LIM homeobox transcription factor 1-alpha

Overview
NameLIM homeobox transcription factor 1-alpha
Smed IDSMED30019821
Length (bp)1502
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM homeobox transcription factor 1-alpha (SMED30019821) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM homeobox transcription factor 1-alpha (SMED30019821) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM homeobox transcription factor 1-alpha (SMED30019821) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM homeobox transcription factor 1-alpha (SMED30019821) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019821

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30019821SMESG000039808.1 dd_Smed_v4_14115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019821SMESG000039808.1 dd_Smed_v4_14115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30019821SMESG000039808.1 dd_Smed_v4_14115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019821SMESG000039808.1 dd_Smed_v4_14115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019821SMESG000039808.1 dd_Smed_v4_14115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019821SMESG000039808.1 dd_Smed_v4_14115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1A (LIM homeobox transcription factor 1 alpha [Source:HGNC Symbol;Acc:HGNC:6653])

HSP 1 Score: 128.642 bits (322), Expect = 2.728e-32
Identity = 92/262 (35.11%), Postives = 128/262 (48.85%), Query Frame = 2
Query:  179 PMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKS-HLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            P   CE C   I+D+ +L ++D FWHE CV C  C  PL   C  F  DK+ ++C+ D+ +K  + KC  C   I P++ V++     ++H SCF C  C  +L+ GD +VL K+  ++C                            K     ++ +     SG   D+  + KS H +      +  D                   KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   31 PKSVCEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTC--FYRDKK-LYCKYDY-EKLFAVKCGGCFEAIAPNEFVMRAQKS-VYHLSCFCCCVCERQLQKGDEFVL-KEGQLLCKG-----------------------DYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGTAEEGKDHKRP---------------KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 248          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1A (LIM homeobox transcription factor 1 alpha [Source:HGNC Symbol;Acc:HGNC:6653])

HSP 1 Score: 128.642 bits (322), Expect = 2.728e-32
Identity = 92/262 (35.11%), Postives = 128/262 (48.85%), Query Frame = 2
Query:  179 PMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKS-HLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            P   CE C   I+D+ +L ++D FWHE CV C  C  PL   C  F  DK+ ++C+ D+ +K  + KC  C   I P++ V++     ++H SCF C  C  +L+ GD +VL K+  ++C                            K     ++ +     SG   D+  + KS H +      +  D                   KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   31 PKSVCEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTC--FYRDKK-LYCKYDY-EKLFAVKCGGCFEAIAPNEFVMRAQKS-VYHLSCFCCCVCERQLQKGDEFVL-KEGQLLCKG-----------------------DYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGTAEEGKDHKRP---------------KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 248          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1A (LIM homeobox transcription factor 1 alpha [Source:HGNC Symbol;Acc:HGNC:6653])

HSP 1 Score: 128.642 bits (322), Expect = 2.728e-32
Identity = 92/262 (35.11%), Postives = 128/262 (48.85%), Query Frame = 2
Query:  179 PMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKS-HLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            P   CE C   I+D+ +L ++D FWHE CV C  C  PL   C  F  DK+ ++C+ D+ +K  + KC  C   I P++ V++     ++H SCF C  C  +L+ GD +VL K+  ++C                            K     ++ +     SG   D+  + KS H +      +  D                   KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   31 PKSVCEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTC--FYRDKK-LYCKYDY-EKLFAVKCGGCFEAIAPNEFVMRAQKS-VYHLSCFCCCVCERQLQKGDEFVL-KEGQLLCKG-----------------------DYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGTAEEGKDHKRP---------------KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 248          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1B (LIM homeobox transcription factor 1 beta [Source:HGNC Symbol;Acc:HGNC:6654])

HSP 1 Score: 128.257 bits (321), Expect = 6.469e-32
Identity = 90/267 (33.71%), Postives = 134/267 (50.19%), Query Frame = 2
Query:  164 LIDNIPMP-FCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            L  + P P  CE C  PI D+ ++ +++  WHE C+ C  C   L   CY F+  K  ++C+ D+ +   +      +  I P++ V++  L+ ++H  CF C  C  +LR GD +VL K+  ++C                        E+   +  + + D + +V S    D++  MK      S+             S ++G  P    KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   40 LGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRK--LYCKQDYQQLFAAKCSGCMEK-IAPTEFVMRA-LECVYHLGCFCCCVCERQLRKGDEFVL-KEGQLLCKG--------------------DYEKEKDLLSSVSPDESDSVKSE---DEDGDMKPAKGQGSQSK----------GSGDDGKDPRRP-KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 266          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Match: LMX1B (LIM homeobox transcription factor 1 beta [Source:HGNC Symbol;Acc:HGNC:6654])

