Ferritin

Overview
NameFerritin
Smed IDSMED30019831
Length (bp)1012
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ferritin (SMED30019831) t-SNE clustered cells

Violin plots show distribution of expression levels for Ferritin (SMED30019831) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ferritin (SMED30019831) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ferritin (SMED30019831) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019831

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30019831h1SMcG0008745 SmedASXL_002530SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior sideSMED30019831h1SMcG0008745 dd_Smed_v4_3974_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30019831h1SMcG0008745 dd_Smed_v4_3974_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 234.187 bits (596), Expect = 2.011e-76
Identity = 113/171 (66.08%), Postives = 133/171 (77.78%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETLG 582
            S +RQN+H D EA INRQINLELYA Y YLSM+YYFDRDDVALK FA +F   S+EEREHA+KLM  QN+RGG I LQD++KP   DW  GL +ME AL LEK V  SLLELHK+A++  DPHL DF+E HYL EQV+AIKELGD VTNL+++G    GL E++FDK TLG
Sbjct:    7 SQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG 177          
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 234.187 bits (596), Expect = 2.011e-76
Identity = 113/171 (66.08%), Postives = 133/171 (77.78%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETLG 582
            S +RQN+H D EA INRQINLELYA Y YLSM+YYFDRDDVALK FA +F   S+EEREHA+KLM  QN+RGG I LQD++KP   DW  GL +ME AL LEK V  SLLELHK+A++  DPHL DF+E HYL EQV+AIKELGD VTNL+++G    GL E++FDK TLG
Sbjct:    7 SQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG 177          
BLAST of Ferritin vs. Ensembl Human
Match: FTMT (ferritin mitochondrial [Source:HGNC Symbol;Acc:HGNC:17345])

HSP 1 Score: 217.624 bits (553), Expect = 3.166e-69
Identity = 109/174 (62.64%), Postives = 127/174 (72.99%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETLGKFN 591
            S +RQNFH D EA INRQINLELYA Y YLSMAYYF RDDVAL  F+ +F   S EE EHA+KLM  QN+RGG I LQD++KP + DW  GL +ME AL LEK V  SLLELH +AS+  DPHL DFLE +YL EQV++IKELGD V NL ++G    GL E++FD  TLG  N
Sbjct:   66 SRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGRIRLQDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNEN 239          
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 186.037 bits (471), Expect = 5.154e-58
Identity = 90/141 (63.83%), Postives = 108/141 (76.60%), Query Frame = 1
Query:  169 SMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETLG 582
            S +YYFDRDDVALK FA +F   S+EEREHA+KLM  QN+RGG I LQD++KP   DW  GL +ME AL LEK V  SLLELHK+A++  DPHL DF+E HYL EQV+AIKELGD VTNL+++G    GL E++FDK TLG
Sbjct:    7 SQSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG 147          
BLAST of Ferritin vs. Ensembl Human
Match: FTL (ferritin light chain [Source:HGNC Symbol;Acc:HGNC:3999])

HSP 1 Score: 184.111 bits (466), Expect = 4.940e-57
Identity = 86/170 (50.59%), Postives = 126/170 (74.12%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETL 579
            S IRQN+  D EA +N  +NL L A YTYLS+ +YFDRDDVAL+G ++FFR+ + E+RE  ++L+  QN+RGG  + QD++KPA+ +WG    +M+AA+ LEK++  +LL+LH + S   DPHL DFLE H+L+E+V+ IK++GD +TNL R+G    GLGE++F++ TL
Sbjct:    3 SQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTL 172          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-2 (Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3])

HSP 1 Score: 221.476 bits (563), Expect = 4.607e-72
Identity = 101/166 (60.84%), Postives = 128/166 (77.11%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKE 573
            MSL RQN+H++ EA +N+QIN+ELYA Y YLSM++YFDRDDVAL   A FF++ S+EEREHA +LM  QN RGG ++LQD++KP   +WG  L++ EAAL LEK    SLL+LH  A NH D HLTDF+EE YL+EQV++I E    V NLKRVGPG+GE++FDKE
Sbjct:    1 MSLARQNYHSEVEAAVNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRGGRVVLQDIQKPENDEWGTALKAFEAALALEKFNNESLLKLHSTAGNHNDAHLTDFIEEKYLDEQVKSINEFARMVANLKRVGPGVGEYVFDKE 166          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-2 (Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3])

HSP 1 Score: 221.476 bits (563), Expect = 4.607e-72
Identity = 101/166 (60.84%), Postives = 128/166 (77.11%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKE 573
            MSL RQN+H++ EA +N+QIN+ELYA Y YLSM++YFDRDDVAL   A FF++ S+EEREHA +LM  QN RGG ++LQD++KP   +WG  L++ EAAL LEK    SLL+LH  A NH D HLTDF+EE YL+EQV++I E    V NLKRVGPG+GE++FDKE
Sbjct:    1 MSLARQNYHSEVEAAVNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRGGRVVLQDIQKPENDEWGTALKAFEAALALEKFNNESLLKLHSTAGNHNDAHLTDFIEEKYLDEQVKSINEFARMVANLKRVGPGVGEYVFDKE 166          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-1 (Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453])

HSP 1 Score: 198.364 bits (503), Expect = 4.398e-63
Identity = 89/166 (53.61%), Postives = 123/166 (74.10%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKE 573
            MSL RQN+H + EA +N+QIN+ELYA Y YLSM+ +FDRDD+AL+  A FF++ S+EER HA +LM  Q  RGG + +Q+++KP K +WG  L++ EAAL LE+    SLL+LH +A    D HLT++++E YLEEQV +I E   ++ N+KR GPGLGE++FDKE
Sbjct:    1 MSLARQNYHDEVEAAVNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRGGRVAMQNIQKPEKDEWGTVLEAFEAALALERANNASLLKLHGIAEQRNDAHLTNYIQEKYLEEQVHSINEFARYIANIKRAGPGLGEYLFDKE 166          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-1 (Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453])

HSP 1 Score: 198.364 bits (503), Expect = 4.398e-63
Identity = 89/166 (53.61%), Postives = 123/166 (74.10%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKE 573
            MSL RQN+H + EA +N+QIN+ELYA Y YLSM+ +FDRDD+AL+  A FF++ S+EER HA +LM  Q  RGG + +Q+++KP K +WG  L++ EAAL LE+    SLL+LH +A    D HLT++++E YLEEQV +I E   ++ N+KR GPGLGE++FDKE
Sbjct:    1 MSLARQNYHDEVEAAVNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRGGRVAMQNIQKPEKDEWGTVLEAFEAALALERANNASLLKLHGIAEQRNDAHLTNYIQEKYLEEQVHSINEFARYIANIKRAGPGLGEYLFDKE 166          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer3HCH (gene:FBgn0030449 transcript:FBtr0073745)

HSP 1 Score: 159.073 bits (401), Expect = 1.706e-47
Identity = 76/163 (46.63%), Postives = 111/163 (68.10%), Query Frame = 1
Query:   82 LIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDK 570
            L+RQNF   CE  +N QIN+EL A + YL+MAY+FDR D++  G   FF K+S EEREHA+K+M Y NKRGG IIL  V +P    +   L +++ A+++E +V   LL+LH +A    DP+L DF+E ++L+EQV+  K L D+++ L++    +GEF+FDK
Sbjct:   15 LVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTYMNKRGGLIILSSVPQPLPC-FASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANFLQEQVDGQKILADYISQLEKAQNQVGEFLFDK 176          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer1HCH (gene:FBgn0015222 transcript:FBtr0344763)

HSP 1 Score: 108.612 bits (270), Expect = 2.397e-28
Identity = 68/165 (41.21%), Postives = 92/165 (55.76%), Query Frame = 1
Query:  109 CEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRG----GTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVAS----NHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRV---GPGLGEFIFDK 570
            C  G+  QI  E+ A Y YL+M  YF RD V   GFA  F K++ EEREH  KL+ Y + RG    G   L +V   AK +W DG  ++  AL+LE +V  S+ +L +       NH+  HL D+L   YLEEQ+   +EL   +T LK++      LGEF+FDK
Sbjct:    5 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHY--HLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 167          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer1HCH (gene:FBgn0015222 transcript:FBtr0085633)

HSP 1 Score: 108.997 bits (271), Expect = 4.758e-28
Identity = 68/165 (41.21%), Postives = 92/165 (55.76%), Query Frame = 1
Query:  109 CEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRG----GTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVAS----NHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPG---LGEFIFDK 570
            C  G+  QI  E+ A Y YL+M  YF RD V   GFA  F K++ EEREH  KL+ Y + RG    G   L +V   AK +W DG  ++  AL+LE +V  S+ +L +       NH+  HL D+L   YLEEQ+   +EL   +T LK++      LGEF+FDK
Sbjct:   41 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHY--HLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 203          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer1HCH (gene:FBgn0015222 transcript:FBtr0085632)

