ELK+++Q+A  A+  A  +L   E     +R++R+  + + K+ A+EK+L  E++E++   R+     +ED         EE   Q+  +   E  F  +K+ATGV++   VV RF  Q ET   L +LK + +  + KL+EEK R+Q     +KY+G+  + + ++L EE ++   +EE R   V + LE ++++L   K  +EHL +KL H+K+  +     ++D  S+++  ++L   +E+LL+L + L   D+   L  + + EF   +E K+PL+N R+ LP
Sbjct:   49 PKSATSFHAMKSSVHAQVLELQRKIQLLEGDRKAFYESSQWNMKKNQDTINQLQEETKALHVQLKDLLQGDSKVIQAIIQEWKSEKPFLKNRTCEQALEHLEHQLREKMNQLNALRHQVILRQKRLEDLRLQHSLRQLEMAEVQDSNMEAA----KTMRNLENRLEKARMKAEEAEHITNVYLQLKSYLQEESLNLESRLDSMEAEVMNTKHEVQELKVVNQEAINARDIAKNQLQYLEESAIRDRKKREHYITDCKKRAEEKKLQTERMERKQTHRDHVLLQSEDTIQDHQRHREEELRQRWSMYQMEVMFGKVKDATGVAESHAVVRRFLAQDETFTQLENLKKDNELALAKLKEEKQRLQRELENLKYSGDATLVSQRRLHEEMQKTFKKEEQRHNDVHERLEHTSRILQLVKDCLEHLANKLSHVKLDDTVLAGKKLDRDSEDYAYNLLVVVQEKLLKLQDQLESQDVPELLRHIADREFLATLEGKLPLYNTRILLP 546          
BLAST of CCDC151 vs. Ensembl Mouse
Match: Ccdc183 (coiled-coil domain containing 183 [Source:MGI Symbol;Acc:MGI:1924308])

HSP 1 Score: 65.0846 bits (157), Expect = 1.583e-10
Identity = 117/488 (23.98%), Postives = 223/488 (45.70%), Query Frame = 1
Query:  274 DDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAAR---ESTSN--------AEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIE-AQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAP--QAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQL-SKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            D   I++A     + R      T  VA + +   V D     N L H+   + ++L+ LQ    ELA    +  AT +   ++ Q +R LEN ++K ++K   +++I   Y  +   L+     Y   LD ++  +     E++++ +M QDA +        + + E+    ERR R+  L   K++  +K   +E  EK    R   +  SN         +  +TS   I  + Q K+T   E    +K A   S L ++  RF  Q  T+ +L +L++E  ++  T+L     +++L  A +K+           + ++ K  ++EEE R    ++++ +  ++L+  ++GI++L+ +L  I     T P  Q +I VS+   V   L  CE +L+ L E +  +    ++ +K+++    + ++ K   HN R+          +E  EE  + +    D   D + + +R  IKKQ+QQL++
Sbjct:   66 DQWTISKACGKDTSMRLAHGRSTLEVAREKLRKYVFDRVNTHNILIHLVRRRGQKLESLQL---ELASLRNQPDATKDEL-RQLQIIRQLENNIEKTVIKITTSQNIHTLYKVLLDYLKKVLAEYPTELDKLQNLVANYCSELSDMTVMSQDAMMITDEVKRNMRQGEATFIEERRARENRLNQQKKLI-DKIHTKETSEKYRRGRRDLDFPSNLMTMENVKVKKRKTSVADI--QYQTKVTTLVER---VKSAVQCSHLWDIAGRFLAQKNTEENL-ELQMEDCEERRTQLEALMKKLELEEAVLKFHQTPSAVGFNSIQKKMKNMLEEEEARLKQAQNNMNKGQQLLLVIQTGIDNLYIRLIGI-----TLPTFQKEIAVSNTLDVYGKLDYCEGKLIYLAERMQTLSRNEEVDTKVRDTLESSTLKEK---HNTRI---------TFEDPEEDMIETFQFADV--DHSYVPSRAEIKKQAQQLIE 523          
BLAST of CCDC151 vs. UniProt
Match: sp|A7MBH5|CC151_BOVIN (Coiled-coil domain-containing protein 151 OS=Bos taurus OX=9913 GN=CCDC151 PE=2 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 1.761e-71
Identity = 187/556 (33.63%), Postives = 316/556 (56.83%), Query Frame = 1
Query:  112 EIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKE-GQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKK---ITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKST----------------APQAQ--------IDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQV-QKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            ++ E++ K+ LLEGDRKA++ES++  +   ++ + +LR +   L+LQL+  L  D+ V+    +   +E+  L N+T   A++ +DY++++  K+LNAL+H    +QK L+ELQ Q++    + AEAQ     +N E  + +R+LENRL+KA +K  EAEHI + Y Q+KA L++E L+ GN LD MEAE+ R + E+ EL +++Q+A  A+  A  +L   E  VF ER++R+  L   K+ A+EK+L  E++E++         ++D    ++   EE+ K+   +   E  F  +K+ATGV++   VV RF  QG+T   L  LK E ++ + +L++EK R+Q    ++KY+GE  + + QK   E + ++  EE RR   ++ L+R+ + L   K G+EHL  KL HI V+  T                 PQ Q        +D   D+++ ++L   EE+LL+L   L   ++   L  + + EF   +E K+P +N R+ LP    KD  +           +EE+S +DD+D++TR  +K +SQ+L++
Sbjct:   69 QVAELQRKIQLLEGDRKAFYESTQWNIKKNQETINQLREETRVLQLQLTALLQGDEKVVQAVIREWKSEKPYLKNRTGQQALEHLDYRLNEKVKQLNALRHQLGLRQKWLEELQLQHSLRELEIAEAQ----DSNTEVAKTMRNLENRLEKARMKAEEAEHITSVYLQLKAYLQEESLHLGNRLDFMEAEVVRTKHELEELHLVNQEALNARDIAKNQLQYLEETVFRERKKRERYLTECKKRAEEKKLQNERMERKTQREHVLLQSDDTLQDSMYSKEEELKRRWSMYQMEVLFGKVKDATGVAETHAVVRRFLAQGDTFTQLEMLKSENEQTLLRLKQEKQRLQQELEDLKYSGEALLVSEQKRQAELQGRLKMEEQRRADAQNQLDRTMRALQITKEGLEHLAGKLNHIVVAGPTYEEGSPGASLDTKGSATPQPQETGRSVGKMDPKVDDYLPNLLGLVEEKLLKLHSQLENHNVPEMLRHIVDLEFYATLEGKLPSYNTRIALPVAGHKDKFF-----------DEEESEEDDSDVVTRAALKMRSQKLIE 609          
BLAST of CCDC151 vs. UniProt
Match: sp|Q8BSN3|CC151_MOUSE (Coiled-coil domain-containing protein 151 OS=Mus musculus OX=10090 GN=Ccdc151 PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 5.782e-71
Identity = 166/501 (33.13%), Postives = 288/501 (57.49%), Query Frame = 1
Query:   76 PKPG----ALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQ-ATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEE---QQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLP 1554