HSP 1 Score: 127.872 bits (320), Expect = 6.517e-32
Identity = 90/267 (33.71%), Postives = 134/267 (50.19%), Query Frame = 2
Query:  164 LIDNIPMP-FCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            L  + P P  CE C  PI D+ ++ +++  WHE C+ C  C   L   CY F+  K  ++C+ D+ +   +      +  I P++ V++  L+ ++H  CF C  C  +LR GD +VL K+  ++C                        E+   +  + + D + +V S    D++  MK      S+             S ++G  P    KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   46 LGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRK--LYCKQDYQQLFAAKCSGCMEK-IAPTEFVMRA-LECVYHLGCFCCCVCERQLRKGDEFVL-KEGQLLCKG--------------------DYEKEKDLLSSVSPDESDSVKSE---DEDGDMKPAKGQGSQSK----------GSGDDGKDPRR-PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 272          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: lin-11 (pep chromosome:WBcel235:I:10248256:10255327:1 gene:WBGene00003000.1 transcript:ZC247.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-11)

HSP 1 Score: 105.916 bits (263), Expect = 1.532e-24
Identity = 80/257 (31.13%), Postives = 121/257 (47.08%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C AC  PI+D++V  +  + WH++C+ C  C  P+   C+        I C+TDF ++           L +  DLV +   D +FH  CF+CS C   L +GD+  + +    VC +    AT +S+  S +  V    E N  +    N+D    V     +DD             C +         NS ++      G   PRT +   Q    K AF + PKP+R +RE LA+ETGL++RV+QVWFQN+R+
Sbjct:   68 CAACAQPILDRYVFTVLGKCWHQSCLRCCDCRAPMSMTCFSRDG---LILCKTDFSRRYSQRCAGCDGKL-EKEDLVRRAR-DKVFHIRCFQCSVCQRLLDTGDQLYIMEGNRFVCQSDFQTATKTSTPTSIHRPVSNGSECNSDVEE-DNVDACDEVG----LDDG---------EGDCGK--------DNSDDSNSAKRRG---PRTTIKAKQLETLKNAFAATPKPTRHIREQLAAETGLNMRVIQVWFQNRRS 294          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: mec-3 (Mechanosensory protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P09088])

HSP 1 Score: 99.7525 bits (247), Expect = 5.229e-23
Identity = 76/267 (28.46%), Postives = 123/267 (46.07%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAI--------IDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKR--PRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C  C   I D+++  + +R +HENCV C  C  PL + C+ +K  +  I+C   + K     +C  C+  + P+D+V KL   L+FH  C  CS CG  L  G++ +L  D ++      ++                        N  G I +A+++ S +         ID+++     +        ++    SF +  ++       LKR  PRT +  +Q       F + PKPS+  R  LA ETGLS+RV+QVWFQN+R+
Sbjct:   29 CNCCNEQIYDRYIYRMDNRSYHENCVKCTICESPLAEKCF-WKNGR--IYCSQHYYKDHSIHRCAGCKKGVSPTDMVYKLKAGLVFHVECHCCSLCGRHLSPGEQ-ILVDDTMMTVSCMSHYPPQMDD------------------NAPGAIGSAVDIPSCSTENPIAPYPIDESFSSAFQVKKEVDAYGYNFEHYSFSDFCDDD---SRMLKRRGPRTTIKQNQLDVLNEMFSNTPKPSKHARAKLALETGLSMRVIQVWFQNRRS 270          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: mec-3 (Mechanosensory protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P09088])