HSP 1 Score: 108.997 bits (271), Expect = 4.758e-28
Identity = 68/165 (41.21%), Postives = 92/165 (55.76%), Query Frame = 1
Query:  109 CEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRG----GTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVAS----NHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPG---LGEFIFDK 570
            C  G+  QI  E+ A Y YL+M  YF RD V   GFA  F K++ EEREH  KL+ Y + RG    G   L +V   AK +W DG  ++  AL+LE +V  S+ +L +       NH+  HL D+L   YLEEQ+   +EL   +T LK++      LGEF+FDK
Sbjct:   41 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHY--HLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 203          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer1HCH (gene:FBgn0015222 transcript:FBtr0085631)

HSP 1 Score: 108.997 bits (271), Expect = 4.758e-28
Identity = 68/165 (41.21%), Postives = 92/165 (55.76%), Query Frame = 1
Query:  109 CEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRG----GTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVAS----NHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPG---LGEFIFDK 570
            C  G+  QI  E+ A Y YL+M  YF RD V   GFA  F K++ EEREH  KL+ Y + RG    G   L +V   AK +W DG  ++  AL+LE +V  S+ +L +       NH+  HL D+L   YLEEQ+   +EL   +T LK++      LGEF+FDK
Sbjct:   41 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHY--HLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 203          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1a (ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-000831-2])

HSP 1 Score: 241.506 bits (615), Expect = 1.142e-79
Identity = 113/175 (64.57%), Postives = 141/175 (80.57%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGKFNS 594
            S +RQNF   CEA +NRQIN+ELYA Y YLSM+YYFDRDD AL  FA FFR  S+EEREHA+KLM +QN+RGG I LQDV+KP K +WG G++++E AL+LEK V +SLLELHK+AS H DPH+ DF+E HYL+EQV++IKELGD VTNL+R+G    G+ E++FDK TLGK +S
Sbjct:    3 SQVRQNFEEACEAAVNRQINMELYASYVYLSMSYYFDRDDQALHNFAKFFRHQSHEEREHAEKLMKFQNQRGGRIFLQDVKKPEKDEWGSGVEALECALQLEKSVNHSLLELHKLASQHNDPHMCDFIETHYLDEQVKSIKELGDHVTNLRRMGAPQNGMAEYMFDKLTLGKESS 177          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1a (ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-000831-2])

HSP 1 Score: 241.506 bits (615), Expect = 1.142e-79
Identity = 113/175 (64.57%), Postives = 141/175 (80.57%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGKFNS 594
            S +RQNF   CEA +NRQIN+ELYA Y YLSM+YYFDRDD AL  FA FFR  S+EEREHA+KLM +QN+RGG I LQDV+KP K +WG G++++E AL+LEK V +SLLELHK+AS H DPH+ DF+E HYL+EQV++IKELGD VTNL+R+G    G+ E++FDK TLGK +S
Sbjct:    3 SQVRQNFEEACEAAVNRQINMELYASYVYLSMSYYFDRDDQALHNFAKFFRHQSHEEREHAEKLMKFQNQRGGRIFLQDVKKPEKDEWGSGVEALECALQLEKSVNHSLLELHKLASQHNDPHMCDFIETHYLDEQVKSIKELGDHVTNLRRMGAPQNGMAEYMFDKLTLGKESS 177          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1b (ferritin, heavy polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040912-30])

HSP 1 Score: 230.335 bits (586), Expect = 2.676e-75
Identity = 109/175 (62.29%), Postives = 136/175 (77.71%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGKFNS 594
            S +RQNFH +CEA INRQI LELYA Y YLSM YYFDRDD +L  FA FFR  S EEREHA+KLM+ QN+RGG I LQD++KP + +WG GL+++E AL LEK V  SLLELHKVA+ H DPH+ DFLE HYL+EQV++IKEL D+V +L+R+G     + E++FD+ TLGK +S
Sbjct:    3 SQVRQNFHQECEAAINRQIYLELYASYVYLSMGYYFDRDDKSLPNFAKFFRDQSKEEREHAEKLMSLQNQRGGRIFLQDIKKPDRDEWGSGLEALECALALEKSVNLSLLELHKVATQHNDPHVCDFLETHYLDEQVKSIKELSDWVGSLRRMGAPQNNMAEYLFDRHTLGKESS 177          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fthl27 (ferritin, heavy polypeptide-like 27 [Source:ZFIN;Acc:ZDB-GENE-040718-72])

HSP 1 Score: 229.18 bits (583), Expect = 6.952e-75
Identity = 108/170 (63.53%), Postives = 134/170 (78.82%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPG---LGEFIFDKETL 579
            S +RQN+  DCEA IN+ INLELYA YTY SMA+YFDRDDVAL GFA FF+K+S EEREHA+K M +QNKRGG I+LQD++KP + +W +GL +M+ AL+LEK V  +LL+LHKVAS   DPHL DFLE HYL EQVEAIK+LGD +TNL ++  G   + E++FDK TL
Sbjct:    3 SQVRQNYDRDCEALINKMINLELYAGYTYTSMAFYFDRDDVALPGFAKFFKKNSEEEREHAEKFMEFQNKRGGRIVLQDIKKPERDEWDNGLTAMQCALQLEKNVNQALLDLHKVASQKGDPHLCDFLESHYLNEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fthl28 (ferritin, heavy polypeptide-like 28 [Source:ZFIN;Acc:ZDB-GENE-030131-7540])

HSP 1 Score: 226.483 bits (576), Expect = 8.474e-74
Identity = 107/168 (63.69%), Postives = 133/168 (79.17%), Query Frame = 1
Query:   85 IRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPG---LGEFIFDKETL 579
            IRQN+ +DCEA IN+ INLELYA YTY SMA+YF RDDVAL GFA FF+K+S EEREHA+K M +QNKRGG I+LQD++KP +  W +GL +M+ AL+LEK V  +LL+LHKVAS   DPHL DFLE HYL+EQVEAIK+LGD +TNL ++  G   + E++FDK TL
Sbjct:    6 IRQNYDSDCEASINKMINLELYAGYTYTSMAHYFKRDDVALNGFAKFFKKNSEEEREHAEKFMEFQNKRGGRIVLQDIKKPDRDVWDNGLIAMQCALQLEKNVNQALLDLHKVASQKGDPHLCDFLETHYLDEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDKHTL 173          
BLAST of Ferritin vs. Ensembl Xenopus
Match: nop53 (NOP53 ribosome biogenesis factor [Source:Xenbase;Acc:XB-GENE-853827])

HSP 1 Score: 238.039 bits (606), Expect = 3.904e-78
Identity = 107/172 (62.21%), Postives = 141/172 (81.98%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGK 585
            S +RQN+H +CEA INRQ+N+ELYA Y YLSMAYYFDRDDVALK F+ +F   S+EEREHA+KLM  QN+RGG I LQDV+KP + +W +GL+++E +L+LEK V  SLLELHK++++H DPHL DFLE HYL+EQV+++KELGD +TNL+R+G    G+ E++FDK TLG+
Sbjct:    3 SQVRQNYHQECEAAINRQVNMELYASYVYLSMAYYFDRDDVALKNFSKYFLHQSHEEREHAEKLMKMQNQRGGRIFLQDVKKPDRDEWANGLEALECSLQLEKSVNQSLLELHKLSTDHNDPHLCDFLESHYLDEQVKSMKELGDHITNLRRMGAPSNGMAEYLFDKHTLGE 174          
BLAST of Ferritin vs. Ensembl Xenopus
Match: fth1.1 (ferritin, heavy polypeptide 1, gene 1 [Source:NCBI gene;Acc:394604])

HSP 1 Score: 237.654 bits (605), Expect = 5.233e-78
Identity = 108/172 (62.79%), Postives = 142/172 (82.56%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGK 585
            S +RQNF++DCEA INR +N+ELYA Y YLSM+YYFDRDDVAL   A FF++ S+EEREHA+K + YQNKRGG  +LQD++KP + +WG+ L++M+AAL+LEK V  +LL+LHK+AS+  DPHL DFLE  YLEEQV+A+KELGD++TNLKR+G    G+GE++FDK TLG+
Sbjct:    3 SQVRQNFNSDCEAAINRMVNMELYASYVYLSMSYYFDRDDVALHHVAKFFKEQSHEEREHAEKFLKYQNKRGGRAVLQDIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLASDKTDPHLCDFLESEYLEEQVKAMKELGDYITNLKRLGVPQNGMGEYLFDKHTLGE 174          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC79725 (MGC79725 protein [Source:NCBI gene;Acc:448524])