            PK      A++  V  ++ E++ K+ LLEGDRKA++ESS+  +   +  + +L+ +   L +QL D L  D  VI    Q   +E+  L N+T   A++ +++++ +   +LNAL+H    +QKRL++L+ Q++    + AE Q + +E A    + +R+LENRL+KA +K  EAEHI N Y Q+K+ L++E LN  + LD+MEAE+   + EV ELK+++Q+A  A+  A  +L   E     +R++R+  + + K+ A+EK+L  E++E++         +ED         EE   Q+  +   E  F  +K+ATGV++   VV RF  Q ET   L +LK + +  + KL+EEK R+Q     +KY+G+  + + ++L EE ++   +EE R   V + LE ++++L   K  +EHL +KL H+K+  +     ++D  S+++  ++L   +E+LL+L + L   D+   L  + + EF   +E K+PL+N R+ LP
Sbjct:   49 PKSATSFHAMKSSVHAQVLELQRKIQLLEGDRKAFYESSQWNMKKNQDTINQLQEETKALHVQLKDLLQGDSKVIQAIIQEWKSEKPFLKNRTCEQALEHLEHQLREKMNQLNALRHQVILRQKRLEDLRLQHSLRQLEMAEVQDSNMEAA----KTMRNLENRLEKARMKAEEAEHITNVYLQLKSYLQEESLNLESRLDSMEAEVMNTKHEVQELKVVNQEAINARDIAKNQLQYLEESAIRDRKKREHYITDCKKRAEEKKLQTERMERKTHRDHVLLQSEDTIQDHQRHREEELRQRWSMYQMEVMFGKVKDATGVAESHAVVRRFLAQDETFTQLENLKKDNELALAKLKEEKQRLQRELENLKYSGDATLVSQRRLHEEMQKTFKKEEQRHNDVHERLEHTSRILQLVKDCLEHLANKLSHVKLDDTVLAGKKLDRDSEDYAYNLLVVVQEKLLKLQDQLESQDVPELLRHIADREFLATLEGKLPLYNTRILLP 545          
BLAST of CCDC151 vs. UniProt
Match: sp|A5D8V7|CC151_HUMAN (Coiled-coil domain-containing protein 151 OS=Homo sapiens OX=9606 GN=CCDC151 PE=1 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 1.212e-69
Identity = 177/540 (32.78%), Postives = 304/540 (56.30%), Query Frame = 1
Query:   85 GALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEE---QQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLP-QVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            GA +  V  ++ E+  K+ LLEGDRKA+FESS+  +   ++ +++LR++   L L+L D L  D+ V+    +    E+  L N+T   A++ +D+++ +  K+ NAL+H    +Q+RL+ELQ Q++    + AEAQ       +  + +R+LENRL+KA +K  EAEHI + Y Q+KA L DE LN  N LD+MEAE+ R + E+  L +++Q+A  A+  A  +L   E  +  ER++R+  +   K+ A+EK+L  E++E++         ++D    ++   EE   Q+  +   E  F  +K+ATG  +   +V RF  QG+T   L  LK E ++ + +L++EK ++Q    ++KY+GE  + + QKL  E ++++ +EE R    KD LER+ + +   K  +EHL  KL HI V        ++D  +D +V ++L   EE+LL+L   L   D++  L  +   EF   +E ++P +N R+ LP    KD  ++ E E            ++D +++TR  +K +SQ+L++
Sbjct:   61 GAGKPSVHSQVAELHKKIQLLEGDRKAFFESSQWNIKKNQETISQLRKETKALELKLLDLLKGDEKVVQAVIREWKWEKPYLKNRTGQ-ALEHLDHRLREKVKQQNALRHQVVLRQRRLEELQLQHSLRLLEMAEAQNR---HTEVAKTMRNLENRLEKAQMKAQEAEHITSVYLQLKAYLMDESLNLENRLDSMEAEVVRTKHELEALHVVNQEALNARDIAKNQLQYLEETLVRERKKRERYISECKKRAEEKKLENERMERKTHREHLLLQSDDTIQDSLHAKEEELRQRWSMYQMEVIFGKVKDATGTDETHSLVRRFLAQGDTFAQLETLKSENEQTLVRLKQEKQQLQRELEDLKYSGEATLVSQQKLQAEAQERLKKEERRHAEAKDQLERALRAMQVAKDSLEHLASKLIHITVEDGRFAGKELDPQADNYVPNLLGLVEEKLLKLQAQLQGHDVQEMLCHIANREFLASLEGRLPEYNTRIALPLATSKDKFFDEESE------------EEDNEVVTRASLKIRSQKLIE 584          
BLAST of CCDC151 vs. UniProt
Match: sp|A2AJB1|CC183_MOUSE (Coiled-coil domain-containing protein 183 OS=Mus musculus OX=10090 GN=Ccdc183 PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.107e-9
Identity = 117/488 (23.98%), Postives = 223/488 (45.70%), Query Frame = 1
Query:  274 DDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAAR---ESTSN--------AEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIE-AQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAP--QAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQL-SKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            D   I++A     + R      T  VA + +   V D     N L H+   + ++L+ LQ    ELA    +  AT +   ++ Q +R LEN ++K ++K   +++I   Y  +   L+     Y   LD ++  +     E++++ +M QDA +        + + E+    ERR R+  L   K++  +K   +E  EK    R   +  SN         +  +TS   I  + Q K+T   E    +K A   S L ++  RF  Q  T+ +L +L++E  ++  T+L     +++L  A +K+           + ++ K  ++EEE R    ++++ +  ++L+  ++GI++L+ +L  I     T P  Q +I VS+   V   L  CE +L+ L E +  +    ++ +K+++    + ++ K   HN R+          +E  EE  + +    D   D + + +R  IKKQ+QQL++
Sbjct:   66 DQWTISKACGKDTSMRLAHGRSTLEVAREKLRKYVFDRVNTHNILIHLVRRRGQKLESLQL---ELASLRNQPDATKDEL-RQLQIIRQLENNIEKTVIKITTSQNIHTLYKVLLDYLKKVLAEYPTELDKLQNLVANYCSELSDMTVMSQDAMMITDEVKRNMRQGEATFIEERRARENRLNQQKKLI-DKIHTKETSEKYRRGRRDLDFPSNLMTMENVKVKKRKTSVADI--QYQTKVTTLVER---VKSAVQCSHLWDIAGRFLAQKNTEENL-ELQMEDCEERRTQLEALMKKLELEEAVLKFHQTPSAVGFNSIQKKMKNMLEEEEARLKQAQNNMNKGQQLLLVIQTGIDNLYIRLIGI-----TLPTFQKEIAVSNTLDVYGKLDYCEGKLIYLAERMQTLSRNEEVDTKVRDTLESSTLKEK---HNTRI---------TFEDPEEDMIETFQFADV--DHSYVPSRAEIKKQAQQLIE 523          
BLAST of CCDC151 vs. TrEMBL
Match: gnl|BL_ORD_ID|20309842 (tr|A0A076Q0C2|A0A076Q0C2_SCHMD CCDC151 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1063.91 bits (2750), Expect = 0.000e+0
Identity = 529/541 (97.78%), Postives = 530/541 (97.97%), Query Frame = 1