HSP 1 Score: 92.0485 bits (227), Expect = 1.929e-20
Identity = 75/278 (26.98%), Postives = 127/278 (45.68%), Query Frame = 2
Query:  158 LKLIDNIPMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAI--------IDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKR--PRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            ++++++ P+       + I   H   + +R +HENCV C  C  PL + C+ +K  +  I+C   + K     +C  C+  + P+D+V KL   L+FH  C  CS CG  L  G++ +L  D ++      ++                        N  G I +A+++ S +         ID+++     +        ++    SF +  ++       LKR  PRT +  +Q       F + PKPS+  R  LA ETGLS+RV+QVWFQN+R+
Sbjct:    1 MEMLESKPLSAISMVIDSIGVDHENQMDNRSYHENCVKCTICESPLAEKCF-WKNGR--IYCSQHYYKDHSIHRCAGCKKGVSPTDMVYKLKAGLVFHVECHCCSLCGRHLSPGEQ-ILVDDTMMTVSCMSHYPPQMDD------------------NAPGAIGSAVDIPSCSTENPIAPYPIDESFSSAFQVKKEVDAYGYNFEHYSFSDFCDDD---SRMLKRRGPRTTIKQNQLDVLNEMFSNTPKPSKHARAKLALETGLSMRVIQVWFQNRRS 253          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: lim-6 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G4RV72])

HSP 1 Score: 91.6633 bits (226), Expect = 3.591e-20
Identity = 42/53 (79.25%), Postives = 47/53 (88.68%), Query Frame = 2
Query:  803 KRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            KRPRTILN  QRR+FK AF+ + KPSRK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:  187 KRPRTILNAQQRRQFKTAFERSSKPSRKVREQLANETGLSVRVVQVWFQNQRA 239          

HSP 2 Score: 51.2174 bits (121), Expect = 7.216e-7
Identity = 29/109 (26.61%), Postives = 51/109 (46.79%), Query Frame = 2
Query:  188 FCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDI--CYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRY 508
             C  CG  I D+++  + +  +HE+C+ C+CC + L     C+    +   I+C  D          +   +L+ P+D+V ++H  + +H  CF C  C      GD Y
Sbjct:   41 LCSGCGCLIKDRYIYRVMEDSYHESCLRCSCCQLSLSSFKKCFSRHGN---IYCEHDHQMLYGKRCRRCMTLLL-PTDIVHRVHF-MYYHAQCFSCCSCQRPFNLGDEY 144          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Match: mec-3 (Mechanosensory protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P09088])

HSP 1 Score: 90.5077 bits (223), Expect = 5.196e-20
Identity = 72/252 (28.57%), Postives = 116/252 (46.03%), Query Frame = 2
Query:  236 ISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAI--------IDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKR--PRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            + +R +HENCV C  C  PL + C+ +K  +  I+C   + K     +C  C+  + P+D+V KL   L+FH  C  CS CG  L  G++ +L  D ++      ++                        N  G I +A+++ S +         ID+++     +        ++    SF +  ++       LKR  PRT +  +Q       F + PKPS+  R  LA ETGLS+RV+QVWFQN+R+
Sbjct:    1 MDNRSYHENCVKCTICESPLAEKCF-WKNGR--IYCSQHYYKDHSIHRCAGCKKGVSPTDMVYKLKAGLVFHVECHCCSLCGRHLSPGEQ-ILVDDTMMTVSCMSHYPPQMDD------------------NAPGAIGSAVDIPSCSTENPIAPYPIDESFSSAFQVKKEVDAYGYNFEHYSFSDFCDDD---SRMLKRRGPRTTIKQNQLDVLNEMFSNTPKPSKHARAKLALETGLSMRVIQVWFQNRRS 227          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lmx1a (gene:FBgn0052105 transcript:FBtr0075953)

HSP 1 Score: 120.939 bits (302), Expect = 8.500e-29
Identity = 79/262 (30.15%), Postives = 120/262 (45.80%), Query Frame = 2
Query:  188 FCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAI-IDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRP---RTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
             CE CG  I D+ ++ + D  WHE C+ C  CG+ L   CY        ++C+ D+ +         C  ++ P +LV++   + +FH  CF C  C + L+ G++++L    +     FCY                      H + +   +  A     G + +D+  +++                            P  G + P   RTIL   QR++FKA+FD +PKP RK+RE LA +TGLSVRVVQVWFQNQRA
Sbjct:  274 LCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQLHHTCY---VRNSKLYCKMDYDRLFGVKCSSCCHAIL-PQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQL-----FCYR---------------------HDLEKEMFLAAAAAQHCGFVGLDEEDLLR----------------------------PRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRA 477          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lmx1a (gene:FBgn0052105 transcript:FBtr0333837)

