Kinase-like domain-containing protein

Overview
NameKinase-like domain-containing protein
Smed IDSMED30019830
Length (bp)1774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinase-like domain-containing protein (SMED30019830) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinase-like domain-containing protein (SMED30019830) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinase-like domain-containing protein (SMED30019830) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinase-like domain-containing protein (SMED30019830) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019830

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30019830h1SMcG0020483 dd_Smed_v4_2672_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019830h1SMcG0020483 dd_Smed_v4_2672_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019830h1SMcG0020483 dd_Smed_v4_2672_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019830h1SMcG0020483 dd_Smed_v4_2672_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019830h1SMcG0020483 Contig45059newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019830h1SMcG0020483 Contig45059uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30019830h1SMcG0020483 dd_Smed_v6_2672_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinase-like domain-containing protein vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 51.9878 bits (123), Expect = 3.862e-6
Identity = 46/170 (27.06%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  973 LHILSSVKDKNHLCPMFS-VQGIDSTLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTS-TAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIESV 1476
            LH+  S +    L  +F  + G+D           E ++    E N    EIV  + Q+   L +LHSHN  + H+D+  E+I + T  ++ IK+       Q++   +F      L  T       E    ++ + A+DM+ LGT++Y L +GI+PF        IE++
Sbjct: 24811 LHLHESFESMEELVMIFEFISGLD---------IFERINTSAFELNE--REIVSYVHQVCEALQFLHSHN--IGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFR-----LLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENI 24962          
BLAST of Kinase-like domain-containing protein vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 51.9878 bits (123), Expect = 3.862e-6
Identity = 46/170 (27.06%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  973 LHILSSVKDKNHLCPMFS-VQGIDSTLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTS-TAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIESV 1476
            LH+  S +    L  +F  + G+D           E ++    E N    EIV  + Q+   L +LHSHN  + H+D+  E+I + T  ++ IK+       Q++   +F      L  T       E    ++ + A+DM+ LGT++Y L +GI+PF        IE++
Sbjct: 24936 LHLHESFESMEELVMIFEFISGLD---------IFERINTSAFELNE--REIVSYVHQVCEALQFLHSHN--IGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFR-----LLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENI 25087          
BLAST of Kinase-like domain-containing protein vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 51.9878 bits (123), Expect = 3.862e-6
Identity = 46/170 (27.06%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  973 LHILSSVKDKNHLCPMFS-VQGIDSTLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTS-TAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIESV 1476
            LH+  S +    L  +F  + G+D           E ++    E N    EIV  + Q+   L +LHSHN  + H+D+  E+I + T  ++ IK+       Q++   +F      L  T       E    ++ + A+DM+ LGT++Y L +GI+PF        IE++
Sbjct: 25003 LHLHESFESMEELVMIFEFISGLD---------IFERINTSAFELNE--REIVSYVHQVCEALQFLHSHN--IGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFR-----LLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENI 25154          