Query:   73 MPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVDM 1695
            MPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEV ELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYE          +EEDSGDDDADILTRNVIKKQSQQLVDM
Sbjct:    1 MPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVIELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYE----------DEEDSGDDDADILTRNVIKKQSQQLVDM 531          
BLAST of CCDC151 vs. TrEMBL
Match: gnl|BL_ORD_ID|15795493 (tr|A0A267ES77|A0A267ES77_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032824g1 PE=4 SV=1)

HSP 1 Score: 530.406 bits (1365), Expect = 2.901e-179
Identity = 275/533 (51.59%), Postives = 392/533 (73.55%), Query Frame = 1
Query:   94 QRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            +R + E+++E++ K+ LLEGDRKAY+E+S       K+++ +LR++N  LR QL DRLSADDHVINQAFQ++P ERA L+NKT   AIQTMDYKVSD  KKLNALKH+TA KQ++LDELQ +  E+ +D  EA+AT EG + EG+RLRDLEN++DK  +K  EAEHIK TY QIK++L+++HL++GN LDAMEAEI+  REE++EL+   ++AN +K  A  +L + E  V+ ER+RR+ E+  +K  A EK+L  EK+E+R A R+ST +   ERTS+  + + QQ+KITD +EAFK IKEATGVSDL+EVV+RFENQG T+ HL +LK +++K   +LR E+D ++  + ++KY+GE K+S+GQK+LE Y+ ++  EE  R  V+ +LE ++KVL+QCK+G++HLH+KL HIKV++S A QAQID SSD +VLD+L +CEERLL+L+  L + D+EA+L  M+ EEF  Q+E K+P HNVR+ L    ++  Y+ + + +              ++L+R  +KKQSQQL+D
Sbjct:    2 ERPLAEKVEELRNKINLLEGDRKAYYENSYYTQKQNKEKIGQLRKENKDLRKQLKDRLSADDHVINQAFQDRPVERAALSNKTGRDAIQTMDYKVSDTKKKLNALKHMTAVKQRKLDELQQENKEMEQDAEEAKATEEGESYEGRRLRDLENKMDKTNMKLKEAEHIKRTYEQIKSRLQEDHLSFGNTLDAMEAEIREGREEISELERTAEEANRSKEEAAHKLKKMEETVYTERKRREQEIHKLKSEADEKRLQYEKMERRQAQRDSTQDQGPERTSS-SLGDSQQEKITDLQEAFKRIKEATGVSDLNEVVIRFENQGSTREHLEELKKDSEKETQRLRAERDTLKTQFDDVKYSGECKLSSGQKILENYQTQLRREEEDRAAVEQELESASKVLVQCKAGVDHLHEKLSHIKVARSHAAQAQIDPSSDAYVLDVLGKCEERLLKLMAELEKEDVEAELKAMRAEEFNQQVESKLPQHNVRISLAGQSREKSYDDDSDSAEDD----------GEVLSRAAVKKQSQQLID 523          
BLAST of CCDC151 vs. TrEMBL
Match: gnl|BL_ORD_ID|15754212 (tr|A0A1I8IHX6|A0A1I8IHX6_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 529.635 bits (1363), Expect = 4.685e-179
Identity = 275/533 (51.59%), Postives = 392/533 (73.55%), Query Frame = 1
Query:   94 QRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            +R + E+++E++ K+ LLEGDRKAY+E+S       K+++ +LR++N  LR QL DRLSADDHVINQAFQ++P ERA L+NKT   AIQTMDYKVSD  KKLNALKH+TA KQ++LDELQ +  E+ +D  EA+AT EG + EG+RLRDLEN++DK  +K  EAEHIK TY QIK++L+++HL++GN LDAMEAEI+  REE++EL+   ++AN +K  A  +L + E  V+ ER+RR+ E+  +K  A EK+L  EK+E+R A R+ST +   ERTS+  + + QQ+KITD +EAFK IKEATGVSDL+EVV+RFENQG T+ HL +LK +++K   +LR E+D ++  + ++KY+GE K+S+GQK+LE Y+ ++  EE  R  V+ +LE ++KVL+QCK+G++HLH+KL HIKV++S A QAQID SSD +VLD+L +CEERLL+L+  L + D+EA+L  M+ EEF  Q+E K+P HNVR+ L    ++  Y+ + + +              ++L+R  +KKQSQQL+D
Sbjct:    3 ERPLAEKVEELRNKINLLEGDRKAYYENSYYTQKQNKEKIGQLRKENKDLRKQLKDRLSADDHVINQAFQDRPVERAALSNKTGRDAIQTMDYKVSDTKKKLNALKHMTAVKQRKLDELQQENKEMEQDAEEAKATEEGESYEGRRLRDLENKMDKTNMKLKEAEHIKRTYEQIKSRLQEDHLSFGNTLDAMEAEIREGREEISELERTAEEANRSKEEAAHKLKKMEETVYTERKRREQEIHKLKSEADEKRLQYEKMERRQAQRDSTQDQGPERTSS-SLGDSQQEKITDLQEAFKRIKEATGVSDLNEVVIRFENQGSTREHLEELKKDSEKETQRLRAERDTLKTQFDDVKYSGECKLSSGQKILENYQTQLRREEEDRAAVEQELESASKVLVQCKAGVDHLHEKLSHIKVARSHAAQAQIDPSSDAYVLDVLGKCEERLLKLMAELEKEDVEAELKAMRAEEFNQQVESKLPQHNVRISLAGQSREKSYDDDSDSAEDD----------GEVLSRAAVKKQSQQLID 524          
BLAST of CCDC151 vs. TrEMBL
Match: gnl|BL_ORD_ID|20349250 (tr|A0A1S3JQG1|A0A1S3JQG1_LINUN coiled-coil domain-containing protein 151 OS=Lingula unguis OX=7574 GN=LOC106175233 PE=4 SV=1)

HSP 1 Score: 494.197 bits (1271), Expect = 3.778e-165
Identity = 284/536 (52.99%), Postives = 390/536 (72.76%), Query Frame = 1
Query:   94 QRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAE---DERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            QR + E I+E+K+K+ALLEGDRKAY+E+S+  +   +  + +LR++N +LR +LSD LSADDHVIN+AF  +  ERA + NKT   AI  MD KV D  KKLNALKHVTA+KQKRL+ELQ QYN++ +D ++A AT  G ++    LR+LENRLDKA+LKCNEAE I+ TY QIK+KLE+E L++ N LDAMEAEIKRCREE+ EL+ M+ DA+++K AA  EL + E +V+A+R++R++ELQ MK+ A+EK++  E+ EKRIA R S    E    E+ + +G  E+QQ KIT +EEAFK IKEATGVSD  EVV RFENQGET+ HL +LK +++K I +LREEK+++Q  + +MKYTGE K+S+GQ+LLEE++  + EEE R+    + L++++K+L+  K+G+EHL DKL H+K +K   PQAQI  +SDE+VLD+LS  EE+LL+LLE L   DI   L  M+EEEF   IE K+P +N R+KLP   KDNVY+ E+E      +          +LTRN+IK+Q+Q ++D