HSP 1 Score: 120.553 bits (301), Expect = 9.288e-29
Identity = 79/262 (30.15%), Postives = 120/262 (45.80%), Query Frame = 2
Query:  188 FCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAI-IDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRP---RTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
             CE CG  I D+ ++ + D  WHE C+ C  CG+ L   CY        ++C+ D+ +         C  ++ P +LV++   + +FH  CF C  C + L+ G++++L    +     FCY                      H + +   +  A     G + +D+  +++                            P  G + P   RTIL   QR++FKA+FD +PKP RK+RE LA +TGLSVRVVQVWFQNQRA
Sbjct:  273 LCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQLHHTCY---VRNSKLYCKMDYDRLFGVKCSSCCHAIL-PQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQL-----FCYR---------------------HDLEKEMFLAAAAAQHCGFVGLDEEDLLR----------------------------PRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRA 476          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Lim1 (gene:FBgn0026411 transcript:FBtr0071279)

HSP 1 Score: 111.694 bits (278), Expect = 5.311e-26
Identity = 86/281 (30.60%), Postives = 133/281 (47.33%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGD--------RYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNID----NAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGM------------CPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C  C  PI+DK +L + +R WH +CV C  C  PL D C+   + +  ++CR DF ++  +      Q  I PSDLV K   D +FH +CF C  C  +L +G+        +++   DY++     C H + S S+  + S      +  H    A  +     N  +   G +   +  ++S +S +S+ N   D     L+   +G               G   + PRT +   Q    K AF+  PKP+R +RE LA ETGL +RV+QVWFQN+R+
Sbjct:   27 CAGCNKPILDKFLLNVLERAWHASCVRCCECLQPLTDKCF---SRESKLYCRNDFFRRYGTKCSGCGQG-IAPSDLVRKPR-DKVFHLNCFTCCICRKQLSTGEQLYVLDDNKFICKDDYLLGKAPSCGHNSLSDSLMGSASEDDDDDDPPHLRATALGLGVLGPNGPDSAGGPLGTSDISVQS-MSTDSK-NTHDDSDQGSLDGDPDGRGDSQAENKSPDDANGSKRRGPRTTIKAKQLEVLKTAFNQTPKPTRHIREQLAKETGLPMRVIQVWFQNKRS 300          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: CG4328 (gene:FBgn0036274 transcript:FBtr0301071)

HSP 1 Score: 90.8929 bits (224), Expect = 4.638e-19
Identity = 40/54 (74.07%), Postives = 47/54 (87.04%), Query Frame = 2
Query:  797 GLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQR 958
            G KRPRTILN  QRR FKA+F+ +PKP RK+RENLA +TGLS+R+VQVWFQNQR
Sbjct:  340 GPKRPRTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQNQR 393          

HSP 2 Score: 68.5514 bits (166), Expect = 5.120e-12
Identity = 34/110 (30.91%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTK 520
            C  C  PI D++++ + +  +HE C+ C  C + L+  CY   A +  ++CR D+ +    + C  C + I   +LV++ H + +FH  CF C  CG  L+ G++YV+ +
Sbjct:  199 CAHCCQPICDRYIMRVVENSFHEGCLKCTACSLHLVHSCY---AREGKLYCRVDYERLYIRNHCLGCGLKIAADELVMRCHEN-VFHLKCFACVVCGALLKKGEQYVVKQ 304          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Match: Awh (gene:FBgn0013751 transcript:FBtr0073155)

HSP 1 Score: 80.8777 bits (198), Expect = 3.854e-17
Identity = 73/257 (28.40%), Postives = 103/257 (40.08%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C ACG PI D+  L +    WH +C+ C  C  PL      F  ++Q ++C+ D+  K   +KC  C   I  SD V +   +L+FH +CF C QCG +L +G+++ L  D V+ C A                    Y+E          ++     +      D Y    H S   R                            RT     Q +  +A F  +  P  +  E +AS TGLS RV QVWFQN RA
Sbjct:    8 CAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQ-VYCKADY-SKNFGAKCSKCCRGISASDWVRRAR-ELVFHLACFACDQCGRQLSTGEQFALMDDRVL-CKAH-------------------YLE---------TVEGGTTSSDEGCDGDGY----HKSKTKR---------------------------VRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRA 201          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lhx1b (LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-116])