HSP 1 Score: 211.075 bits (536), Expect = 1.463e-67
Identity = 96/172 (55.81%), Postives = 131/172 (76.16%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLG 582
            +S +RQN+  DCEA +NR +NLE+YA YTYLSM++YFDRDDVAL   A FF++ S EERE A+KLM  QNKRGG I+LQD++KP + +WG  L +M+ AL+LEK V  +LL+LH +A+   DPH+ DFLE  +L+EQV+ +K+ GD +TNLKR+G    G+GE++FDK +L 
Sbjct:    2 ISQVRQNYSHDCEAAVNRMVNLEMYASYTYLSMSHYFDRDDVALHHVAEFFKEQSKEERECAEKLMKCQNKRGGRIVLQDIKKPERDEWGSTLDAMQTALDLEKHVNQALLDLHNLATERKDPHICDFLESEHLDEQVKHMKKFGDHITNLKRLGVPQNGMGEYLFDKHSLS 173          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC75752 (uncharacterized protein MGC75752 [Source:NCBI gene;Acc:394820])

HSP 1 Score: 210.305 bits (534), Expect = 2.717e-67
Identity = 96/171 (56.14%), Postives = 132/171 (77.19%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLG 582
            S IRQN+H + EAGINR  NLEL   Y YLS+ YYFDRDDVAL  F+ ++R+ S ++R+HA+ L+ +QNKRGG ++LQD++KP   +WG+G ++ME AL LEK V  +LL+LHK+A++H DPH+ D+LE  +LEE+V+ IK+LGD +TNLKRV     G+GE++FDK TLG
Sbjct:    5 SQIRQNYHEESEAGINRIANLELQTSYVYLSLGYYFDRDDVALSKFSKYYRELSEKKRDHAEDLLKFQNKRGGRVVLQDIKKPDADEWGNGTKAMEVALNLEKSVNQALLDLHKIATDHADPHMCDYLEREFLEEEVKIIKKLGDHLTNLKRVKAAEDGMGEYLFDKLTLG 175          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC79725 (MGC79725 protein [Source:NCBI gene;Acc:448524])

HSP 1 Score: 209.92 bits (533), Expect = 4.101e-67
Identity = 96/170 (56.47%), Postives = 130/170 (76.47%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKET 576
            +S +RQN+  DCEA +NR +NLE+YA YTYLSM++YFDRDDVAL   A FF++ S EERE A+KLM  QNKRGG I+LQD++KP + +WG  L +M+ AL+LEK V  +LL+LH +A+   DPH+ DFLE  +L+EQV+ +K+ GD +TNLKR+G    G+GE++FDK T
Sbjct:    2 ISQVRQNYSHDCEAAVNRMVNLEMYASYTYLSMSHYFDRDDVALHHVAEFFKEQSKEERECAEKLMKCQNKRGGRIVLQDIKKPERDEWGSTLDAMQTALDLEKHVNQALLDLHNLATERKDPHICDFLESEHLDEQVKHMKKFGDHITNLKRLGVPQNGMGEYLFDKHT 171          
BLAST of Ferritin vs. Ensembl Mouse
Match: Fth1 (ferritin heavy polypeptide 1 [Source:MGI Symbol;Acc:MGI:95588])

HSP 1 Score: 228.024 bits (580), Expect = 2.808e-74
Identity = 109/171 (63.74%), Postives = 133/171 (77.78%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETLG 582
            S +RQN+H D EA INRQINLELYA Y YLSM+ YFDRDDVALK FA +F   S+EEREHA+KLM  QN+RGG I LQD++KP + DW  GL +ME AL LEK V  SLLELHK+A++  DPHL DF+E +YL EQV++IKELGD VTNL+++G    G+ E++FDK TLG
Sbjct:    7 SQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTLG 177          
BLAST of Ferritin vs. Ensembl Mouse
Match: Fth1 (ferritin heavy polypeptide 1 [Source:MGI Symbol;Acc:MGI:95588])

HSP 1 Score: 228.024 bits (580), Expect = 2.808e-74
Identity = 109/171 (63.74%), Postives = 133/171 (77.78%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETLG 582
            S +RQN+H D EA INRQINLELYA Y YLSM+ YFDRDDVALK FA +F   S+EEREHA+KLM  QN+RGG I LQD++KP + DW  GL +ME AL LEK V  SLLELHK+A++  DPHL DF+E +YL EQV++IKELGD VTNL+++G    G+ E++FDK TLG
Sbjct:    7 SQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTLG 177          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftmt (ferritin mitochondrial [Source:MGI Symbol;Acc:MGI:1914884])

HSP 1 Score: 225.328 bits (573), Expect = 2.443e-72
Identity = 112/173 (64.74%), Postives = 129/173 (74.57%), Query Frame = 1
Query:   73 RMSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETLG 582
            R S +RQNFH D EA INRQINLELYA Y YLSMAYYF RDDVAL  F+ +F + S EEREHA+KLM  QN+RGG I LQD++KP K DW  GL++ME AL LEK V  SLL+LH +AS   DPHL DFLE HYL EQV++IKELGD V NL  +G    GL E++FDK TLG
Sbjct:   60 RPSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALYNFSKYFLRQSLEEREHAEKLMKLQNQRGGRICLQDIKKPDKDDWECGLRAMECALLLEKNVNQSLLDLHTLASEKGDPHLCDFLETHYLHEQVKSIKELGDHVHNLVTMGAPAAGLAEYLFDKHTLG 232          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftl1 (ferritin light polypeptide 1 [Source:MGI Symbol;Acc:MGI:95589])

HSP 1 Score: 183.726 bits (465), Expect = 7.582e-57
Identity = 87/178 (48.88%), Postives = 128/178 (71.91%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRV-GP----------GLGEFIFDKETL 579
            S IRQN+  + EA +NR +NL L A YTYLS+ ++FDRDDVAL+G  +FFR+ + E+RE A++L+ +QN RGG  + QDV+KP++ +WG   ++MEAAL +EK +  +LL+LH + S   DPHL DFLE HYL+++V+ IK++G+ +TNL+RV GP           LGE++F++ TL
Sbjct:    3 SQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGAPQGSLGEYLFERLTL 180          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftl1-ps1 (ferritin light polypeptide 1, pseudogene 1 [Source:MGI Symbol;Acc:MGI:3779109])

HSP 1 Score: 183.726 bits (465), Expect = 7.582e-57
Identity = 87/178 (48.88%), Postives = 128/178 (71.91%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRV-GP----------GLGEFIFDKETL 579
            S IRQN+  + EA +NR +NL L A YTYLS+ ++FDRDDVAL+G  +FFR+ + E+RE A++L+ +QN RGG  + QDV+KP++ +WG   ++MEAAL +EK +  +LL+LH + S   DPHL DFLE HYL+++V+ IK++G+ +TNL+RV GP           LGE++F++ TL
Sbjct:    3 SQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGAPQGSLGEYLFERLTL 180          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P85838|FRIH_PSEBE (Ferritin, heavy subunit OS=Pseudotrematomus bernacchii OX=40690 PE=1 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 6.336e-83
Identity = 117/172 (68.02%), Postives = 143/172 (83.14%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGK 585
            S +RQNFH DCEA INRQINLELYA Y+YLSMAYYFDRDDVAL GFA+FF++ S EEREHA+KL+ +QN+RGG I LQDV+KP + +WG GL ++E AL+LEK V  SLL+LHKV S H DPH+ DFLE HYL+EQV++IKELGD+VTNL+R+G    G+ E++FDK TLGK
Sbjct:    3 SQVRQNFHKDCEAAINRQINLELYASYSYLSMAYYFDRDDVALPGFAHFFKQQSEEEREHAEKLLKFQNQRGGRIFLQDVKKPDRDEWGSGLDALECALQLEKNVNQSLLDLHKVCSEHNDPHMCDFLETHYLDEQVKSIKELGDWVTNLRRLGAPQNGMAEYLFDKHTLGK 174          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P85837|FRIH_TRENE (Ferritin, heavy subunit OS=Trematomus newnesi OX=35730 PE=1 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 1.599e-82
Identity = 118/172 (68.60%), Postives = 141/172 (81.98%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGK 585
            S +RQNFH DCEA INRQINLELYA Y+YLSMAYYFDRDDVAL GFA+FF+  S EEREHA+KLM  QN+RGG I LQDV+KP + +WG GL ++E AL+LEK V  SLL+LHKV S H DPH+ DFLE HYL+EQV++IKELGD+VTNL+R+G    G+ E++FDK TLGK
Sbjct:    3 SQVRQNFHKDCEAAINRQINLELYASYSYLSMAYYFDRDDVALPGFAHFFKHQSEEEREHAEKLMKQQNQRGGRIFLQDVKKPDRDEWGSGLDALECALQLEKNVNQSLLDLHKVCSEHNDPHMCDFLETHYLDEQVKSIKELGDWVTNLRRLGAPQNGMAEYLFDKHTLGK 174          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P42577|FRIS_LYMST (Soma ferritin OS=Lymnaea stagnalis OX=6523 PE=2 SV=2)