Sbjct:    3 QRAITEHIEEVKSKIALLEGDRKAYYENSQWTMKQNRDTIEKLRKENWELRKKLSDCLSADDHVINKAFHGRKVERAAMKNKTGSNAITIMDRKVCDYIKKLNALKHVTATKQKRLEELQTQYNQMVKDASDAVATDAGESEAAANLRNLENRLDKAVLKCNEAEQIRRTYEQIKSKLEEESLSFPNQLDAMEAEIKRCREELKELRAMYNDAHISKEAAQAELHKHEEVVYADRKKREIELQKMKKEAEEKKMQHERTEKRIAQRGSLQQDELSPSEKAAILG--EDQQAKITTYEEAFKRIKEATGVSDTKEVVDRFENQGETQRHLEELKKDSEKQIQRLREEKEKLQQEFEDMKYTGEAKLSSGQRLLEEFETHLAEEERRKEEAGERLDKASKILVSVKAGVEHLSDKLTHLKANKGHVPQAQISATSDEYVLDLLSTAEEKLLKLLEDLDGKDISEALKLMEEEEFHASIEGKLPSYNTRIKLPVTHKDNVYDDEDESGDDDGD----------VLTRNLIKRQAQNMID 526          
BLAST of CCDC151 vs. TrEMBL
Match: gnl|BL_ORD_ID|18228035 (tr|A0A1I8IN67|A0A1I8IN67_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 490.345 bits (1261), Expect = 1.247e-163
Identity = 269/539 (49.91%), Postives = 380/539 (70.50%), Query Frame = 1
Query:   94 QRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLA-----KTA-ALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            +R + E+++E++ K+ LLEGDRKAY+E+S       K+++ +LR++N  LR QL DRLSADDHVINQAFQ++P ERA L+NKT   AIQTMDYKVSD  KKLNALKH+TA KQ++LDELQ +  E+ +D  EA+AT EG + EG+RLRDLEN++DK  +K  EAEHIK TY QIK++L+++HL++GN        + R R      K   + A+ +      TA A  +L + E  V+ ER+RR+ E+  +K  A EK+L  EK+E+R A R+ST +   ERTS+  + + QQ+KITD +EAFK IKEATGVSDL+EVV+RFENQG T+ HL +LK +++K   +LR E+D ++  + ++KY+GE K+S+GQK+LE Y+ ++  EE  R  V+ +LE ++KVL+QCK+G++HLH+KL HIKV++S A QAQID SSD +VLD+L +CEERLL+L+  L + D+EA+L  M+ EEF  Q+E K+P HNVR+ L    +      E+     S + ED G    ++L+R  +KKQSQQL+D
Sbjct:    3 ERPLAEKVEELRNKINLLEGDRKAYYENSYYTQKQNKEKIGQLRKENKDLRKQLKDRLSADDHVINQAFQDRPVERAALSNKTGRDAIQTMDYKVSDTKKKLNALKHMTAVKQRKLDELQQENKEMEQDAEEAKATEEGESYEGRRLRDLENKMDKTNMKLKEAEHIKRTYEQIKSRLQEDHLSFGNT------RLTRWRRRF--AKAERRSASWSAQPRRPTAEAAHKLKKMEETVYTERKRREQEIHKLKSEADEKRLQYEKMERRQAQRDSTQDQGPERTSS-SLGDSQQEKITDLQEAFKRIKEATGVSDLNEVVIRFENQGSTREHLEELKKDSEKETQRLRAERDTLKTQFDDVKYSGECKLSSGQKILENYQTQLRREEEDRAAVEQELESASKVLVQCKAGVDHLHEKLSHIKVARSHAAQAQIDPSSDAYVLDVLGKCEERLLKLMAELEKEDVEAELKAMRAEEFNQQVESKLPQHNVRISLAGQSR------EKSYDDDSDSAEDDG----EVLSRAAVKKQSQQLID 522          
BLAST of CCDC151 vs. Ensembl Cavefish
Match: ccdc151 (coiled-coil domain containing 151 [Source:NCBI gene;Acc:103028489])

HSP 1 Score: 275.404 bits (703), Expect = 8.568e-84
Identity = 197/556 (35.43%), Postives = 327/556 (58.81%), Query Frame = 1
Query:   64 IAIMPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQ--------RLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKR---IAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQ--IDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            ++ +    +++  + ++I E++ K+ LLEG+R A+FESS  A+   K+ + +LR +N +L ++L+  L  D+  I + FQ++ +E+A   N +   A +  D K+    KKLNA+KH T + ++RL+EL+ Q   L  +    +A     N+  Q         +R LENRL+KA LKC  AEHI  +Y ++K  L++E L +   L+ +EAEI R R+E+ +L+ M+  A+LAK AA  EL +QE  V+ ERR+R++ L   K+  +E++   E+ E+R   +A      N+E +R SA G+ EE+ + ++ FEEAF+ I+EATGV++  EVV RF  Q +T+ HL ++K+E +  + +L+EE+D +   + EMKY+GET +S  ++ LEE +  +  E+ R+   K+ +E   + L    +G+EHL DKL++I     T PQ+   +   +D  ++ +L   E +L  L   L   D    + +M+EEEF   IE K+P +N R+ L   Q+ ++Y            EE+SG+D+ DI+TR  +K+QSQ L+D
Sbjct:    1 MSALFSSNSIRAPIHDQISELQRKIQLLEGERSAFFESSENAIKKNKETILQLREENRRLNMRLAHALRGDEQEIKEVFQSR-SEKAAFRNMSAKAAAEVQDQKLCFKMKKLNAMKHTTNTLRQRLEELRTQNEHLKEERRNPKAEKNTKNEVNQAELHPQQHNVRMLENRLEKAQLKCQGAEHITKSYLKLKEHLQEESLTFEPRLNELEAEILRRRQELRQLQDMNHQAHLAKEAAKAELQQQEEQVYQERRKRELILNQYKKQVEERRAQAERGERRAQRVALHPDELNSEAQR-SATGVGEEE-RVLSSFEEAFQHIREATGVTNTQEVVDRFTYQKDTQKHLEEMKVENEAKLQQLKEERDTLDAQFQEMKYSGETNLSRARQELEECESHLQAEQQRQNAAKEKVEWLTQTLSTVSAGVEHLTDKLQNI-----TLPQSDECVQSDTDNRIVKLLLEAEHKLQHLQTELQDKDPHVLMKEMEEEEFHASIEGKLPQYNTRITLLDTQRSDLY----------EEEENSGEDEGDIITRTSLKRQSQLLID 538          
BLAST of CCDC151 vs. Ensembl Cavefish
Match: ccdc151 (coiled-coil domain containing 151 [Source:NCBI gene;Acc:103028489])

HSP 1 Score: 267.314 bits (682), Expect = 4.240e-81
Identity = 183/519 (35.26%), Postives = 306/519 (58.96%), Query Frame = 1
Query:   64 IAIMPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQ--------RLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKR---IAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQ--IDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYE 1581
            ++ +    +++  + ++I E++ K+ LLEG+R A+FESS  A+   K+ + +LR +N +L ++L+  L  D+  I + FQ++ +E+A   N +   A +  D K+    KKLNA+KH T + ++RL+EL+ Q   L  +    +A     N+  Q         +R LENRL+KA LKC  AEHI  +Y ++K  L++E L +   L+ +EAEI R R+E+ +L+ M+  A+LAK AA  EL +QE  V+ ERR+R++ L   K+  +E++   E+ E+R   +A      N+E +R SA G+ EE+ + ++ FEEAF+ I+EATGV++  EVV RF  Q +T+ HL ++K+E +  + +L+EE+D +   + EMKY+GET +S  ++ LEE +  +  E+ R+   K+ +E   + L    +G+EHL DKL++I     T PQ+   +   +D  ++ +L   E +L  L   L   D    + +M+EEEF   IE K+P +N R+ L   Q+ ++YE