HSP 1 Score: 120.553 bits (301), Expect = 1.796e-29
Identity = 82/265 (30.94%), Postives = 123/265 (46.42%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSP-----NSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            M  C  C  PI+D+ +L + DR WH  CV C  C   L D C+  +     ++C+ DF ++  +         I PSDLV K     +FH +CF C  C  +L +G+   +  +Y  VC                        ++++  N  G   N +++T+     D  +      P     +S     SD  T   N+ N+    GG  + PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    1 MVHCAGCERPILDRFLLSVLDRAWHAKCVQCCDCKCSLTDRCFSREG---RLYCKNDFFRRYGTKCGGCA-QGISPSDLVRKAR-SKVFHLNCFTCIMCNKQLSTGEELYILDEYKFVC------------------------KEDYLNNSNGKDTNLLSITT---CSDPSLSPESQDPQDDYKDSESGPMSDKET--CNNENDEQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 231          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lhx1b (LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-116])

HSP 1 Score: 120.553 bits (301), Expect = 1.796e-29
Identity = 82/265 (30.94%), Postives = 123/265 (46.42%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSP-----NSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            M  C  C  PI+D+ +L + DR WH  CV C  C   L D C+  +     ++C+ DF ++  +         I PSDLV K     +FH +CF C  C  +L +G+   +  +Y  VC                        ++++  N  G   N +++T+     D  +      P     +S     SD  T   N+ N+    GG  + PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    1 MVHCAGCERPILDRFLLSVLDRAWHAKCVQCCDCKCSLTDRCFSREG---RLYCKNDFFRRYGTKCGGCA-QGISPSDLVRKAR-SKVFHLNCFTCIMCNKQLSTGEELYILDEYKFVC------------------------KEDYLNNSNGKDTNLLSITT---CSDPSLSPESQDPQDDYKDSESGPMSDKET--CNNENDEQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 231          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lhx1a (LIM homeobox 1a [Source:NCBI gene;Acc:30463])

HSP 1 Score: 110.923 bits (276), Expect = 4.255e-26
Identity = 78/263 (29.66%), Postives = 123/263 (46.77%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTS---GAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            M  C  C  PI+D+ +L + DR WH  CV C  C   L + C+  +     ++C+ DF ++  +      Q  I P+DLV +     +FH +CF C  C  +L +G+   +  +   VC                        + ++  N  G   N ++VT+    ++  D+         ++     SD  T   N+ N+    GG  + PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    1 MVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKCNLTEKCFSREGK---LYCKNDFFRRFGTKCAGCAQG-ISPNDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVC------------------------KDDYLSNTNGKDSNLLSVTACSDPSLSPDSQDQLQDDVKDAEIANLSDKETG--NNENDDQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 232          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lhx5 (LIM homeobox 5 [Source:NCBI gene;Acc:30465])

HSP 1 Score: 100.523 bits (249), Expect = 1.673e-22
Identity = 76/260 (29.23%), Postives = 119/260 (45.77%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            M  C  C  PI+D+ +L + DR WH  CV C  C   L + C  F  D + ++C+ DF ++  +      Q  I PSDLV +     +FH +CF C  C  +L +G+   +  +   VC      A+    +                     N+++  + T  ++  D        +  +  +  SD  T+   +     C     + PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    2 MVHCAGCERPILDRFLLNVLDRAWHAKCVQCCECNCNLTEKC--FSRDGK-LYCKIDFFRRFGTKCAGCLQG-ISPSDLVRRAR-SKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKEDYLSASAIKEV---------------------NLNSVSSCTDRSLSPDLPDQIQDDTKETDNSTSSDKDTNNNENEEQNSC--TKRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 233          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Match: lhx2a (LIM homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-091118-109])