BLAST of Kinase-like domain-containing protein vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 51.9878 bits (123), Expect = 3.868e-6
Identity = 46/170 (27.06%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  973 LHILSSVKDKNHLCPMFS-VQGIDSTLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTS-TAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIESV 1476
            LH+  S +    L  +F  + G+D           E ++    E N    EIV  + Q+   L +LHSHN  + H+D+  E+I + T  ++ IK+       Q++   +F      L  T       E    ++ + A+DM+ LGT++Y L +GI+PF        IE++
Sbjct: 31308 LHLHESFESMEELVMIFEFISGLD---------IFERINTSAFELNE--REIVSYVHQVCEALQFLHSHN--IGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFR-----LLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENI 31459          
BLAST of Kinase-like domain-containing protein vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 51.9878 bits (123), Expect = 3.902e-6
Identity = 46/170 (27.06%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  973 LHILSSVKDKNHLCPMFS-VQGIDSTLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTS-TAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIESV 1476
            LH+  S +    L  +F  + G+D           E ++    E N    EIV  + Q+   L +LHSHN  + H+D+  E+I + T  ++ IK+       Q++   +F      L  T       E    ++ + A+DM+ LGT++Y L +GI+PF        IE++
Sbjct: 33876 LHLHESFESMEELVMIFEFISGLD---------IFERINTSAFELNE--REIVSYVHQVCEALQFLHSHN--IGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFR-----LLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENI 34027          
BLAST of Kinase-like domain-containing protein vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 53.9138 bits (128), Expect = 3.896e-7
Identity = 30/109 (27.52%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 1141 QIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            QI+ GL +LH+ NPP+ H DL  ++I    +T  +K+  + + T        ++K     V   P  +  +  +E+Y E+ D+Y  G  L  + TG  P++  +  + I
Sbjct:  443 QILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLAT-------LKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATI 544          
BLAST of Kinase-like domain-containing protein vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 53.9138 bits (128), Expect = 3.897e-7
Identity = 30/109 (27.52%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 1141 QIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            QI+ GL +LH+ NPP+ H DL  ++I    +T  +K+  + + T        ++K     V   P  +  +  +E+Y E+ D+Y  G  L  + TG  P++  +  + I
Sbjct:  445 QILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLAT-------LKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATI 546          
BLAST of Kinase-like domain-containing protein vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 53.9138 bits (128), Expect = 3.897e-7
Identity = 30/109 (27.52%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 1141 QIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            QI+ GL +LH+ NPP+ H DL  ++I    +T  +K+  + + T        ++K     V   P  +  +  +E+Y E+ D+Y  G  L  + TG  P++  +  + I
Sbjct:  445 QILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLAT-------LKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATI 546          
BLAST of Kinase-like domain-containing protein vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 53.5286 bits (127), Expect = 4.064e-7