Sbjct:    1 MSALFSSNSIRAPIHDQISELQRKIQLLEGERSAFFESSENAIKKNKETILQLREENRRLNMRLAHALRGDEQEIKEVFQSR-SEKAAFRNMSAKAAAEVQDQKLCFKMKKLNAMKHTTNTLRQRLEELRTQNEHLKEERRNPKAEKNTKNEVNQAELHPQQHNVRMLENRLEKAQLKCQGAEHITKSYLKLKEHLQEESLTFEPRLNELEAEILRRRQELRQLQDMNHQAHLAKEAAKAELQQQEEQVYQERRKRELILNQYKKQVEERRAQAERGERRAQRVALHPDELNSEAQR-SATGVGEEE-RVLSSFEEAFQHIREATGVTNTQEVVDRFTYQKDTQKHLEEMKVENEAKLQQLKEERDTLDAQFQEMKYSGETNLSRARQELEECESHLQAEQQRQNAAKEKVEWLTQTLSTVSAGVEHLTDKLQNI-----TLPQSDECVQSDTDNRIVKLLLEAEHKLQHLQTELQDKDPHVLMKEMEEEEFHASIEGKLPQYNTRITLLDTQRSDLYE 511          
BLAST of CCDC151 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007274.1 (pep scaffold:Pmarinus_7.0:GL477241:305104:312550:-1 gene:ENSPMAG00000006574.1 transcript:ENSPMAT00000007274.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.037 bits (471), Expect = 1.396e-53
Identity = 118/328 (35.98%), Postives = 192/328 (58.54%), Query Frame = 1
Query:  271 ADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQ----------------RLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLM--------QEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMS 1182
             D+ VIN+AFQN   E+A++ NKT   A++ +D +V +  K+LNAL H T  +++RL ELQ   + L  +T+  +AT  G +++ +                 LR LENRL+KA +KC EAE +   Y +I+  L+ E LN+   LD +EA+I + R+++  L+ M ++A LA+  A  EL +QE  V  ERR R+  L   K+  +E+  M          + ++ +  +E  ++   E   A    EEQ++KI  +EEAF+ IKEATGVSD  EVV RF++QG+T+  L  +K   ++ + +L+E+ ++++  Y ++KY+GE K+S
Sbjct:    1 GDEQVINEAFQNHQAEKAVMKNKTGQAAVEMLDQRVCERIKRLNALHHETEQRERRLQELQAHRDLLQAETSREEATHSGNSEQAKVATMCTPKNEKTEKLTDLRMLENRLEKARMKCAEAERVAGVYMRIRGHLQQERLNFPTVLDGLEAQILQQRQQLEHLQAMEKEAQLARDTAKLELQQQEESVAKERRERERTLAEYKRQVEERTRMLFDRKILCAWRPQRALIPQEEPAS---ETQRAATAAEEQERKIRSYEEAFQRIKEATGVSDTKEVVSRFQSQGKTQEDLEMMKSSNKRELARLKEQHEKLKQEYTQIKYSGEAKLS 325          
BLAST of CCDC151 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005756.1 (pep scaffold:Pmarinus_7.0:GL494106:909:3277:1 gene:ENSPMAG00000005220.1 transcript:ENSPMAT00000005756.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 1.934e-19
Identity = 53/162 (32.72%), Postives = 95/162 (58.64%), Query Frame = 1
Query: 1237 RRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQI------DVSS---DEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKD-NVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            +R   +++LERS +++   ++G+EHL++KL  +    + +  A +      +V S   DE V+ +L+  E RLL L + L   D+   L ++ +EEF  +IE  +P +NVR+KLP  +K  +++E          +EE SG+D  ++LTR  +K+QSQQ+++
Sbjct:   19 KRDVAREELERSTRLMNGVRAGVEHLYEKLLFVFSHHTLSTCAFVQDEELPEVGSYDGDEGVVAMLAVAEHRLLALKKELEGQDLTKILQQIGDEEFYTRIEGNLPTYNVRIKLPSSKKKADIFE----------DEESSGEDATEVLTRATLKRQSQQIIE 170          
BLAST of CCDC151 vs. Ensembl Nematostella
Match: EDO35840 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKE0])

HSP 1 Score: 389.808 bits (1000), Expect = 2.683e-128
Identity = 230/535 (42.99%), Postives = 345/535 (64.49%), Query Frame = 1
Query:  100 QVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAF-QNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERT--SAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQV-QKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            ++ EEIDE+K KLALL+GDRKAY+ESS+ ++   K+ +  LR  N  LRL+L+ + + D+ VI++AF Q  P     +   +   AI  +D +V +  KK+NALKH    ++K+L +LQ +Y+++ +D  EA  T  G + + QRLR +EN LDK  LK +EA+ IK TY QI   L +E   + NNLD  E  I+R  EE+ ELK  + DA LA+ AA  EL++ E  V   +R R+  L   K+ A+EK+   +KVEKR+   + +S  +DE T   A    EEQ++KIT +EEA   IK+ATGVSD+ EVV RF +QG+T+ HL  LK   +KM+ +L+E+K++++L Y EMKY+GE ++S+GQ++LEE++Q+VD+EE R    +     +++ L+  K+GIEHL DKL+H+K  K   PQAQ+  +SDE++LD+L  CE++LL+L++ LG  DI   + +M++ EF++ +E K+P HN RVKLP V ++   Y+ +EE                 +L+RN IK+ SQQLVD
Sbjct:    2 RITEEIDELKRKLALLDGDRKAYYESSQWSMKKNKETIQSLREKNKDLRLELAKKKAGDEKVIDEAFKQRDPQRHCAMKGMSGRAAINKLDQQVCESVKKMNALKHTRKVQEKKLKQLQTEYDQMVKDAEEAVNTDAGDSDDAQRLRVVENNLDKMSLKLSEAKRIKCTYEQIYDCLREECRTWPNNLDNKEEAIRRMEEELQELKASNNDAQLAREAAKAELAKLEQSVSESKREREAALAEYKKQAEEKKEQADKVEKRL---QRSSLQQDELTDPKATLSGEEQERKITTYEEAMNKIKDATGVSDIKEVVQRFLSQGDTQKHLEQLKNNNEKMLVRLKEDKEKLRLEYEEMKYSGEARLSSGQRMLEEFQQRVDDEEKRCAEAELRQNHASRTLVNTKAGIEHLADKLQHLKAPKGQVPQAQLSPTSDEYILDLLGTCEQKLLKLMDDLGGKDISDVMKEMEDFEFRSSMESKLPQHNTRVKLPVVAERTAGYDDDEESGEDED-----------VLSRNAIKRYSQQLVD 522          
BLAST of CCDC151 vs. Ensembl Medaka
Match: ENSORLT00000028321.1 (myosin-10 [Source:NCBI gene;Acc:101163390])

HSP 1 Score: 118.627 bits (296), Expect = 9.946e-28
Identity = 127/467 (27.19%), Postives = 244/467 (52.25%), Query Frame = 1