HSP 1 Score: 94.3597 bits (233), Expect = 7.812e-21
Identity = 79/272 (29.04%), Postives = 124/272 (45.59%), Query Frame = 2
Query:  185 PFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLID--ICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIV-------CVAFCYHATGXXXXXXXXXXVLLYIEQN----HKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            P C  CG  I D+  LL ++R WHE C+ C+ C   L     C+    D   I+C+ D+ ++  S +C  C + I  +++V++   DL++H SCF C+ C   L +GD Y + +  V         C A  Y++  SS   ++ S+   Y E++     ++ R  N   A ++   + + D   +   LS    C +                      KR RT     Q R  ++ F  N  P  K  + LA +TGL+ RV+QVWFQN RA
Sbjct:   11 PVCAGCGALISDRFYLLAAERRWHERCLKCSACQTDLESELTCFSKHGD---IYCKEDYYRRFSSQRCARCHLGISATEIVMRAR-DLVYHLSCFSCATCHKVLLTGDHYGMKETSVYCRAHIQRECHADLYYSDMSSRETNSESHT--YDEESPVHRARVRRRKNNSTADHIAYSSDVSD---LGVDLSERVSCQK---------------------SKRMRTSFKHHQLRSMQSFFTHNHNPDAKDLKELAQKTGLTKRVLQVWFQNARA 252          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: dcp1b (decapping mRNA 1B [Source:Xenbase;Acc:XB-GENE-877165])

HSP 1 Score: 127.872 bits (320), Expect = 4.430e-32
Identity = 85/258 (32.95%), Postives = 130/258 (50.39%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVT-SGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C  CGN I D+ +L ++DR WHE CV C  C   L   CY      + ++C+ D+ K   +      + ++ PS+L++++ L  ++H +CF C +C  +L  GD +VL K+  ++C +                             R   + +A+++T SG++  ++                 +   S     + G  P    KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGL+VRVVQVWFQNQRA
Sbjct:   27 CAGCGNTISDRFLLRVNDRSWHECCVKCAACLQILSGTCY---YRNRQLYCKEDYDKLFATKCNSCLKTVL-PSELIMRV-LSNVYHVACFFCCECERRLERGDEFVL-KEGQLLCRS--------------------------DYEREKEMLSALSLTPSGSVKSED-----------------EDGASLQGKSDEGKDPKRS-KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLTVRVVQVWFQNQRA 234          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: LMX1A (LIM homeobox transcription factor 1 alpha [Source:NCBI gene;Acc:100492433])

HSP 1 Score: 121.709 bits (304), Expect = 7.961e-30
Identity = 92/260 (35.38%), Postives = 126/260 (48.46%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKR---PRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            CE C   I D+ +L ISD  WHE C  C  C  PL   C  F  DK+ ++CR D+ K             I PS+ V++   + ++H  CF C  C  +L+ GD +VL KD  ++C                        + +++  R     + +++ S A  D     KS    ++   +F D         + G   G   KR   PRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   35 CEGCERVICDRFLLRISDSLWHEQCAQCCTCKEPLESSC--FYRDKK-LYCRNDYEKLFAVKCGTCLDT-ITPSEFVMRAQKN-VYHLGCFCCCVCDRQLQKGDEFVL-KDGQLLC------------------------KSDYERER-----DLLSLVSPAASDSG---KSEDEDDA--GKFDD---------SKGPEDGKDQKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 245          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: klf2 (Kruppel-like factor 2 [Source:Xenbase;Acc:XB-GENE-485035])

HSP 1 Score: 112.849 bits (281), Expect = 1.363e-26
Identity = 81/260 (31.15%), Postives = 126/260 (48.46%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            M  C  C  PI+D+ +L + DR WH  CV C  C   L + C+  +     ++C+TDF  ++  +KC  C + I PSDLV K   + +FH +CF C  C  +L +G+   +  +   VC      A+               ++++   + +   D +++      I D      H       +  SD  T+  N+ N     G   + PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    2 MVHCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGK---LYCKTDFF-RRFGTKCAGCSLGISPSDLVRKAR-NKVFHLNCFTCMVCNKQLSTGEELYIIDENKFVCKEDYASASS--------------LKESSLNSVSSCTDRSLSPDLQDPIQDESKETDH-------STSSDKETA--NNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 233          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: gfm2 (G elongation factor, mitochondrial 2 [Source:Xenbase;Acc:XB-GENE-1002407])

HSP 1 Score: 108.997 bits (271), Expect = 3.070e-25
Identity = 77/261 (29.50%), Postives = 118/261 (45.21%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDR-YVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            M  C  C  PI+D+ +L + DR WH  CV C  C   L + C+  +     ++C+ DF ++  +      Q  I PSDLV +     +FH +CF C  C  +L +G+  Y++ ++  + C  F    +         S+  L  E    +      D+A +  S  I D    +                        N+    G   + PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    1 MVHCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGK---LYCKNDFFRRFGTKCAGCAQG-ISPSDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVYCKLFWAGPSSPLVSVIDCSDPSLSPESQDPLQ-----DDAKDSESANISDKEAGVNE----------------------NDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 229          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Match: gfm2 (G elongation factor, mitochondrial 2 [Source:Xenbase;Acc:XB-GENE-1002407])