Identity = 30/109 (27.52%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 1141 QIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            QI+ GL +LH+ NPP+ H DL  ++I    +T  +K+  + + T        ++K     V   P  +  +  +E+Y E+ D+Y  G  L  + TG  P++  +  + I
Sbjct:  443 QILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLAT-------LKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATI 544          
BLAST of Kinase-like domain-containing protein vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 53.5286 bits (127), Expect = 4.064e-7
Identity = 30/109 (27.52%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 1141 QIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            QI+ GL +LH+ NPP+ H DL  ++I    +T  +K+  + + T        ++K     V   P  +  +  +E+Y E+ D+Y  G  L  + TG  P++  +  + I
Sbjct:  445 QILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLAT-------LKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATI 546          
BLAST of Kinase-like domain-containing protein vs. Ensembl Zebrafish
Match: wnk4b (WNK lysine deficient protein kinase 4b [Source:ZFIN;Acc:ZDB-GENE-131120-119])

HSP 1 Score: 51.9878 bits (123), Expect = 2.416e-6
Identity = 40/157 (25.48%), Postives = 69/157 (43.95%), Query Frame = 1
Query: 1000 KNHLCPMFSVQGIDS-TLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            K H C +   + + S TLK ++  F+E   KL          + R   QI+ GL +LH+  PP+ H DL  ++I     T  +K+  + + T        +S      V   P  +  +  +E Y EA D+Y  G  +  + T   P++    +++I
Sbjct:  250 KGHKCIILVTELMTSGTLKTYLKRFKEMKLKL----------LQRWSNQILKGLHFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLAT-------LKSASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCILEMTTSEYPYSECQNAAQI 389          
BLAST of Kinase-like domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01069040.1 (pep chromosome:GRCz11:12:3652015:3705862:-1 gene:ENSDARG00000111945.1 transcript:ENSDART00000193864.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01069040.1)

HSP 1 Score: 50.0618 bits (118), Expect = 6.183e-6
Identity = 35/142 (24.65%), Postives = 64/142 (45.07%), Query Frame = 1
Query: 1042 STLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
             TLK ++  F+E   KL          + R   QI+ GL +LH+ +PP+ H DL  ++I     T  +K+  + + T    +++         V   P  +  +  +E Y EA D+Y  G  +  + T   P++    +++I
Sbjct:  250 GTLKTYLKRFKEMKLKL----------LQRWSRQILKGLHFLHTRSPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFA-------KSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCILEMTTSEYPYSECQNAAQI 374          
BLAST of Kinase-like domain-containing protein vs. Ensembl Mouse
Match: Ripk2 (receptor (TNFRSF)-interacting serine-threonine kinase 2 [Source:MGI Symbol;Acc:MGI:1891456])

HSP 1 Score: 50.447 bits (119), Expect = 2.969e-6
Identity = 33/117 (28.21%), Postives = 59/117 (50.43%), Query Frame = 1
Query: 1129 RLLEQIINGLIYLHSHNPPLNHYDLTLESI----GFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            R+L +I  G+ YLH+ NPPL H+DL  ++I     F+   A+  LS   + + +  + S++S  E   + ++P E  E G K   +   D+Y    +++ + +   PF  V    +I
Sbjct:  123 RILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMS-LSQSRSYKSAPEGGTIIYMPPENYEPGQKSRASVKHDIYSYAVIMWEVLSRKQPFEEVTNPLQI 238          
BLAST of Kinase-like domain-containing protein vs. Ensembl Mouse
Match: Ripk2 (receptor (TNFRSF)-interacting serine-threonine kinase 2 [Source:MGI Symbol;Acc:MGI:1891456])

HSP 1 Score: 50.0618 bits (118), Expect = 7.277e-6
Identity = 33/117 (28.21%), Postives = 59/117 (50.43%), Query Frame = 1