Query:  310 PTERAMLANKTTPVAIQ------TMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERR---RRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEE-FQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQ 1680
            P     L +K T + +Q      T+  +V   +K+LN+LKH T + Q+RLDEL+ ++  L +  +        A ++   LR LEN L+   LK   A+ I  +  ++    +D+ L +   LDA+E EI + R ++ +L+I  ++A L K     E  +QE       +     +  L+N  +  ++     EK EK++   E +  A+D  +S++   +E++   + +EEAF++IK+ TG++D++++V  F +Q +T + L  L ++ +K   +L E+   ++    E+K+ G   + + ++  EE +++++  + R    K  L+     L   ++G+E L  KL+HI++S+ TA +   D  S EF+L++L+ C  +L  L E L   D++A + +M++++ FQ+ +E  +   NVR++ P  Q              + + +  G D+  I +R  +KK+SQ
Sbjct:   72 PMRSMALTDKETCIRMQGKATHATLQQQVFSKTKRLNSLKHTTKTLQQRLDELKTEHERLKQQRSSE------AEEDAVTLRRLENSLETPRLKLRLAQSIMASTQKLINHFQDQSLTHEGQLDALETEILKERGKLQKLQIRKRNAQLLKDGCQAEQQQQEQEDQLLLKDLKETEQRLENYIKKLEDVNGKAEKTEKKLQPDEMSIEAQDSSSSSLA--DEEKTVASAYEEAFRLIKDCTGITDVEDLVECFVSQRDTLNTLESLMMKEKKEELELAEQLTLLEKELEEVKHQGAALLFSEEEHQEERRRQLEALQQRCDVTKRRLDSLEITLSTARNGVECLAQKLQHIELSEQTANEVPPD--SPEFILELLTTCTRKLQLLYEQLEGKDLDAIMKEMKKDKNFQDFLERNLSESNVRIQRPGRQTPE----------QTKDGDVRGVDEDTIASRETLKKKSQ 518          
BLAST of CCDC151 vs. Planmine SMEST
Match: SMESG000007771.1 (SMESG000007771.1)

HSP 1 Score: 1067.37 bits (2759), Expect = 0.000e+0
Identity = 530/541 (97.97%), Postives = 531/541 (98.15%), Query Frame = 1
Query:   73 MPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVDM 1695
            MPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYE          +EEDSGDDDADILTRNVIKKQSQQLVDM
Sbjct:    1 MPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDNVYE----------DEEDSGDDDADILTRNVIKKQSQQLVDM 531          
BLAST of CCDC151 vs. Planmine SMEST
Match: SMESG000007771.1 (SMESG000007771.1)

HSP 1 Score: 1060.44 bits (2741), Expect = 0.000e+0
Identity = 530/550 (96.36%), Postives = 531/550 (96.55%), Query Frame = 1
Query:   73 MPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEE---------EFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVDM 1695
            MPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEE         EFQNQIEHKIPLHNVRVKLPQVQKDNVYE          +EEDSGDDDADILTRNVIKKQSQQLVDM
Sbjct:    1 MPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEEEKVELMALFEFQNQIEHKIPLHNVRVKLPQVQKDNVYE----------DEEDSGDDDADILTRNVIKKQSQQLVDM 540          
BLAST of CCDC151 vs. Planmine SMEST
Match: SMESG000019349.1 (SMESG000019349.1)

HSP 1 Score: 234.572 bits (597), Expect = 9.776e-69
Identity = 181/555 (32.61%), Postives = 294/555 (52.97%), Query Frame = 1
Query:   73 MPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTELRRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDYKVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKEGQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEK--QLMQEKV----EKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQEE---------EFQNQIEHKIPLHNVRVKLPQVQKDNVYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVD 1692
            M +    Q  + E+++ +K K+ L++GDRKAY++++ Q L     ++ ELR     LR  + DR + D+ + +QA Q +P ER  +   +   A++ MD +V+D  KKLNAL+H T  K  +L E +  Y +L    AE  AT     K GQ++RD+ENRLDKA LK NEA H+  TY +IK  L  E + Y   LDAME EI+  R E++++K +  D+ +A+     EL R E  V  E +RR++EL N+KQ+A  K  Q +Q +V    E     +E  SN  +E ++ +   +E   ++   E+ F+ IKEATG+S+L++++ RF+ Q  T ++L +LK + +  I   R EK+     Y    +  E K S       E +QK+ +  +R   +  DL     +L + + GIEHL  K +  K+ ++      I+++  +F   IL +    +L  +  +    IE +  KM+EE         EF   ++ K+   N R+KL  V +  V             +E   +D ADI+TR  +KKQS+++++
Sbjct:    1 MSQSWRPQAPLFEQVNSMKHKILLMDGDRKAYYDATFQKLMKEHNKLVELRHQVKVLRNDVRDRRNPDEFITDQALQRQPKERQAMLRYSALEAMEIMDNQVNDTMKKLNALRHKTHLKTDKLHEQEESYTKLLMFAAEEAATKARQGKVGQQIRDIENRLDKAFLKQNEAMHVNATYEKIKDMLRQEAITYNLTLDAMEKEIETSRNELSQVKQLQSDSVVARNHDFVELRRHEEFVSTELKRRELELTNLKQMALTKNFQTIQSRVVVPMEMSFGDQEDLSNKSEENSTFV---DENNVRLKKHEDLFQTIKEATGISNLNQMIKRFQTQVNTSNNLENLKKKLEDEILNKRTEKEESVREYLNQTFNIEEKGSRHNLTKSEKEQKMKDLTNRSDEILKDLILKEILLSKIRVGIEHLAHKCEK-KLDRN------IELNEIKFYNKILDKICNEILFYISEMKDYSIEEEAFKMKEEEDEVVVIATEFAILVDSKLSSFNTRIKLTTVPQKEVL------------DESDPEDRADIITRQALKKQSRKILE 533          
BLAST of CCDC151 vs. Planmine SMEST
Match: SMESG000006478.1 (SMESG000006478.1)

HSP 1 Score: 192.586 bits (488), Expect = 1.325e-54
Identity = 118/355 (33.24%), Postives = 207/355 (58.31%), Query Frame = 1
Query:  532 LRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDFEEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREEKDR-MQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERSNKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEERLLQLLEHLGQVDIEAQLSKMQE-------EEFQNQIEHKIPLHNVRVKLPQVQKDN 1572