HSP 1 Score: 249.21 bits (635), Expect = 7.188e-82
Identity = 113/169 (66.86%), Postives = 140/169 (82.84%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETLG 582
            +S  RQN+HA+ EAGINRQIN+ELYA Y+Y SMAYYFDRDDVAL GF  FF+  S EEREHA+KLM YQNKRGG I+LQD++KP + +WG GL++M+ AL+LEK V  SLL+LHK+ ++H D  + DFLE  +LEEQV++IKEL D++TNLKRVGPGLGE+IFDKETL 
Sbjct:    3 VSQARQNYHAESEAGINRQINMELYASYSYQSMAYYFDRDDVALPGFHKFFKHQSEEEREHAEKLMKYQNKRGGRIVLQDIKKPDRDEWGTGLEAMQVALQLEKSVNQSLLDLHKLCTSHDDAQMADFLESEFLEEQVKSIKELSDYITNLKRVGPGLGEYIFDKETLS 171          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P49946|FRIH_SALSA (Ferritin, heavy subunit OS=Salmo salar OX=8030 PE=2 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.027e-80
Identity = 114/172 (66.28%), Postives = 140/172 (81.40%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGK 585
            S +RQNFH DCEA INRQINLELYA Y YLSMAYYFDRDD AL  FA FF+  S+EEREHA+KLM  QN+RGG I LQDV+KP K +WG G++++E++L+LEK V  SLL+LHKV S H DPH+ DF+E HYL+EQV++IKELGD+VTNL+R+G    G+ E++FDK TLGK
Sbjct:    3 SQVRQNFHQDCEAAINRQINLELYASYVYLSMAYYFDRDDQALHNFAKFFKNQSHEEREHAEKLMKVQNQRGGRIFLQDVKKPEKDEWGSGVEALESSLQLEKSVNQSLLDLHKVCSEHNDPHMCDFIETHYLDEQVKSIKELGDWVTNLRRMGAPQNGMAEYLFDKHTLGK 174          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P07229|FRI1_LITCT (Ferritin, higher subunit OS=Lithobates catesbeianus OX=8400 PE=1 SV=3)

HSP 1 Score: 240.736 bits (613), Expect = 1.585e-78
Identity = 110/172 (63.95%), Postives = 142/172 (82.56%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETLGK 585
            S +RQNFH DCEA INR +N+ELYA YTYLSMA+YFDRDD+AL   A FF++ S+EEREHA+KLM  QNKRGG I+LQDV+KP + +WG+ L++M+AAL+LEK V  +LL+LHKV S+  DPHL DFLE  YLEEQV++IK+LGD++TNLKR+G    G+GE++FDK T+G+
Sbjct:    3 SQVRQNFHRDCEAAINRMVNMELYASYTYLSMAFYFDRDDIALHNVAKFFKEQSHEEREHAEKLMKDQNKRGGRIVLQDVKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKVGSDKVDPHLCDFLETEYLEEQVKSIKQLGDYITNLKRLGLPQNGMGEYLFDKHTMGE 174          
BLAST of Ferritin vs. TrEMBL
Match: A0A2C9JSJ7 (Ferritin OS=Biomphalaria glabrata OX=6526 GN=106066392 PE=3 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 6.734e-84
Identity = 116/169 (68.64%), Postives = 144/169 (85.21%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETLG 582
            +S  RQN+HADCEAGINRQIN+ELYA YTY SMA+YF+RDDVAL GF  FF+K S EEREHA+KLM YQNKRGG ++LQD++KP + +WG GL++M+ AL+LEK V  SLL+LHKV ++H DP + DFLE  YLEEQVE+IK++GD++TNLKRVG GLGE++FDKETLG
Sbjct:    3 VSQCRQNYHADCEAGINRQINMELYASYTYQSMAFYFERDDVALPGFHKFFKKQSEEEREHAEKLMKYQNKRGGRVVLQDIKKPDRDEWGTGLEAMQVALQLEKSVNQSLLDLHKVCTDHEDPQMADFLESEYLEEQVESIKQIGDYITNLKRVGSGLGEYLFDKETLG 171          
BLAST of Ferritin vs. TrEMBL
Match: A0A168L517 (Ferritin (Fragment) OS=Conus monile OX=351660 GN=FTH1 PE=2 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 7.560e-83
Identity = 117/168 (69.64%), Postives = 144/168 (85.71%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETL 579
            +S  RQN+HA+CEAGINRQIN+EL+A Y Y SMA+YFDRDDVAL GFA FFRKSS EEREHA+KLM +QN+RGG I+LQD++KP + +WG GL +M+ AL LEK V  SLL+LH+VA+NH D  +TDFLE +YL+EQV +IKELGD++TNLKRVGPGLGE++FDKETL
Sbjct:    3 VSQCRQNYHAECEAGINRQINMELHASYCYQSMAFYFDRDDVALPGFAKFFRKSSEEEREHAEKLMTFQNQRGGRIVLQDIKKPDRDEWGSGLDAMQVALALEKSVNQSLLDLHEVATNHNDAQMTDFLEGNYLQEQVRSIKELGDYITNLKRVGPGLGEYLFDKETL 170          
BLAST of Ferritin vs. TrEMBL
Match: A0A5P8I130 (Ferritin OS=Conus magus OX=6492 PE=2 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 7.726e-83
Identity = 117/168 (69.64%), Postives = 144/168 (85.71%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETL 579
            +S  RQN+HA+CEAGINRQIN+EL+A Y Y SMA+YFDRDDVAL GFA FFRKSS EEREHA+KLM +QN+RGG I+LQD++KP + +WG GL +M+ AL LEK V  SLL+LH+VA+NH D  +TDFLE +YL+EQV +IKELGD++TNLKRVGPGLGE++FDKETL
Sbjct:    3 VSQCRQNYHAECEAGINRQINMELHASYCYQSMAFYFDRDDVALPGFAKFFRKSSEEEREHAEKLMTFQNQRGGRIVLQDIKKPDRDEWGSGLDAMQVALALEKSVNQSLLDLHEVATNHNDAQMTDFLEGNYLQEQVRSIKELGDYITNLKRVGPGLGEYMFDKETL 170          
BLAST of Ferritin vs. TrEMBL
Match: A0A218NGM4 (Ferritin OS=Conus ebraeus OX=89425 GN=FTH1 PE=2 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 7.726e-83
Identity = 117/168 (69.64%), Postives = 144/168 (85.71%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETL 579
            +S  RQN+HA+CEAGINRQIN+EL+A Y Y SMA+YFDRDDVAL GFA FFRKSS EEREHA+KLM +QN+RGG I+LQD++KP + +WG GL +M+ AL LEK V  SLL+LH+VA+NH D  +TDFLE +YL+EQV +IKELGD++TNLKRVGPGLGE++FDKETL
Sbjct:    3 VSQCRQNYHAECEAGINRQINMELHASYCYQSMAFYFDRDDVALPGFAKFFRKSSEEEREHAEKLMTFQNQRGGRIVLQDIKKPDRDEWGSGLDAMQVALALEKSVNQSLLDLHEVATNHNDAQMTDFLEGNYLQEQVRSIKELGDYITNLKRVGPGLGEYMFDKETL 170          
BLAST of Ferritin vs. TrEMBL
Match: A0A1Y0F4J2 (Ferritin OS=Conus frigidus OX=101755 GN=FTH1 PE=2 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 7.726e-83
Identity = 117/168 (69.64%), Postives = 144/168 (85.71%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETL 579
            +S  RQN+HA+CEAGINRQIN+EL+A Y Y SMA+YFDRDDVAL GFA FFRKSS EEREHA+KLM +QN+RGG I+LQD++KP + +WG GL +M+ AL LEK V  SLL+LH+VA+NH D  +TDFLE +YL+EQV +IKELGD++TNLKRVGPGLGE++FDKETL
Sbjct:    3 VSQCRQNYHAECEAGINRQINMELHASYCYQSMAFYFDRDDVALPGFAKFFRKSSEEEREHAEKLMTFQNQRGGRIVLQDIKKPDRDEWGSGLDAMQVALALEKSVNQSLLDLHEVATNHNDAQMTDFLEGNYLQEQVRSIKELGDYITNLKRVGPGLGEYMFDKETL 170          
BLAST of Ferritin vs. Ensembl Cavefish
Match: fth1b (ferritin, heavy subunit [Source:NCBI gene;Acc:103039853])

