Peptidase M60 domain-containing protein

Overview
NamePeptidase M60 domain-containing protein
Smed IDSMED30019829
Length (bp)504
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019829

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30019829SMESG000026377.1 SmedASXL_017423SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30019829SMESG000026355.1 SMESG000026354.1 SmedASXL_017424SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30019829SMESG000026355.1 SMESG000026354.1 SmedASXL_017424SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019829SMESG000026355.1 SMESG000026354.1 dd_Smed_v4_9120_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019829SMESG000026355.1 SMESG000026354.1 dd_Smed_v4_9120_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30019829SMESG000026355.1 SMESG000026354.1 Contig49803newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30019829SMESG000026355.1 SMESG000026354.1 Contig49803uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: R7UHN9 (Peptidase M60 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_195748 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 8.370e-13
Identity = 34/101 (33.66%), Postives = 61/101 (60.40%), Query Frame = 1
Query:   43 GSFMLKFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIP 345
            G++   FR+Y  ++++Q+  ++DEKI+LWI   +E  G NLC L+  W + I       L++L +FLP D +T  V +R+ +++++F G    + T L +P
Sbjct:  607 GTYKAVFRKYEVMSNEQKPKTDDEKIRLWITTFAECCGQNLCALFRFWGFTIPNDLQRNLAELPLFLPMDEMTLFVPERIAKVVAEFDGEGGCMDT-LPLP 706          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: V4A0M8 (Peptidase M60 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_165593 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.348e-12
Identity = 37/100 (37.00%), Postives = 55/100 (55.00%), Query Frame = 1
Query:   43 GSFMLKFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTI 342
            G F   FRRY  +        E+++I LW  + SE+S +NL  L + W+ P+S K   E+SK Q FLPDD + +M  +R   I++K+    + LR P  I
Sbjct:  836 GVFKEVFRRYGRMNPSSYPNKENDQIDLWYTLLSEVSQLNLASLVDFWKIPLSDKARREMSKFQPFLPDDDVMRMAPERTHMILAKY--HSNCLRQPAYI 933          

HSP 2 Score: 26.5646 bits (57), Expect = 1.348e-12
Identity = 10/20 (50.00%), Postives = 14/20 (70.00%), Query Frame = 3
Query:    3 ALCIYAQIKNYFGWEFYAQV 62
            AL IYAQI ++ GW  + +V
Sbjct:  822 ALFIYAQIAHHLGWGVFKEV 841          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: V4BHI6 (Peptidase M60 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_126693 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.601e-10
Identity = 32/90 (35.56%), Postives = 45/90 (50.00%), Query Frame = 1
Query:   43 GSFMLKFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGA 312
            G +   FR+Y  +           KI  W    SEI+G NL PL + WR P+S    N L++   FLPDD +T++  +RV EI   + G 
Sbjct:  308 GLYKSIFRKYRLMNQSAIPHHNVTKIDFWFTSLSEIAGYNLAPLCDFWRIPLSTAVRNHLTQFPPFLPDDEVTRLAPQRVREICEFYHGV 397          

HSP 2 Score: 28.4906 bits (62), Expect = 1.601e-10
Identity = 11/20 (55.00%), Postives = 14/20 (70.00%), Query Frame = 3
Query:    3 ALCIYAQIKNYFGWEFYAQV 62
            AL IYAQ+ N+FGW  Y  +
Sbjct:  294 ALFIYAQLANHFGWGLYKSI 313          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: C3XPE8 (Peptidase M60 domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_85351 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.267e-10
Identity = 31/81 (38.27%), Postives = 48/81 (59.26%), Query Frame = 1
Query:   61 FRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKF 303
            FR+Y     K++  +  E+I LWI   SE  G NL PL++ W +P  ++   ++S L+ FLPDD LT +  +R+ EI  K+
Sbjct:  592 FRQYEKDPKKKQPENNKERIVLWIVRFSEEVGRNLVPLFDFWGFPHIEEAQAQVSGLEAFLPDDDLTALAPERLAEIRGKY 672          

HSP 2 Score: 31.187 bits (69), Expect = 3.267e-10
Identity = 11/20 (55.00%), Postives = 16/20 (80.00%), Query Frame = 3
Query:    3 ALCIYAQIKNYFGWEFYAQV 62
            AL +YAQ+ ++FGWE Y +V
Sbjct:  572 ALAVYAQLAHHFGWEPYKKV 591          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A4S2LA64 (Peptidase M60 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008812 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 5.332e-10
Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = 1
Query:   88 KQRSISEDEKIQLWIKITSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKS 318
            K+R  SE EK   W+K+    +G N+ P +++W +PIS  T +  +KL  F P D  T   E ++ E+I+K+GG  S
Sbjct:  109 KKRPSSESEKTHFWVKLMCVETGYNMLPFHDMWHFPISGDTKSTCTKLPCFFPQDQHTMSFESKITEVINKYGGNCS 185          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026354.1 (SMESG000026354.1)

HSP 1 Score: 204.527 bits (519), Expect = 3.013e-62
Identity = 108/124 (87.10%), Postives = 114/124 (91.94%), Query Frame = 1
Query:   49 FMLKFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFVIEGAXXXXXXXXLN 420
            F   FRRYN L ++  +IS+++KIQLWIK TSEISGMNLCPLYELWRWPISQKT NELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRF IEGAQIIEEIQILN
Sbjct:  634 FAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTENELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFTIEGAQIIEEIQILN 757          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026355.1 (SMESG000026355.1)