Query: 1129 RLLEQIINGLIYLHSHNPPLNHYDLTLESI----GFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            R+L +I  G+ YLH+ NPPL H+DL  ++I     F+   A+  LS   + + +  + S++S  E   + ++P E  E G K   +   D+Y    +++ + +   PF  V    +I
Sbjct:  123 RILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMS-LSQSRSYKSAPEGGTIIYMPPENYEPGQKSRASVKHDIYSYAVIMWEVLSRKQPFEEVTNPLQI 238          
BLAST of Kinase-like domain-containing protein vs. UniProt/SwissProt
Match: sp|X5M5N0|WNK_CAEEL (Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans OX=6239 GN=wnk-1 PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 5.235e-6
Identity = 30/109 (27.52%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 1141 QIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            QI+ GL +LH+ NPP+ H DL  ++I    +T  +K+  + + T        ++K     V   P  +  +  +E+Y E+ D+Y  G  L  + TG  P++  +  + I
Sbjct:  445 QILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLAT-------LKNKSFAKSVIGTPEFMAPEMYEEMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATI 546          
BLAST of Kinase-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q01577|PKPA_PHYB8 (Serine/threonine-protein kinase pkpA OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=pkpA PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 5.798e-6
Identity = 38/136 (27.94%), Postives = 61/136 (44.85%), Query Frame = 1
Query: 1063 GSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSV-SVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            G+ RE + KL    N     + R   QI+ GL YLH H PP+ H D+  ++I  N +  EIK+  + + + +    Y+     E +     P    E+G    Y E  D+Y  G  L  + TG  P+     + ++
Sbjct:   97 GTLREYIRKLTPLPN--IKIVKRWCRQILKGLAYLHGHEPPIIHRDIKCDNIFINGAHGEIKIGDMGTAEMKNGKKYTVIGTPEFM----APEMYEEQG----YNEKVDIYAFGMCLLEMATGEYPYGECTNAVQV 222          
BLAST of Kinase-like domain-containing protein vs. TrEMBL
Match: A0A2N0PP96 (Kinase-like protein OS=Rhizophagus irregularis OX=588596 GN=RhiirA5_171536 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.505e-9
Identity = 58/197 (29.44%), Postives = 93/197 (47.21%), Query Frame = 1
Query:  961 LTFDLHILSSVKDKN----HLCPMFSVQGIDSTLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSV-SVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIE---SVEMFVETMKKTKHHLIID 1527
            L+ ++ IL  V+  N    H C     + I  T     G+ RE + KL + N  +   + R   QI+ GLIYLHSHNPP+ H D+  ++I  N +  E+K+  + + K ++   Y+     E +     P    EKG    Y E  D+Y  G  L  + TG  P+     +++I    S  +  E++KK +   I+D
Sbjct:  124 LSQEIKILKQVRHPNIINFHDCWYKDAEFIFVTELMTSGTLREYIRKLSLPNMKI---VKRWSRQILKGLIYLHSHNPPIIHRDIKCDNIFINGAHGEVKIGDMGTAKMKLGKKYTVIGTPEFM----APEMYEEKG----YNEKVDIYAFGMCLLEMVTGEYPYGECKNAAQIYKKVSQAIKPESLKKVQDPKILD 309          
BLAST of Kinase-like domain-containing protein vs. TrEMBL
Match: A0A1S3KAU9 (uncharacterized protein LOC106180054 OS=Lingula unguis OX=7574 GN=LOC106180054 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.063e-9
Identity = 42/137 (30.66%), Postives = 82/137 (59.85%), Query Frame = 1
Query: 1087 KLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIES--SRIESVEMFVE 1491
            K + E   ++ EI+R   Q++NGL YLHS +    HYDL+L+++  +     +KL+++  +  ++I+ + E +E +L+ +HLP E+L       YT  SDMY +G +++ +WTG   F + I +  ++ +++  F++
Sbjct:  423 KTDEEKYMVFLEIMR---QVVNGLEYLHSRSMQWVHYDLSLDTVAMDYKDT-VKLTNIGHRRMLKIDPT-EPRENILRYSHLPHEVL-ADPPTTYTLTSDMYSVGIMMWEMWTGKRAFEDEITANPTKFQTMSDFIQ 553          
BLAST of Kinase-like domain-containing protein vs. TrEMBL
Match: A0A2Z6QAJ5 (Protein kinase domain-containing protein OS=Rhizophagus clarus OX=94130 GN=RclHR1_11990002 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.518e-9