HSP 1 Score: 241.506 bits (615), Expect = 1.230e-79
Identity = 112/175 (64.00%), Postives = 139/175 (79.43%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGKFNS 594
            S +RQNFH DCEA INRQINLELYA Y YLSM+YYFDRDD AL  FA FF K S+EEREHA+KLM  QN+RGG I LQD+ KP + +WG G++++E AL+LEK V  SLL+LHKVAS   DPH+ DF+E HYL+EQV++IKEL D+V+NL+R+G    G+ E++FDK TLGK +S
Sbjct:    3 SQVRQNFHQDCEAAINRQINLELYASYVYLSMSYYFDRDDQALPNFAKFFHKQSHEEREHAEKLMKLQNQRGGRIFLQDIRKPERDEWGSGVEALECALQLEKSVNQSLLDLHKVASERNDPHMCDFIETHYLDEQVKSIKELADWVSNLRRMGAPQNGMAEYLFDKHTLGKESS 177          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000042393.1 (ferritin, middle subunit [Source:NCBI gene;Acc:103038450])

HSP 1 Score: 233.417 bits (594), Expect = 1.529e-76
Identity = 106/171 (61.99%), Postives = 140/171 (81.87%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPG---LGEFIFDKETLG 582
            S +RQN+H DCEA INR +N+EL+A YTY SMAYYF RDDVAL+GFA+FF+++S+EE+EHA+KL+++QNKRGG I LQD++KP + +WG GL++M+ AL+LEK V  +LL+LHK+AS   DPHL DFLE HYL EQVEAIK+LGD +TNL ++  G   + E++FDK TLG
Sbjct:    4 SQVRQNYHRDCEAAINRMVNMELFASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEQEHAEKLLSFQNKRGGRIFLQDIKKPERDEWGTGLEAMQCALQLEKNVNQALLDLHKIASEKGDPHLCDFLETHYLNEQVEAIKKLGDHITNLTKMDAGNNRMAEYLFDKHTLG 174          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000048516.1 (ferritin, middle subunit [Source:NCBI gene;Acc:103038450])

HSP 1 Score: 233.417 bits (594), Expect = 1.685e-76
Identity = 106/171 (61.99%), Postives = 140/171 (81.87%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPG---LGEFIFDKETLG 582
            S +RQN+H DCEA INR +N+EL+A YTY SMAYYF RDDVAL+GFA+FF+++S+EE+EHA+KL+++QNKRGG I LQD++KP + +WG GL++M+ AL+LEK V  +LL+LHK+AS   DPHL DFLE HYL EQVEAIK+LGD +TNL ++  G   + E++FDK TLG
Sbjct:    3 SQVRQNYHRDCEAAINRMVNMELFASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEQEHAEKLLSFQNKRGGRIFLQDIKKPERDEWGTGLEAMQCALQLEKNVNQALLDLHKIASEKGDPHLCDFLETHYLNEQVEAIKKLGDHITNLTKMDAGNNRMAEYLFDKHTLG 173          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000033875.1 (ferritin, middle subunit-like [Source:NCBI gene;Acc:103029096])

HSP 1 Score: 230.72 bits (587), Expect = 1.516e-75
Identity = 104/171 (60.82%), Postives = 138/171 (80.70%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPG---LGEFIFDKETLG 582
            S IRQN+H+DCEA INR +N+E YA YTY SMAYYF RDDVAL+GFA+FF+++S+EEREHA+K + +QNKRGG + LQD++KP + +WG GL++M+ AL+LEK+V  +LL+LHK+AS   DPHL DFLE +YL EQVE IK+LGD +TNL ++  G   + E++FDK TLG
Sbjct:    3 SQIRQNYHSDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEREHAEKFLEFQNKRGGRVFLQDIKKPERDEWGTGLEAMQCALQLEKKVNQALLDLHKIASEKGDPHLCDFLESNYLNEQVEMIKKLGDHITNLTKMDAGNNRMAEYLFDKHTLG 173          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000033391.1 (ferritin, middle subunit-like [Source:NCBI gene;Acc:103029400])

HSP 1 Score: 230.335 bits (586), Expect = 3.019e-75
Identity = 103/171 (60.23%), Postives = 137/171 (80.12%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPG---LGEFIFDKETLG 582
            SL+RQN+H DCEA INR +N+E YA YTY SMAYYF RDDVALKGFA+FF+++S+EEREHA+K + +QNKRGG + LQD++KP + +WG GL++M+ AL+LEK+V  +LL+LH +A+   DPHL DFLE +YL EQVE IK+LGD +TNL ++  G   + E++FDK TLG
Sbjct:   10 SLVRQNYHRDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALKGFAHFFKENSHEEREHAEKFLEFQNKRGGRVFLQDIKKPERDEWGTGLEAMQCALQLEKKVNQALLDLHNIATEKGDPHLCDFLESNYLNEQVEMIKKLGDHITNLTKMDAGNNKMAEYLFDKHTLG 180          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009440.1 (pep scaffold:Pmarinus_7.0:GL477527:22989:26064:-1 gene:ENSPMAG00000008472.1 transcript:ENSPMAT00000009440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.958 bits (598), Expect = 8.786e-78
Identity = 112/175 (64.00%), Postives = 138/175 (78.86%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGKFNS 594
            S +RQN+  D EA INRQIN+EL A Y YLSMAYYFDRDDVAL  F  FF++ S+EEREHA+KLM YQNKRGG ++L+DV+KP + +WG GL++++ AL+LEK V  SLL+LH + S   DP L DFLE HYLEEQVEAIK+LGDFVTNLKR+G    G+GE++FDK TLG  +S
Sbjct:    3 SQVRQNYAQDVEAAINRQINMELSASYVYLSMAYYFDRDDVALNNFFKFFKEQSHEEREHAEKLMAYQNKRGGRVVLKDVKKPERDEWGSGLEAVQLALQLEKNVNQSLLDLHALGSKENDPQLCDFLESHYLEEQVEAIKKLGDFVTNLKRLGASQSGMGEYLFDKLTLGSSSS 177          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009047.1 (pep scaffold:Pmarinus_7.0:GL479272:14627:24709:-1 gene:ENSPMAG00000008168.1 transcript:ENSPMAT00000009047.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.95 bits (585), Expect = 7.756e-76
Identity = 108/172 (62.79%), Postives = 135/172 (78.49%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETLG 582
            MSL+RQNF  +CEA INRQIN ELYA Y YLSMA+YFDRDDVALK  + FFR+ S EER HA+KLM YQN+RGG I LQDV+KP + +WG+ L+++  AL+LEK V  +LLELH +A+ H DP L DFL+ HYLEEQVE+IK + D +T+LK++G    G+GEF+FDK TLG
Sbjct:    6 MSLVRQNFSEECEAAINRQINQELYASYVYLSMAFYFDRDDVALKHLSKFFREQSLEERGHAEKLMGYQNRRGGRIFLQDVQKPERDEWGNALEALTLALQLEKNVNQALLELHALATEHNDPQLCDFLDSHYLEEQVESIKNIADHITSLKKMGVPQSGMGEFLFDKLTLG 177          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006438.1 (pep scaffold:Pmarinus_7.0:GL477323:212806:215511:-1 gene:ENSPMAG00000005680.1 transcript:ENSPMAT00000006438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 221.861 bits (564), Expect = 1.008e-72
Identity = 107/171 (62.57%), Postives = 133/171 (77.78%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETLG 582
            S IRQNF  + EA INRQ+N ELYA Y YLS+A YFDRDDVALK F  FF+  S+EEREHA+KL+ YQNKRGG  +LQD++KP + +WG GL++M+ AL+LEK V  +LL+LH +AS   DP L DFLE  +LEEQVE+IK+LGD VTNLKR+G    G+GE++FDK TLG
Sbjct:    3 SQIRQNFSQEVEAAINRQVNQELYASYVYLSLASYFDRDDVALKHFHKFFKDLSHEEREHAEKLLEYQNKRGGRAVLQDIKKPERDEWGSGLEAMQLALQLEKTVNQALLDLHALASEKTDPQLCDFLESEFLEEQVESIKKLGDHVTNLKRLGVPQSGMGEYLFDKMTLG 173          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006468.1 (pep scaffold:Pmarinus_7.0:GL477323:226303:228626:1 gene:ENSPMAG00000005828.1 transcript:ENSPMAT00000006468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.468 bits (550), Expect = 1.683e-70
Identity = 109/180 (60.56%), Postives = 133/180 (73.89%), Query Frame = 1
Query:   70 KRMSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDV--EKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETLGKFNS 594
            K  S IRQNF  + EA INRQ+N ELYA Y YLSMA YFDRDDVALK F  FF+  S+EEREHA+KL+ YQNKRGG  +LQD+  +KP + +WG GL++M+ AL+LEK V  +LL+LH +AS   DP L DFLE  +LEEQVE+IK+LGD VTNLKR+G      GE++FDK TLG   S
Sbjct:    4 KMTSQIRQNFSQEVEAAINRQVNQELYASYVYLSMASYFDRDDVALKHFHKFFKDLSHEEREHAEKLLEYQNKRGGRAVLQDIKEQKPERDEWGSGLEAMQLALQLEKTVNQALLDLHALASEKKDPQLCDFLESEFLEEQVESIKKLGDHVTNLKRLGVPHSTTGEYLFDKLTLGSSQS 183          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008696.1 (pep scaffold:Pmarinus_7.0:GL479023:7641:33670:-1 gene:ENSPMAG00000007869.1 transcript:ENSPMAT00000008696.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.593 bits (501), Expect = 3.335e-63
Identity = 93/171 (54.39%), Postives = 131/171 (76.61%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVG---PGLGEFIFDKETLG 582
            S +RQN+  D EA INRQ+N+ L+A Y +LS+A YFDRDDVALK F  FF++ S++EREHA KL+ YQNKRGG ++L+D++ P + DWG  L++M+ AL+L+K +  SLL+LH  A    DP L +FL++ +LEEQVE+IK+LGD +TNLKR+G    GLGE+++++ TLG
Sbjct:    7 SQVRQNYSPDVEAAINRQVNMTLHASYVFLSLASYFDRDDVALKNFRKFFKELSDKEREHADKLLAYQNKRGGRVVLRDIKTPERDDWGHILEAMQTALQLQKSINQSLLDLHGQAREKNDPQLCEFLKD-FLEEQVESIKKLGDHITNLKRLGVPQSGLGEYLYERLTLG 176          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO39948 (Ferritin [Source:UniProtKB/TrEMBL;Acc:A7S8I6])