            +R+LENRLDKA LKC+EA+ I   Y QIK KL++E+L+YGNNLDA+E EI  C +++  ++++H+D+ +A   A++EL  +E  VF +R+RR+ EL  MK+  ++KQ + EK+E+R+   +ST+   D   + + I E  Q++I  +EE ++  +  +GV ++ E V+R++NQ  T+ HL ++  E +K     R+EK R +   Y + K+  ETK S  ++     +Q + ++E     +K  L ++N +L  CK   +H+ + L    +S+  +   +   + ++ ++D+    + ++L L+E + + D E    K+          EF N +   IPLHN RV + +  KDN
Sbjct:    1 MRNLENRLDKATLKCSEAQQINKIYNQIKYKLQEEYLHYGNNLDALENEIIYCNKDLCHIRVLHKDSLIAHDFAMKELKEKEDQVFIDRKRREKELIYMKKAVEDKQSVNEKMERRLENNDSTALNNDPLVNEVQINEGYQQRIAAYEEIYRNFQNISGVLNIQEAVVRYQNQNNTEMHLRNIIDEYEKHCINYRKEKTRFIHKLYCD-KFESETKSSFNEENHLNVEQYLKDKEQINTELKQLLNQANSILALCKLSTDHIDEIL---PLSQWNSMDLRKKCNPNDIMMDLFDAIQLKILSLIEQVKEFDKEEFKKKIHSPSILETYNEFHNNVLKSIPLHNARVSIRKSMKDN 351          
BLAST of CCDC151 vs. Planmine SMEST
Match: SMESG000006478.1 (SMESG000006478.1)

HSP 1 Score: 114.775 bits (286), Expect = 5.714e-30
Identity = 56/117 (47.86%), Postives = 88/117 (75.21%), Query Frame = 1
Query:  532 LRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAMEAEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQNMKQVAQEKQLMQEKVEKRI 882
            +R+LENRLDKA LKC+EA+ I   Y QIK KL++E+L+YGNNLDA+E EI  C +++  ++++H+D+ +A   A++EL  +E  VF +R+RR+ EL  MK+  ++KQ + EK+E+R+
Sbjct:    1 MRNLENRLDKATLKCSEAQQINKIYNQIKYKLQEEYLHYGNNLDALENEIIYCNKDLCHIRVLHKDSLIAHDFAMKELKEKEDQVFIDRKRREKELIYMKKAVEDKQSVNEKMERRL 117          
The following BLAST results are available for this feature:
BLAST of CCDC151 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CCDC1512.524e-7032.78coiled-coil domain containing 151 [Source:HGNC Sym... [more]
CCDC1512.882e-5032.99coiled-coil domain containing 151 [Source:HGNC Sym... [more]
CCDC1511.098e-4628.52coiled-coil domain containing 151 [Source:HGNC Sym... [more]
back to top
BLAST of CCDC151 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCDC151 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC1511.402e-1222.94gene:FBgn0036219 transcript:FBtr0076037[more]
back to top
BLAST of CCDC151 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccdc1516.511e-9637.36coiled-coil domain containing 151 [Source:ZFIN;Acc... [more]
ccdc1512.155e-9537.36coiled-coil domain containing 151 [Source:ZFIN;Acc... [more]
back to top
BLAST of CCDC151 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCDC1513.749e-10039.70uncharacterized loc100135382 [Source:Xenbase;Acc:X... [more]
CCDC1512.458e-9839.20uncharacterized loc100135382 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of CCDC151 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ccdc1515.880e-7233.13coiled-coil domain containing 151 [Source:MGI Symb... [more]
Ccdc1511.082e-7133.27coiled-coil domain containing 151 [Source:MGI Symb... [more]
Ccdc1831.583e-1023.98coiled-coil domain containing 183 [Source:MGI Symb... [more]
back to top
BLAST of CCDC151 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|A7MBH5|CC151_BOVIN1.761e-7133.63Coiled-coil domain-containing protein 151 OS=Bos t... [more]
sp|Q8BSN3|CC151_MOUSE5.782e-7133.13Coiled-coil domain-containing protein 151 OS=Mus m... [more]
sp|A5D8V7|CC151_HUMAN1.212e-6932.78Coiled-coil domain-containing protein 151 OS=Homo ... [more]
sp|A2AJB1|CC183_MOUSE1.107e-923.98Coiled-coil domain-containing protein 183 OS=Mus m... [more]
back to top
BLAST of CCDC151 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203098420.000e+097.78tr|A0A076Q0C2|A0A076Q0C2_SCHMD CCDC151 OS=Schmidte... [more]
gnl|BL_ORD_ID|157954932.901e-17951.59tr|A0A267ES77|A0A267ES77_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157542124.685e-17951.59tr|A0A1I8IHX6|A0A1I8IHX6_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|203492503.778e-16552.99tr|A0A1S3JQG1|A0A1S3JQG1_LINUN coiled-coil domain-... [more]
gnl|BL_ORD_ID|182280351.247e-16349.91tr|A0A1I8IN67|A0A1I8IN67_9PLAT Uncharacterized pro... [more]
back to top
BLAST of CCDC151 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccdc1518.568e-8435.43coiled-coil domain containing 151 [Source:NCBI gen... [more]
ccdc1514.240e-8135.26coiled-coil domain containing 151 [Source:NCBI gen... [more]
back to top
BLAST of CCDC151 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007274.11.396e-5335.98pep scaffold:Pmarinus_7.0:GL477241:305104:312550:-... [more]
ENSPMAT00000005756.11.934e-1932.72pep scaffold:Pmarinus_7.0:GL494106:909:3277:1 gene... [more]
back to top
BLAST of CCDC151 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCDC151 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO358402.683e-12842.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CCDC151 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000028321.19.946e-2827.19myosin-10 [Source:NCBI gene;Acc:101163390][more]