Identity = 49/159 (30.82%), Postives = 79/159 (49.69%), Query Frame = 1
Query: 1063 GSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSV-SVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIE---SVEMFVETMKKTKHHLIID 1527
            G+ RE + KL + N  +   + R   QI+ GLIYLHSHNPP+ H D+  ++I  N +  E+K+  + + K ++   Y+     E +     P    EKG    Y E  D+Y  G  L  + TG  P+     +++I    S  +  E++KK +   I+D
Sbjct:  163 GTLREYIRKLSLPNMKI---VKRWSRQILKGLIYLHSHNPPIIHRDIKCDNIFINGAHGEVKIGDMGTAKMKLGKKYTVIGTPEFM----APEMYEEKG----YNEKVDIYAFGMCLLEMVTGEYPYGECKNAAQIYKKVSQAIKPESLKKVQDPKILD 310          
BLAST of Kinase-like domain-containing protein vs. TrEMBL
Match: A0A2P4Q244 (Kinase-like domain-containing protein OS=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) OX=747089 GN=GLOIN_2v1603424 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.693e-9
Identity = 49/159 (30.82%), Postives = 79/159 (49.69%), Query Frame = 1
Query: 1063 GSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSV-SVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIE---SVEMFVETMKKTKHHLIID 1527
            G+ RE + KL + N  +   + R   QI+ GLIYLHSHNPP+ H D+  ++I  N +  E+K+  + + K ++   Y+     E +     P    EKG    Y E  D+Y  G  L  + TG  P+     +++I    S  +  E++KK +   I+D
Sbjct:  123 GTLREYIRKLSLPNMKI---VKRWSRQILKGLIYLHSHNPPIIHRDIKCDNIFINGAHGEVKIGDMGTAKMKLGKKYTVIGTPEFM----APEMYEEKG----YNEKVDIYAFGMCLLEMVTGEYPYGECKNAAQIYKKVSQAIKPESLKKVQDPKILD 270          
BLAST of Kinase-like domain-containing protein vs. TrEMBL
Match: A0A1S3JCR2 (uncharacterized protein LOC106171979 OS=Lingula unguis OX=7574 GN=LOC106171979 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.855e-9
Identity = 38/128 (29.69%), Postives = 77/128 (60.16%), Query Frame = 1
Query: 1114 YNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIES--SRIESVEMFVE 1491
            Y   + ++ Q++NGL YLHS +    HYDL+L+++  +     +KL+++  +  ++I+ + E +E +L+ +HLP E+L       YT  SDMY +G +++ +WTG   F + I +  ++ +++  F++
Sbjct:  954 YMVFLEIMRQVVNGLEYLHSRSMQWVHYDLSLDTVAMDYKDT-VKLTNIGHRRMLKIDPT-EPRENILRYSHLPHEVL-ADPPTTYTLTSDMYSVGIMMWEMWTGKRAFEDEITANPTKFQTMSDFIQ 1078          
BLAST of Kinase-like domain-containing protein vs. Ensembl Cavefish
Match: wnk4b (serine/threonine-protein kinase WNK4-like [Source:NCBI gene;Acc:103036582])

HSP 1 Score: 51.9878 bits (123), Expect = 2.077e-6
Identity = 40/157 (25.48%), Postives = 69/157 (43.95%), Query Frame = 1
Query: 1000 KNHLCPMFSVQGIDS-TLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            K H C +   + + S TLK ++  F+E   KL          + R   QI+ GL +LH+  PP+ H DL  ++I     T  +K+  + + T        +S      V   P  +  +  +E Y EA D+Y  G  +  + T   P++    +++I
Sbjct:  273 KGHKCIILVTELMTSGTLKTYLKRFKEMKLKL----------LQRWSHQILKGLHFLHTRAPPIIHRDLKCDNIFITGPTGSVKIGDLGLAT-------LKSASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCILEMTTSEYPYSECQNAAQI 412          
BLAST of Kinase-like domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000021454.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:17750465:17783039:-1 gene:ENSAMXG00000020841.2 transcript:ENSAMXT00000021454.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 2.674e-6
Identity = 39/157 (24.84%), Postives = 70/157 (44.59%), Query Frame = 1
Query: 1000 KNHLCPMFSVQGIDS-TLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            K H C +   + + S TLK ++  F+E   KL          + R   QI+ GL +LH+  PP+ H DL  ++I     T  +K+  + + T    +++         V   P  +  +  +E Y EA D+Y  G  +  + T   P++    +++I