HSP 1 Score: 237.269 bits (604), Expect = 1.621e-78
Identity = 109/169 (64.50%), Postives = 139/169 (82.25%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETLG 582
            MSL RQN+H +CEAGIN+QINLELYA Y YLSMA++FDRDDVAL GF  +F K+S+EEREHA+KLM +QN+RGG I+LQD++KP K +WG G+ S++ AL+LEK V  +LL+LHK+A  H D  +TDF+E ++L EQVEAIKEL   +TNLKRVGPGLGE+ +D ET+G
Sbjct:    1 MSLCRQNYHEECEAGINKQINLELYASYAYLSMAFHFDRDDVALPGFHKYFLKASHEEREHAEKLMKFQNERGGRIVLQDIKKPEKDEWGCGMDSIQVALDLEKHVNQALLDLHKIAEKHGDAQMTDFIEGNFLTEQVEAIKELAGHLTNLKRVGPGLGEYQYDHETIG 169          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO31578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI7])

HSP 1 Score: 227.254 bits (578), Expect = 1.237e-74
Identity = 106/168 (63.10%), Postives = 134/168 (79.76%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETL 579
            +S+ RQN+H + EAG+N+QINLELYA Y Y+SMAY+FDRDDVAL GF  +F K+S+EEREHA+KL  +Q +RGG I+LQD+++P + DWG G  +++AAL+LEK V  +LL+LHKVA  H D  + D+LE HYL EQVEAIKEL   +TNLKRVGPGLGEF FDK TL
Sbjct:    3 LSVCRQNYHEESEAGVNKQINLELYASYVYMSMAYHFDRDDVALPGFHKYFMKASHEEREHAEKLAKFQLQRGGRIVLQDIKRPERDDWGCGQDAIQAALDLEKHVNQALLDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHLTNLKRVGPGLGEFQFDKLTL 170          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO35374 (Ferritin [Source:UniProtKB/TrEMBL;Acc:A7SLM6])

HSP 1 Score: 224.172 bits (570), Expect = 1.954e-73
Identity = 101/171 (59.06%), Postives = 135/171 (78.95%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETLGKF 588
            MSL RQN+H +CEAGIN+QINLELYA Y Y SMA YFDR+DV L GF  FF+K ++EEREHA+KLM +QN+RGG I+LQ+V+KP + +WG GL++M+ AL+LEK V  +L+EL K A  + D  ++DF+E+H+L EQVE+I+EL  ++  LK+VGPGLG + FD ETLG+ 
Sbjct:    1 MSLCRQNYHEECEAGINKQINLELYASYVYTSMACYFDREDVHLPGFHKFFKKQAHEEREHAEKLMKFQNQRGGRIVLQNVKKPERDEWGSGLEAMQTALDLEKHVNQALIELEKTAEKNGDAQMSDFIEDHFLTEQVESIRELSGYIAVLKKVGPGLGVYQFDHETLGEL 171          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO31579 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI8])

HSP 1 Score: 224.172 bits (570), Expect = 2.403e-73
Identity = 104/167 (62.28%), Postives = 133/167 (79.64%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETL 579
            S+ RQN+H + EAG+N+QINLELYA Y Y+SMA++FDRDDVAL GF  +F ++S+EEREHA+KL  +Q +RGG I+LQD+++P + DWG G  +++AAL+LEK V  +LL+LHKVA  H D  + D+LE HYL EQVEAIKEL   +TNLKRVGPGLGEF FDK TL
Sbjct:    4 SVCRQNYHEESEAGVNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFMEASHEEREHAEKLAKFQLQRGGRIVLQDIKRPERDDWGCGQDAIQAALDLEKHVNQALLDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHMTNLKRVGPGLGEFQFDKHTL 170          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO32257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVL1])

HSP 1 Score: 223.402 bits (568), Expect = 4.274e-73
Identity = 104/168 (61.90%), Postives = 133/168 (79.17%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETL 579
            +S+ RQN+H + EAG+N+QINLELYA Y Y+SMA++FDRDDVAL GF  +F K+S+EEREHA+KL  +Q +RGG I+LQD+++P + DWG G  +++AAL+LEK V  +L +LHKVA  H D  + D+LE HYL EQVEAIKEL   +TNLKRVGPGLGEF FDK TL
Sbjct:    3 LSVCRQNYHEESEAGVNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFIKASHEEREHAEKLAKFQLQRGGRIVLQDIKRPERDDWGCGQDAIQAALDLEKHVNQALHDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHMTNLKRVGPGLGEFQFDKHTL 170          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000007389.2 (ferritin, heavy subunit [Source:NCBI gene;Acc:101169025])

HSP 1 Score: 237.654 bits (605), Expect = 4.250e-78
Identity = 110/175 (62.86%), Postives = 139/175 (79.43%), Query Frame = 1
Query:   70 KRMSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGK 585
            ++ S +R NFH DCEA INRQINLELYA Y YLSM YYFDRDD AL  FA FFRK S+EE EHA+KLM  QN+RGG I LQD++KP + +WG+GL+++E AL+LEK V  SLL++HK+ S   DPHL DF+E HYL+EQV++IKELGD+VTNL+R+G    G+ E++FDK TLG+
Sbjct:    2 EKHSQVRHNFHQDCEAAINRQINLELYASYVYLSMGYYFDRDDQALHNFAKFFRKQSHEEHEHAEKLMKLQNQRGGRIFLQDIKKPDRDEWGNGLEALECALQLEKNVNQSLLDMHKLCSERNDPHLCDFIETHYLDEQVKSIKELGDWVTNLRRMGAPQNGMAEYLFDKHTLGE 176          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000030594.1 (ferritin, heavy subunit [Source:NCBI gene;Acc:101169025])