HSP 1 Score: 107.457 bits (267), Expect = 1.136e-24
Identity = 78/260 (30.00%), Postives = 125/260 (48.08%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            M  C  C  PI+D+ +L + DR WH  CV C  C   L + C+  +     ++C+ DF ++  +      Q  I PSDLV +     +FH +CF C  C  +L +G+   +  +   VC              + N+N     ++N  I+  G+ D +++  S   + D+       + +S     SD       + +  +  G   + PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    1 MVHCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGK---LYCKNDFFRRFGTKCAGCAQG-ISPSDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVC---------KEDYLNNNNNNNNAAKENSFISVTGS-DPSLSPESQDPLQDD-------AKDSESANISDKEAGVNENDDQNL--GAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 236          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lmx1b (LIM homeobox transcription factor 1 beta [Source:MGI Symbol;Acc:MGI:1100513])

HSP 1 Score: 127.872 bits (320), Expect = 2.933e-32
Identity = 90/267 (33.71%), Postives = 134/267 (50.19%), Query Frame = 2
Query:  164 LIDNIPMP-FCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            L  + P P  CE C  PI D+ ++ +++  WHE C+ C  C   L   CY F+  K  ++C+ D+ +   +      +  I P++ V++  L+ ++H  CF C  C  +LR GD +VL K+  ++C                        E+   +  + + D + +V S    D++  MK      S+             S ++G  P    KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   23 LGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRK--LYCKQDYQQLFAAKCSGCMEK-IAPTEFVMRA-LECVYHLGCFCCCVCERQLRKGDEFVL-KEGQLLCKG--------------------DYEKEKDLLSSVSPDESDSVKSE---DEDGDMKPAKGQGSQSK----------GSGDDGKDPRRP-KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 249          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lmx1b (LIM homeobox transcription factor 1 beta [Source:MGI Symbol;Acc:MGI:1100513])

HSP 1 Score: 127.872 bits (320), Expect = 3.423e-32
Identity = 90/267 (33.71%), Postives = 134/267 (50.19%), Query Frame = 2
Query:  164 LIDNIPMP-FCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            L  + P P  CE C  PI D+ ++ +++  WHE C+ C  C   L   CY F+  K  ++C+ D+ +   +      +  I P++ V++  L+ ++H  CF C  C  +LR GD +VL K+  ++C                        E+   +  + + D + +V S    D++  MK      S+             S ++G  P    KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   13 LGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRK--LYCKQDYQQLFAAKCSGCMEK-IAPTEFVMRA-LECVYHLGCFCCCVCERQLRKGDEFVL-KEGQLLCKG--------------------DYEKEKDLLSSVSPDESDSVKS---EDEDGDMKPAKGQGSQSK----------GSGDDGKDPRR-PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 239          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lmx1a (LIM homeobox transcription factor 1 alpha [Source:MGI Symbol;Acc:MGI:1888519])

HSP 1 Score: 123.635 bits (309), Expect = 1.120e-30
Identity = 95/283 (33.57%), Postives = 131/283 (46.29%), Query Frame = 2
Query:  113 RNFPYKIELL*NDSDLKLIDNIPMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
             NF   IE   + S L      P   CE C   I D+ +L ++D FWHE CV C  C  PL   C  F  DK+ ++C+  + +K  + KC  C   I P++ V++     ++H SCF C  C  +L+ GD +VL K+  ++C                   + L         ++ + ++      GA    +   K H  P                            KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:    9 ENFQSAIETSASFSSLLGRAVSPKSVCEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTC--FYRDKK-LYCKYHY-EKLFAVKCGGCFEAIAPNEFVMRAQKS-VYHLSCFCCCVCERQLQKGDEFVL-KEGQLLCKG---------DYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGASEDGKDHKRP----------------------------KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 248          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lmx1a (LIM homeobox transcription factor 1 alpha [Source:MGI Symbol;Acc:MGI:1888519])