HSP 1 Score: 204.142 bits (518), Expect = 3.282e-61
Identity = 108/124 (87.10%), Postives = 114/124 (91.94%), Query Frame = 1
Query:   49 FMLKFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFVIEGAXXXXXXXXLN 420
            F   FRRYN L ++  +IS+++KIQLWIK TSEISGMNLCPLYELWRWPISQKT NELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRF IEGAQIIEEIQILN
Sbjct:  950 FAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTENELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFAIEGAQIIEEIQILN 1073          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026377.1 (SMESG000026377.1)

HSP 1 Score: 187.193 bits (474), Expect = 3.194e-55
Identity = 89/110 (80.91%), Postives = 97/110 (88.18%), Query Frame = 1
Query:   61 FRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFVIEGA 390
            FRRYN L ++  SIS++EKIQLWIK TSEISGMNLCPLYELW+WPISQKT  ELSKLQMFLPDDFLTKM+EKRVDEIISKFGG  SV RTPLTIPEKIGPL ++F IEG 
Sbjct:  954 FRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPLTIPEKIGPLKHKFSIEGT 1063          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026361.1 (SMESG000026361.1)

HSP 1 Score: 174.866 bits (442), Expect = 6.103e-52
Identity = 90/120 (75.00%), Postives = 102/120 (85.00%), Query Frame = 1
Query:   61 FRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFVIEGAXXXXXXXXLN 420
            FRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELW+WPI+ +T  ELSKL MFLPDDF+TK VEKR+ EII K G   S+ R PL +P K+GP+ N+F +EGA+IIE IQILN
Sbjct:  922 FRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRG---SIFRQPLPVPVKVGPVKNKFTVEGAKIIEHIQILN 1038          

HSP 2 Score: 46.9802 bits (110), Expect = 6.103e-52
Identity = 20/20 (100.00%), Postives = 20/20 (100.00%), Query Frame = 3
Query:    3 ALCIYAQIKNYFGWEFYAQV 62
            ALCIYAQIKNYFGWEFYAQV
Sbjct:  902 ALCIYAQIKNYFGWEFYAQV 921          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026361.1 (SMESG000026361.1)

HSP 1 Score: 174.866 bits (442), Expect = 6.257e-52
Identity = 90/120 (75.00%), Postives = 102/120 (85.00%), Query Frame = 1
Query:   61 FRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWRWPISQKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFVIEGAXXXXXXXXLN 420
            FRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELW+WPI+ +T  ELSKL MFLPDDF+TK VEKR+ EII K G   S+ R PL +P K+GP+ N+F +EGA+IIE IQILN
Sbjct:  914 FRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWKWPITNQTEQELSKLPMFLPDDFVTKSVEKRIKEIICKRG---SIFRQPLPVPVKVGPVKNKFTVEGAKIIEHIQILN 1030          

HSP 2 Score: 46.9802 bits (110), Expect = 6.257e-52
Identity = 20/20 (100.00%), Postives = 20/20 (100.00%), Query Frame = 3
Query:    3 ALCIYAQIKNYFGWEFYAQV 62
            ALCIYAQIKNYFGWEFYAQV
Sbjct:  894 ALCIYAQIKNYFGWEFYAQV 913          
The following BLAST results are available for this feature:
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UHN98.370e-1333.66Peptidase M60 domain-containing protein OS=Capitel... [more]
V4A0M81.348e-1237.00Peptidase M60 domain-containing protein OS=Lottia ... [more]
V4BHI61.601e-1035.56Peptidase M60 domain-containing protein OS=Lottia ... [more]
C3XPE83.267e-1038.27Peptidase M60 domain-containing protein OS=Branchi... [more]
A0A4S2LA645.332e-1037.66Peptidase M60 domain-containing protein OS=Opistho... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026354.13.013e-6287.10SMESG000026354.1[more]
SMESG000026355.13.282e-6187.10SMESG000026355.1[more]
SMESG000026377.13.194e-5580.91SMESG000026377.1[more]
SMESG000026361.16.103e-5275.00SMESG000026361.1[more]
SMESG000026361.16.257e-5275.00SMESG000026361.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019829 ID=SMED30019829|Name=Peptidase M60 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=504bp
TAGCGTTATGCATTTATGCTCAAATAAAAAATTATTTTGGATGGGAGTTT
TATGCTCAAGTTTCGGCGGTATAATGCGCTTACACACAAGCAAAGAAGTA
TTTCTGAAGATGAGAAAATTCAACTTTGGATCAAAATAACCTCTGAAATA
TCCGGAATGAATTTGTGTCCCTTATATGAGCTGTGGAGATGGCCTATTAG
TCAGAAAACTGCAAACGAATTATCCAAACTTCAAATGTTTCTCCCCGATG
ATTTCCTTACCAAAATGGTCGAAAAGAGAGTTGATGAAATAATTTCAAAG
TTTGGTGGAGCAAAATCGGTTCTCCGTACGCCTTTGACAATTCCAGAAAA
AATTGGGCCTTTGACAAATAGATTTGTAATTGAAGGAGCACAAATCATCG
AGGAAATTCAAATATTGAATTGATTAAAACATTTGTGTTTTTAACAATCA
AATGACAAAATTGAAAATTGAAAATAATATAAATGAATATCTTTGCTTTC
TAAA
back to top

protein sequence of SMED30019829-orf-1

>SMED30019829-orf-1 ID=SMED30019829-orf-1|Name=SMED30019829-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
MLKFRRYNALTHKQRSISEDEKIQLWIKITSEISGMNLCPLYELWRWPIS
QKTANELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEK
IGPLTNRFVIEGAQIIEEIQILN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
PLANA:0002089reproductive organ