HSP 1 Score: 237.269 bits (604), Expect = 5.458e-78
Identity = 110/172 (63.95%), Postives = 137/172 (79.65%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGK 585
            S +R NFH DCEA INRQINLELYA Y YLSM YYFDRDD AL  FA FFRK S+EE EHA+KLM  QN+RGG I LQD++KP + +WG+GL+++E AL+LEK V  SLL++HK+ S   DPHL DF+E HYL+EQV++IKELGD+VTNL+R+G    G+ E++FDK TLG+
Sbjct:    6 SQVRHNFHQDCEAAINRQINLELYASYVYLSMGYYFDRDDQALHNFAKFFRKQSHEEHEHAEKLMKLQNQRGGRIFLQDIKKPDRDEWGNGLEALECALQLEKNVNQSLLDMHKLCSERNDPHLCDFIETHYLDEQVKSIKELGDWVTNLRRMGAPQNGMAEYLFDKHTLGQ 177          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000029876.1 (ferritin, heavy subunit [Source:NCBI gene;Acc:101169025])

HSP 1 Score: 236.884 bits (603), Expect = 7.821e-78
Identity = 110/172 (63.95%), Postives = 137/172 (79.65%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLGK 585
            S +R NFH DCEA INRQINLELYA Y YLSM YYFDRDD AL  FA FFRK S+EE EHA+KLM  QN+RGG I LQD++KP + +WG+GL+++E AL+LEK V  SLL++HK+ S   DPHL DF+E HYL+EQV++IKELGD+VTNL+R+G    G+ E++FDK TLG+
Sbjct:    6 SQVRHNFHQDCEAAINRQINLELYASYVYLSMGYYFDRDDQALHNFAKFFRKQSHEEHEHAEKLMKLQNQRGGRIFLQDIKKPDRDEWGNGLEALECALQLEKNVNQSLLDMHKLCSERNDPHLCDFIETHYLDEQVKSIKELGDWVTNLRRMGAPQNGMAEYLFDKHTLGE 177          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020974.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 235.343 bits (599), Expect = 3.794e-77
Identity = 106/174 (60.92%), Postives = 141/174 (81.03%), Query Frame = 1
Query:   70 KRMSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLG 582
            K  S +RQN+H DCEA INR +N+EL+A YTY SMA+YFDRDDVAL GF++FF+++S+EE+EHA KL+++QNKRGG I LQDV+KP + +WG GL++M+ AL+LEK V  +LL+LHKVAS+H DPH+ DFLE HYL EQVE+IK++GD +TNL R+      + E++FDK TLG
Sbjct:    7 KMESQVRQNYHRDCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGRIFLQDVKKPDRNEWGSGLEAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTRMDAHTNKMAEYLFDKHTLG 180          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020975.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 234.958 bits (598), Expect = 4.163e-77
Identity = 105/171 (61.40%), Postives = 140/171 (81.87%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGP---GLGEFIFDKETLG 582
            S +RQN+H DCEA INR +N+EL+A YTY SMA+YFDRDDVAL GF++FF+++S+EE+EHA KL+++QNKRGG I LQDV+KP + +WG GL++M+ AL+LEK V  +LL+LHKVAS+H DPH+ DFLE HYL EQVE+IK++GD +TNL R+      + E++FDK TLG
Sbjct:    3 SQVRQNYHRDCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGRIFLQDVKKPDRNEWGSGLEAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTRMDAHTNKMAEYLFDKHTLG 173          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000003695.1 (SMESG000003695.1)

HSP 1 Score: 357.066 bits (915), Expect = 2.286e-125
Identity = 172/173 (99.42%), Postives = 172/173 (99.42%), Query Frame = 1
Query:   76 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETLGKFNS 594
            MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNH DPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETLGKFNS
Sbjct:    1 MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHSDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETLGKFNS 173          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000003695.1 (SMESG000003695.1)

HSP 1 Score: 288.5 bits (737), Expect = 6.172e-99
Identity = 140/141 (99.29%), Postives = 140/141 (99.29%), Query Frame = 1
Query:  172 MAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETLGKFNS 594
            MAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNH DPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETLGKFNS
Sbjct:    1 MAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHSDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETLGKFNS 141          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000068027.1 (SMESG000068027.1)

HSP 1 Score: 217.238 bits (552), Expect = 2.234e-70
Identity = 100/167 (59.88%), Postives = 130/167 (77.84%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETL 579
            S +RQNFH++ EAGIN+Q+N ELYA Y Y +M +YFDRDDVAL+GF+ FFR  S EEREHAQKLM YQNKRGG I+L+D+ KP  ++W     + E+AL LEK+V  SLL+LHK+A  H DP + DFLE  YL+EQV++IKE+ D +TN++R GPG+G ++FDK TL
Sbjct:    3 SQVRQNFHSESEAGINKQVNKELYASYVYQAMGFYFDRDDVALEGFSKFFRHQSEEEREHAQKLMAYQNKRGGRIVLEDISKPTASEWTPET-AFESALALEKEVNQSLLDLHKIAEKHNDPQMMDFLEGEYLKEQVDSIKEISDHLTNIRRNGPGVGVYLFDKLTL 168          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000068030.1 (SMESG000068030.1)

HSP 1 Score: 213.001 bits (541), Expect = 8.954e-69
Identity = 98/167 (58.68%), Postives = 130/167 (77.84%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETL 579
            S +RQNFH++ EAGIN+QIN ELYA Y Y +M +YFDRDDVAL+GF+ FFR  S EEREHA+KL+ YQNKRGG I+L+++ KP  ++W     + E+AL LEK+V  SLL+LHK+A  H DP + DFLE  YL+EQV++IKE+ D +TN++R GPG+G ++FDK TL
Sbjct:    3 SQVRQNFHSESEAGINKQINKELYASYVYQAMGFYFDRDDVALEGFSKFFRHQSEEEREHAEKLIKYQNKRGGRIVLENISKPTASEWTPET-AFESALALEKEVNQSLLDLHKIAEKHNDPQMMDFLEGEYLKEQVDSIKEISDHLTNIRRNGPGVGVYLFDKLTL 168          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000076636.1 (SMESG000076636.1)