back to top
BLAST of CCDC151 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007771.10.000e+097.97SMESG000007771.1[more]
SMESG000007771.10.000e+096.36SMESG000007771.1[more]
SMESG000019349.19.776e-6932.61SMESG000019349.1[more]
SMESG000006478.11.325e-5433.24SMESG000006478.1[more]
SMESG000006478.15.714e-3047.86SMESG000006478.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019836
GenBankAIJ50388.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019836 ID=SMED30019836|Name=CCDC151|organism=Schmidtea mediterranea sexual|type=transcript|length=2033bp
TTCTAATACTTGATTCCATATCAACAGTTTTAACAGAATTTTAATTTTAA
AGTTTTTTTGAAAATCGCAATTATGCCGAAACCGGGCGCATTGCAGAGAC
AAGTTGTCGAAGAAATAGATGAAATAAAAGCAAAACTTGCATTACTAGAA
GGTGATAGAAAAGCTTATTTTGAAAGTTCGAGACAAGCTTTAGATGACTG
TAAAAAACGAGTTACAGAACTACGTCGGGATAATAATAAACTTCGTCTTC
AATTAAGTGACAGGCTATCAGCAGACGATCACGTTATAAACCAAGCGTTT
CAGAACAAACCAACGGAAAGAGCAATGCTAGCTAATAAAACAACACCCGT
AGCGATCCAAACAATGGATTACAAAGTAAGTGATGGATCCAAAAAACTTA
ACGCCTTGAAGCATGTTACGGCTTCAAAACAAAAACGATTGGATGAACTA
CAATATCAATACAACGAACTAGCTAGAGATACTGCAGAAGCTCAGGCTAC
TTTAGAAGGTGCTAATAAAGAGGGCCAACGATTACGAGATCTCGAAAATA
GATTAGATAAGGCCTTGTTGAAATGCAACGAAGCTGAACATATAAAGAAC
ACTTATGGACAGATTAAAGCAAAATTAGAAGATGAACACTTGAACTATGG
CAATAATCTTGATGCTATGGAGGCTGAAATTAAACGTTGCCGAGAAGAAG
TAAATGAATTAAAAATAATGCATCAAGATGCCAATCTTGCAAAAACAGCT
GCATTGGAAGAATTATCACGTCAAGAAAGTTTAGTGTTTGCTGAAAGACG
AAGACGAGATGTAGAATTACAAAACATGAAACAAGTAGCCCAGGAAAAAC
AGTTAATGCAAGAAAAAGTGGAAAAGAGAATAGCGGCAAGGGAATCGACA
TCAAATGCTGAAGACGAACGTACAAGTGCTATAGGTATTACAGAGGAACA
ACAAAAGAAAATAACTGATTTTGAGGAAGCTTTCAAAATTATCAAGGAAG
CTACTGGAGTCAGTGATCTTGATGAAGTTGTTTTAAGATTTGAAAATCAA
GGCGAAACAAAACACCATTTAGTAGACCTCAAGATAGAAGCTCAGAAAAT
GATTACAAAATTAAGAGAAGAAAAGGATAGAATGCAATTGTGTTATGCAG
AAATGAAATATACTGGTGAAACTAAAATGAGCAACGGTCAGAAATTACTA
GAAGAATATAAACAAAAAGTTGATGAAGAAGAGCATAGACGAATTACAGT
GAAAGATGATTTGGAAAGATCGAATAAAGTCTTGATTCAATGTAAATCTG
GCATAGAGCACTTGCATGACAAATTGAAACACATTAAAGTGTCTAAAAGT
ACAGCTCCACAAGCCCAAATCGACGTCTCTTCCGATGAATTTGTCTTGGA
CATTCTCAGTCGTTGCGAGGAGAGGTTGTTACAATTACTTGAGCATCTTG
GCCAAGTTGACATTGAAGCTCAATTATCAAAAATGCAAGAAGAAGAATTT
CAAAATCAAATTGAACATAAAATTCCGCTTCACAATGTCAGAGTGAAATT
ACCACAAGTACAGAAAGATAATGTTTATGAAGTTGAAGAAGAACTGAGTG
TACATTCATCAAATGAAGAAGACAGTGGCGATGATGATGCCGATATTCTT
ACGCGAAACGTTATCAAAAAACAATCTCAACAACTTGTTGACATGAAAAC
GAAGAAAAGAAATCCCAAAAAGAAAAAGAAAACAAAAACAAAATAAATCA
GGATCATGTCAATCATTTAGACTTTCAAATAAAAAAAAAGATTTCGAAAA
AATTTTCTGGTAGACTTGTTGATTAGAAATGTTCTTAGATCACGTGATCA
TTGCCGATTATATTAAGGGTACAGTAAAATGTTTCTTAGTATTTTAAGTA
GTAGAGTATGATCGTTATGGTCGGAATAATGTACGTTCATTGTAGACAAT
GACAAAATTGGGGTTTTCACACCCAATAATAAAGTGTATTTTTCTCTTTC
ATTTTTCATATAAACAAATATATAATTTTACAG
back to top

protein sequence of SMED30019836-orf-1

>SMED30019836-orf-1 ID=SMED30019836-orf-1|Name=SMED30019836-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=558bp
MPKPGALQRQVVEEIDEIKAKLALLEGDRKAYFESSRQALDDCKKRVTEL
RRDNNKLRLQLSDRLSADDHVINQAFQNKPTERAMLANKTTPVAIQTMDY
KVSDGSKKLNALKHVTASKQKRLDELQYQYNELARDTAEAQATLEGANKE
GQRLRDLENRLDKALLKCNEAEHIKNTYGQIKAKLEDEHLNYGNNLDAME
AEIKRCREEVNELKIMHQDANLAKTAALEELSRQESLVFAERRRRDVELQ
NMKQVAQEKQLMQEKVEKRIAARESTSNAEDERTSAIGITEEQQKKITDF
EEAFKIIKEATGVSDLDEVVLRFENQGETKHHLVDLKIEAQKMITKLREE
KDRMQLCYAEMKYTGETKMSNGQKLLEEYKQKVDEEEHRRITVKDDLERS
NKVLIQCKSGIEHLHDKLKHIKVSKSTAPQAQIDVSSDEFVLDILSRCEE
RLLQLLEHLGQVDIEAQLSKMQEEEFQNQIEHKIPLHNVRVKLPQVQKDN
VYEVEEELSVHSSNEEDSGDDDADILTRNVIKKQSQQLVDMKTKKRNPKK
KKKTKTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR033192CCDC151
Vocabulary: biological process
TermDefinition
GO:0003341cilium movement
GO:0007368determination of left/right symmetry
GO:0030030cell projection organization
GO:0036158outer dynein arm assembly
GO:0070286axonemal dynein complex assembly
GO:1902017regulation of cilium assembly
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005814centriole
GO:0005856cytoskeleton
GO:0005929cilium
GO:0005930axoneme
GO:0036064ciliary basal body
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 182..223
NoneNo IPR availableCOILSCoilCoilcoord: 333..353
NoneNo IPR availableCOILSCoilCoilcoord: 8..28
NoneNo IPR availableCOILSCoilCoilcoord: 249..269
NoneNo IPR availableCOILSCoilCoilcoord: 123..174
NoneNo IPR availableCOILSCoilCoilcoord: 369..396
NoneNo IPR availableCOILSCoilCoilcoord: 33..60
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 505..557
IPR033192Coiled-coil domain-containing protein 151PANTHERPTHR46518FAMILY NOT NAMEDcoord: 10..553