Sbjct:  224 KGHKCILLVTELMTSGTLKTYLKRFKEMKLKL----------LQRWSRQILKGLHFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFA-------KSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCILEMATSEYPYSECQNAAQI 363          
BLAST of Kinase-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002463.1 (pep scaffold:Pmarinus_7.0:GL476400:5068:120393:-1 gene:ENSPMAG00000002229.1 transcript:ENSPMAT00000002463.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 2.304e-6
Identity = 33/125 (26.40%), Postives = 61/125 (48.80%), Query Frame = 1
Query: 1120 EIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGF-NTSTAEIKLSSVS----VKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIESVE 1479
            +++  ++Q+   L +LHS N  + H+D+  E+I + +  ++ +KL        +K    I   F + E L    H           +L + A+DM+ +GT+ Y L +G++PF        IES+E
Sbjct: 17211 DVILYIKQVCEALEFLHSQN--IGHFDIRPENIIYVSKKSSRVKLVEFGQARILKPGDNIKAQFSAPEYLAPEIH---------QHDLVSSATDMWAVGTLAYVLLSGVNPFLAETNQQTIESIE 17324          
BLAST of Kinase-like domain-containing protein vs. Ensembl Medaka
Match: wnk4b (WNK lysine deficient protein kinase 4 [Source:NCBI gene;Acc:101169493])

HSP 1 Score: 52.373 bits (124), Expect = 1.482e-6
Identity = 41/157 (26.11%), Postives = 70/157 (44.59%), Query Frame = 1
Query: 1000 KNHLCPMFSVQGIDS-TLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            K H C +   + + S TLK ++  F+E   KL          + R   QI+ GL +LH+  PP+ H DL  ++I     T  +K+  + + T        +S      V   P  +  +  +E Y EA D+Y LG  +  + T   P++    +++I
Sbjct:  245 KGHKCIILVTELMTSGTLKTYLKRFKEMKLKL----------LQRWSRQILKGLHFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLAT-------LKSASFAKSVIGTPEFMAPEMYEEKYDEAVDVYALGMCILEMATSEYPYSECQNAAQI 384          
BLAST of Kinase-like domain-containing protein vs. Ensembl Medaka
Match: wnk4b (WNK lysine deficient protein kinase 4 [Source:NCBI gene;Acc:101169493])

HSP 1 Score: 52.373 bits (124), Expect = 1.515e-6
Identity = 41/157 (26.11%), Postives = 70/157 (44.59%), Query Frame = 1
Query: 1000 KNHLCPMFSVQGIDS-TLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            K H C +   + + S TLK ++  F+E   KL          + R   QI+ GL +LH+  PP+ H DL  ++I     T  +K+  + + T        +S      V   P  +  +  +E Y EA D+Y LG  +  + T   P++    +++I
Sbjct:  245 KGHKCIILVTELMTSGTLKTYLKRFKEMKLKL----------LQRWSRQILKGLHFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLAT-------LKSASFAKSVIGTPEFMAPEMYEEKYDEAVDVYALGMCILEMATSEYPYSECQNAAQI 384          
BLAST of Kinase-like domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027269.1 (pep primary_assembly:ASM223467v1:8:129429:156272:1 gene:ENSORLG00000026732.1 transcript:ENSORLT00000027269.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 6.203e-6
Identity = 39/157 (24.84%), Postives = 72/157 (45.86%), Query Frame = 1
Query: 1000 KNHLCPMFSVQGIDS-TLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI 1467
            K H C +   + + S TLK ++  FR+   KL          + R   Q++ GL +LHS +PP+ H DL  ++I     +A +K+  + + T  + +++         V   P  +  +  +E Y EA D+Y  G  +  + T   P+     +++I
Sbjct:  152 KGHKCTILVTELMTSGTLKMYLRRFRQMKLKL----------LQRWSFQVLRGLHFLHSRSPPIIHRDLKCDNIFITGPSASVKIGDLGLATLKKASFA-------KSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCMLEMATSEYPYHECHSAAQI 291          
BLAST of Kinase-like domain-containing protein vs. Planmine SMEST
Match: SMESG000010252.1 (SMESG000010252.1)

HSP 1 Score: 525.013 bits (1351), Expect = 1.554e-175
Identity = 251/253 (99.21%), Postives = 252/253 (99.60%), Query Frame = 1