HSP 1 Score: 211.846 bits (538), Expect = 2.954e-68
Identity = 98/167 (58.68%), Postives = 130/167 (77.84%), Query Frame = 1
Query:   79 SLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANFFRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAALELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTNLKRVGPGLGEFIFDKETL 579
            S IRQNFH+DCE GIN QIN EL+A Y Y +M+++FDRDDVAL GF+ FFR+ S EEREHA+KLM YQNKRGG ++L+D+ KP + +W     + E+ALELEK V  +LL+LHKVA  + DP + DF+E  YLEEQVE++K++ D++TN++R G GLG ++FDK TL
Sbjct:    3 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVALSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWT-AESAFESALELEKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTL 168          
The following BLAST results are available for this feature:
BLAST of Ferritin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FTH12.011e-7666.08ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
FTH12.011e-7666.08ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
FTMT3.166e-6962.64ferritin mitochondrial [Source:HGNC Symbol;Acc:HGN... [more]
FTH15.154e-5863.83ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
FTL4.940e-5750.59ferritin light chain [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Ferritin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ftn-24.607e-7260.84Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3][more]
ftn-24.607e-7260.84Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3][more]
ftn-14.398e-6353.61Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453][more]
ftn-14.398e-6353.61Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453][more]
back to top
BLAST of Ferritin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fer3HCH1.706e-4746.63gene:FBgn0030449 transcript:FBtr0073745[more]
Fer1HCH2.397e-2841.21gene:FBgn0015222 transcript:FBtr0344763[more]
Fer1HCH4.758e-2841.21gene:FBgn0015222 transcript:FBtr0085633[more]
Fer1HCH4.758e-2841.21gene:FBgn0015222 transcript:FBtr0085632[more]
Fer1HCH4.758e-2841.21gene:FBgn0015222 transcript:FBtr0085631[more]
back to top
BLAST of Ferritin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fth1a1.142e-7964.57ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZD... [more]
fth1a1.142e-7964.57ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZD... [more]
fth1b2.676e-7562.29ferritin, heavy polypeptide 1b [Source:ZFIN;Acc:ZD... [more]
fthl276.952e-7563.53ferritin, heavy polypeptide-like 27 [Source:ZFIN;A... [more]
fthl288.474e-7463.69ferritin, heavy polypeptide-like 28 [Source:ZFIN;A... [more]
back to top
BLAST of Ferritin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nop533.904e-7862.21NOP53 ribosome biogenesis factor [Source:Xenbase;A... [more]
fth1.15.233e-7862.79ferritin, heavy polypeptide 1, gene 1 [Source:NCBI... [more]
MGC797251.463e-6755.81MGC79725 protein [Source:NCBI gene;Acc:448524][more]
MGC757522.717e-6756.14uncharacterized protein MGC75752 [Source:NCBI gene... [more]
MGC797254.101e-6756.47MGC79725 protein [Source:NCBI gene;Acc:448524][more]
back to top
BLAST of Ferritin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fth12.808e-7463.74ferritin heavy polypeptide 1 [Source:MGI Symbol;Ac... [more]
Fth12.808e-7463.74ferritin heavy polypeptide 1 [Source:MGI Symbol;Ac... [more]
Ftmt2.443e-7264.74ferritin mitochondrial [Source:MGI Symbol;Acc:MGI:... [more]
Ftl17.582e-5748.88ferritin light polypeptide 1 [Source:MGI Symbol;Ac... [more]
Ftl1-ps17.582e-5748.88ferritin light polypeptide 1, pseudogene 1 [Source... [more]
back to top
BLAST of Ferritin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P85838|FRIH_PSEBE6.336e-8368.02Ferritin, heavy subunit OS=Pseudotrematomus bernac... [more]
sp|P85837|FRIH_TRENE1.599e-8268.60Ferritin, heavy subunit OS=Trematomus newnesi OX=3... [more]
sp|P42577|FRIS_LYMST7.188e-8266.86Soma ferritin OS=Lymnaea stagnalis OX=6523 PE=2 SV... [more]
sp|P49946|FRIH_SALSA1.027e-8066.28Ferritin, heavy subunit OS=Salmo salar OX=8030 PE=... [more]
sp|P07229|FRI1_LITCT1.585e-7863.95Ferritin, higher subunit OS=Lithobates catesbeianu... [more]
back to top
BLAST of Ferritin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JSJ76.734e-8468.64Ferritin OS=Biomphalaria glabrata OX=6526 GN=10606... [more]
A0A168L5177.560e-8369.64Ferritin (Fragment) OS=Conus monile OX=351660 GN=F... [more]
A0A5P8I1307.726e-8369.64Ferritin OS=Conus magus OX=6492 PE=2 SV=1[more]
A0A218NGM47.726e-8369.64Ferritin OS=Conus ebraeus OX=89425 GN=FTH1 PE=2 SV... [more]
A0A1Y0F4J27.726e-8369.64Ferritin OS=Conus frigidus OX=101755 GN=FTH1 PE=2 ... [more]
back to top
BLAST of Ferritin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fth1b1.230e-7964.00ferritin, heavy subunit [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000042393.11.529e-7661.99ferritin, middle subunit [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000048516.11.685e-7661.99ferritin, middle subunit [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000033875.11.516e-7560.82ferritin, middle subunit-like [Source:NCBI gene;Ac... [more]
ENSAMXT00000033391.13.019e-7560.23ferritin, middle subunit-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Ferritin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009440.18.786e-7864.00pep scaffold:Pmarinus_7.0:GL477527:22989:26064:-1 ... [more]
ENSPMAT00000009047.17.756e-7662.79pep scaffold:Pmarinus_7.0:GL479272:14627:24709:-1 ... [more]
ENSPMAT00000006438.11.008e-7262.57pep scaffold:Pmarinus_7.0:GL477323:212806:215511:-... [more]
ENSPMAT00000006468.11.683e-7060.56pep scaffold:Pmarinus_7.0:GL477323:226303:228626:1... [more]
ENSPMAT00000008696.13.335e-6354.39pep scaffold:Pmarinus_7.0:GL479023:7641:33670:-1 g... [more]
back to top
BLAST of Ferritin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ferritin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399481.621e-7864.50Ferritin [Source:UniProtKB/TrEMBL;Acc:A7S8I6][more]
EDO315781.237e-7463.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353741.954e-7359.06Ferritin [Source:UniProtKB/TrEMBL;Acc:A7SLM6][more]
EDO315792.403e-7362.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322574.274e-7361.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ferritin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000007389.24.250e-7862.86ferritin, heavy subunit [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000030594.15.458e-7863.95ferritin, heavy subunit [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000029876.17.821e-7863.95ferritin, heavy subunit [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000020974.23.794e-7760.92ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
ENSORLT00000020975.24.163e-7761.40ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Ferritin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003695.12.286e-12599.42SMESG000003695.1[more]
SMESG000003695.16.172e-9999.29SMESG000003695.1[more]
SMESG000068027.12.234e-7059.88SMESG000068027.1[more]
SMESG000068030.18.954e-6958.68SMESG000068030.1[more]
SMESG000076636.12.954e-6858.68SMESG000076636.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019831 ID=SMED30019831|Name=Ferritin|organism=Schmidtea mediterranea sexual|type=transcript|length=1012bp
CTTTAAGTTAGTCATTTGTTTAAATACATTAGTTAATTATTAGCTTTTAC
CAATTTAAATATTCATTAAAAACGAATGTCGCTAATTCGACAAAATTTTC
ATGCAGACTGTGAAGCTGGTATCAATAGGCAAATAAATCTTGAACTATAT
GCTCACTATACGTATTTAAGCATGGCTTATTACTTTGATAGGGATGATGT
TGCTCTTAAAGGATTTGCAAATTTTTTTCGTAAATCTTCTAATGAAGAAA
GAGAGCATGCTCAAAAACTTATGAATTATCAAAATAAGAGAGGTGGAACT
ATTATTCTACAAGATGTGGAGAAACCAGCCAAAACTGATTGGGGAGATGG
GCTGCAATCCATGGAAGCTGCATTGGAATTAGAAAAGCAAGTTCAAAACT
CGTTATTAGAATTGCATAAAGTTGCTTCAAATCATTTTGATCCACACTTG
ACAGACTTTTTGGAAGAACATTATTTAGAAGAACAAGTCGAAGCCATTAA
AGAATTAGGGGATTTCGTTACCAATCTTAAACGAGTTGGTCCAGGATTAG
GGGAATTCATTTTTGATAAAGAAACCCTTGGCAAATTTAATAGTTAAAAA
TTTCTGATAGTTTAATTTATTTGTTTGGATTTAAAATAGCTTTTTGCATT
TAATTATTTATATTATTTGCCTGTTTCATAGAATCATTTTTCTAACTGTA
GATGTGAACAAATTTGGATAATATTTACTGCTTAGTAATTTGTCAGTAGT
TTGAATGCATTTTTATTTTGCTGCGGAGTTTATTCAGCTTGATTATTTGC
AGGTGTACAATTATGGAAAGATCAAGAGATTTGTTGATTATTTTTGTATT
TGAAATTTTATAGCTAAATATTGTTTAATTCTAAATGTATTTAAAAGTTG
ACTTATGTAGTCGGTTGGGTGTCAGTGCTAGAAGAAACAGCGACAAAAGC
CGTTTGAACCCTTCGCCCGATCCTAGCCGTAATCAGGGTAAAAACTATGA
ATAATATTATTA
back to top

protein sequence of SMED30019831-orf-1

>SMED30019831-orf-1 ID=SMED30019831-orf-1|Name=SMED30019831-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=174bp
MSLIRQNFHADCEAGINRQINLELYAHYTYLSMAYYFDRDDVALKGFANF
FRKSSNEEREHAQKLMNYQNKRGGTIILQDVEKPAKTDWGDGLQSMEAAL
ELEKQVQNSLLELHKVASNHFDPHLTDFLEEHYLEEQVEAIKELGDFVTN
LKRVGPGLGEFIFDKETLGKFNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001519Ferritin
IPR008331Ferritin_DPS_dom
IPR012347Ferritin-like
IPR014034Ferritin_CS
IPR009040Ferritin-like_diiron
IPR009078Ferritin-like_SF
Vocabulary: molecular function
TermDefinition
GO:0008199ferric iron binding
GO:0004322ferroxidase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006879cellular iron ion homeostasis
GO:0006826iron ion transport
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008331Ferritin/DPS protein domainPFAMPF00210Ferritincoord: 15..154
e-value: 9.7E-40
score: 135.8
IPR012347Ferritin-likeGENE3DG3DSA:1.20.1260.10coord: 1..169
e-value: 1.6E-83
score: 281.2
IPR001519FerritinPANTHERPTHR11431FERRITINcoord: 2..170
IPR014034Ferritin, conserved sitePROSITEPS00204FERRITIN_2coord: 122..142
IPR009040Ferritin-like diiron domainPROSITEPS50905FERRITIN_LIKEcoord: 6..155
score: 53.403
NoneNo IPR availableCDDcd01056Euk_Ferritincoord: 9..166
e-value: 1.86665E-90
score: 259.013
IPR009078Ferritin-like superfamilySUPERFAMILYSSF47240Ferritin-likecoord: 2..169