Query:  901 FSEILLGDHDKNNSDYLKHFLTFDLHILSSVKDKNHLCPMFSVQGIDSTLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIESVEMFVETMKKTKHHLIIDHSMFLNGFPDMIFAWCTLCWENKLTAKVFNEYLRKTTFYGAIKD 1659
            + EILLGDHDKNNSDYLKHFLTFDLHILSSVKDKNHLCPMFSVQGIDSTLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIESVEMFVETMKKTKHHLIIDHSMFLNGFPDMIFAWCTLCWENKLTAKVFNEYLRKTTFYGAIKD
Sbjct:  785 YREILLGDHDKNNSDYLKHFLTFDLHILSSVKDKNHLCPMFSVQGIDSTLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIESVEMFVETMKKTKHHLIIDHSMFLNGFPDMIFAWCTLCWENKLTAKVFNEYLRKTTFYGAIKD 1037          
BLAST of Kinase-like domain-containing protein vs. Planmine SMEST
Match: SMESG000010251.1 (SMESG000010251.1)

HSP 1 Score: 166.007 bits (419), Expect = 4.949e-43
Identity = 80/220 (36.36%), Postives = 135/220 (61.36%), Query Frame = 1
Query:  958 FLTFDLHILSSVKDKNHLCPMFSVQGIDSTLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYLHSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELLQVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRIESVEMFVETMKKTKHHLIIDHSMFLNGFPDMIFAWCTLCWENKLTAKVFN 1617
            F+    HILS+V D N++ PMF + GID +L+ ++  FR E+ +   E   LYNEI R+L+Q++ GL +LH   PP NHYDLT++SIG+N++   IKLSS+S +T+V ++Y   + + + +++HLP++ILE+ S+  Y++ +D+YCLGT+LY  W G  P    I   +I +++  V+ +        +    F + F   +   C +CW+++   +  N
Sbjct:  803 FMKIRFHILSNVGDPNYVYPMFIINGIDCSLRKYIDDFRSEIPRQSDE--CLYNEICRILKQVLYGLEFLHEQTPPSNHYDLTIDSIGYNSTQNAIKLSSISNETKVLVDYKQTTTKYVEEMSHLPLKILEENSEVKYSKTTDIYCLGTILYYEWVGTLPLFKEILDKQINTIKKLVDYLHLHNIQSGVLSGCFKSNFGSKMLKACKMCWKDQTMIRDLN 1020          
The following BLAST results are available for this feature:
BLAST of Kinase-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTN3.862e-627.06titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN3.862e-627.06titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN3.862e-627.06titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN3.868e-627.06titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN3.902e-627.06titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnk-13.896e-727.52Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-13.897e-727.52Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-13.897e-727.52Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-14.064e-727.52Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-14.064e-727.52Serine/threonine-protein kinase WNK [Source:UniPr... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wnk4b2.416e-625.48WNK lysine deficient protein kinase 4b [Source:ZFI... [more]
CABZ01069040.16.183e-624.65pep chromosome:GRCz11:12:3652015:3705862:-1 gene:E... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ripk22.969e-628.21receptor (TNFRSF)-interacting serine-threonine kin... [more]
Ripk27.277e-628.21receptor (TNFRSF)-interacting serine-threonine kin... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|X5M5N0|WNK_CAEEL5.235e-627.52Serine/threonine-protein kinase WNK OS=Caenorhabdi... [more]
sp|Q01577|PKPA_PHYB85.798e-627.94Serine/threonine-protein kinase pkpA OS=Phycomyces... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2N0PP961.505e-929.44Kinase-like protein OS=Rhizophagus irregularis OX=... [more]
A0A1S3KAU94.063e-930.66uncharacterized protein LOC106180054 OS=Lingula un... [more]
A0A2Z6QAJ57.518e-930.82Protein kinase domain-containing protein OS=Rhizop... [more]
A0A2P4Q2447.693e-930.82Kinase-like domain-containing protein OS=Rhizophag... [more]
A0A1S3JCR27.855e-929.69uncharacterized protein LOC106171979 OS=Lingula un... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wnk4b2.077e-625.48serine/threonine-protein kinase WNK4-like [Source:... [more]
ENSAMXT00000021454.22.674e-624.84pep primary_assembly:Astyanax_mexicanus-2.0:4:1775... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002463.12.304e-626.40pep scaffold:Pmarinus_7.0:GL476400:5068:120393:-1 ... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
wnk4b1.482e-626.11WNK lysine deficient protein kinase 4 [Source:NCBI... [more]
wnk4b1.515e-626.11WNK lysine deficient protein kinase 4 [Source:NCBI... [more]
ENSORLT00000027269.16.203e-624.84pep primary_assembly:ASM223467v1:8:129429:156272:1... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000010252.11.554e-17599.21SMESG000010252.1[more]
SMESG000010251.14.949e-4336.36SMESG000010251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019830 ID=SMED30019830|Name=Kinase-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1774bp
TAATATTTCTGGTATTAGTTATATGGCAAGGTCATGTCAATTCAATAAAA
TAAAATTTATTAGTTGGCAGTGGGGTACTGAGCAATATTTGAAAATACAT
CTTTTTTCAACTTTTCTTCTGTTTTGTTTTTCTTCAAAAGTTCGGTGAAA
TATCACTAATATTTACGAGCATTCTAATACTCAGGAGACTTTTTTTACGG
ATGGATAACTATATCAGATTTTTGCAAGTCTTAATAAATTTTAAGGTGAT
CTGTGTTTTAATATAATATTAATGTGTCTTACTATGACTTTCCTCGGTGC
GTAAGCCAGGATATCTATCAGTTTAAGTGTTACTAAATATGAATTAGCGC
AAATGTGATTTATGGTGTCATTTTGACCATTAACCCTTGTAGTGCCAACA
TAATATTTAAAAACTTCCAAAAAATGCCAACAATCAAGAACCAATACGAA
TGAACCAGAGATCAGACTAGGTTGTGCAGATACAGGAGCGCGATCGTGCT
CCTGGGCGCTTTAATGGTTAAAACATAAAATTTGAATATCACGGTTCATG
ATAAGTAACGAGTAGCTATAATAATATAAATATTTCTCACAGTATTCAGT
CGACTTCAAAACCTTGTCTAGGCGTCTTCAATTCCTTTTATTATTCTAGG
AGTAACTGAGTAGGCGACTGTCACGACGTACCCGGATATGGAATTTAGTA
TTCAGGTACCTTTCCACAAAATATAAATCAAATCTCAATCAACTGGCAAC
CCCAAGGTGCTCGAAATCGGTATTCTGGTAAGGGATTCTGAGACAGCCAC
GTTTGAGGGAGTCACAACCCTTATTTATTATTTAATGACTACATTGTAAA
TATTTAAACTAATAGTTTAAATTATTAATTTTATAAAATTAAATTTATAT
TTCAGTGAAATTCTCTTAGGTGATCATGATAAAAACAATTCCGACTATTT
GAAACACTTCCTTACGTTTGATTTGCATATTTTGTCATCTGTCAAAGACA
AGAATCATTTGTGTCCGATGTTTTCTGTCCAAGGAATAGATTCAACTCTG
AAAGATCACATGGGCAGCTTCAGAGAAGAAGTTTCAAAGCTAGAGGTTGA
AAATAACAGTTTATATAATGAAATCGTACGACTGTTGGAACAGATTATAA
ATGGACTAATTTATTTACACAGCCATAACCCACCTCTTAATCATTATGAT
TTAACATTGGAATCTATTGGATTTAACACCAGCACAGCGGAAATCAAGTT
GTCATCGGTCTCCGTTAAGACGCAGGTGGAAATAAATTATTCATTCGAAT
CCAAAGAAGAATTATTACAAGTCACTCATTTACCAATAGAGATTCTAGAA
AAAGGTTCCAAAGAATTATATACCGAAGCATCGGATATGTACTGTTTAGG
CACGGTTCTCTACCGTTTATGGACCGGAATTGATCCGTTTGCAAATGTCA
TAGAATCCTCTAGAATTGAATCTGTGGAAATGTTTGTTGAAACCATGAAG
AAAACCAAGCATCACCTAATCATTGACCATTCCATGTTTCTTAATGGATT
TCCCGATATGATTTTTGCATGGTGCACATTGTGCTGGGAAAACAAACTGA
CTGCAAAAGTGTTTAATGAATATTTGCGTAAAACAACATTTTACGGAGCA
ATTAAAGATTGAAACTCCTTGATACATTAAATTAAATTGCTATTTTTTTG
AATTCTTCAGAATGATTGATAGAGAACAAATTCAAAAGGATTCCTTGAAT
GTTTTATTAAAGTTTATGGACGCT
back to top

protein sequence of SMED30019830-orf-1

>SMED30019830-orf-1 ID=SMED30019830-orf-1|Name=SMED30019830-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=215bp
MFSVQGIDSTLKDHMGSFREEVSKLEVENNSLYNEIVRLLEQIINGLIYL
HSHNPPLNHYDLTLESIGFNTSTAEIKLSSVSVKTQVEINYSFESKEELL
QVTHLPIEILEKGSKELYTEASDMYCLGTVLYRLWTGIDPFANVIESSRI
ESVEMFVETMKKTKHHLIIDHSMFLNGFPDMIFAWCTLCWENKLTAKVFN
EYLRKTTFYGAIKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004674protein serine/threonine kinase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 15..42
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 16..205
e-value: 3.1E-18
score: 67.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 34..165
e-value: 7.2E-11
score: 41.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 1..214
score: 15.397
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 34..164