HSP 1 Score: 123.635 bits (309), Expect = 1.120e-30
Identity = 95/283 (33.57%), Postives = 131/283 (46.29%), Query Frame = 2
Query:  113 RNFPYKIELL*NDSDLKLIDNIPMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
             NF   IE   + S L      P   CE C   I D+ +L ++D FWHE CV C  C  PL   C  F  DK+ ++C+  + +K  + KC  C   I P++ V++     ++H SCF C  C  +L+ GD +VL K+  ++C                   + L         ++ + ++      GA    +   K H  P                            KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:    9 ENFQSAIETSASFSSLLGRAVSPKSVCEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTC--FYRDKK-LYCKYHY-EKLFAVKCGGCFEAIAPNEFVMRAQKS-VYHLSCFCCCVCERQLQKGDEFVL-KEGQLLCKG---------DYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGASEDGKDHKRP----------------------------KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 248          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Match: Lhx1 (LIM homeobox protein 1 [Source:MGI Symbol;Acc:MGI:99783])

HSP 1 Score: 108.612 bits (270), Expect = 3.277e-25
Identity = 75/260 (28.85%), Postives = 120/260 (46.15%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            M  C  C  PI+D+ +L + DR WH  CV C  C   L + C+  +     ++C+ DF +   +      Q  I PSDLV +     +FH +CF C  C  +L +G+   +  +   VC                      Y+  N  + +  ++ +A   +  ++  D+       + +S     SD      ++ N+    G   + PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    1 MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGK---LYCKNDFFRCFGTKCAGCAQG-ISPSDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKE-------------------DYL-SNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGG--SNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 233          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|Q8TE12|LMX1A_HUMAN (LIM homeobox transcription factor 1-alpha OS=Homo sapiens OX=9606 GN=LMX1A PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.310e-31
Identity = 92/262 (35.11%), Postives = 128/262 (48.85%), Query Frame = 2
Query:  179 PMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKS-HLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            P   CE C   I+D+ +L ++D FWHE CV C  C  PL   C  F  DK+ ++C+ D+ +K  + KC  C   I P++ V++     ++H SCF C  C  +L+ GD +VL K+  ++C                            K     ++ +     SG   D+  + KS H +      +  D                   KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   31 PKSVCEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTC--FYRDKK-LYCKYDY-EKLFAVKCGGCFEAIAPNEFVMRAQKS-VYHLSCFCCCVCERQLQKGDEFVL-KEGQLLCKG-----------------------DYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGTAEEGKDHKRP---------------KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 248          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|O88609|LMX1B_MOUSE (LIM homeobox transcription factor 1-beta OS=Mus musculus OX=10090 GN=Lmx1b PE=1 SV=3)

HSP 1 Score: 127.872 bits (320), Expect = 3.130e-31
Identity = 90/267 (33.71%), Postives = 134/267 (50.19%), Query Frame = 2
Query:  164 LIDNIPMP-FCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            L  + P P  CE C  PI D+ ++ +++  WHE C+ C  C   L   CY F+  K  ++C+ D+ +   +      +  I P++ V++  L+ ++H  CF C  C  +LR GD +VL K+  ++C                        E+   +  + + D + +V S    D++  MK      S+             S ++G  P    KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   46 LGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRK--LYCKQDYQQLFAAKCSGCMEK-IAPTEFVMRA-LECVYHLGCFCCCVCERQLRKGDEFVL-KEGQLLCKG--------------------DYEKEKDLLSSVSPDESDSVKSE---DEDGDMKPAKGQGSQSK----------GSGDDGKDPRR-PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 272          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|O60663|LMX1B_HUMAN (LIM homeobox transcription factor 1-beta OS=Homo sapiens OX=9606 GN=LMX1B PE=1 SV=3)

HSP 1 Score: 127.872 bits (320), Expect = 4.062e-31
Identity = 90/267 (33.71%), Postives = 134/267 (50.19%), Query Frame = 2
Query:  164 LIDNIPMP-FCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            L  + P P  CE C  PI D+ ++ +++  WHE C+ C  C   L   CY F+  K  ++C+ D+ +   +      +  I P++ V++  L+ ++H  CF C  C  +LR GD +VL K+  ++C                        E+   +  + + D + +V S    D++  MK      S+             S ++G  P    KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   46 LGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRK--LYCKQDYQQLFAAKCSGCMEK-IAPTEFVMRA-LECVYHLGCFCCCVCERQLRKGDEFVL-KEGQLLCKG--------------------DYEKEKDLLSSVSPDESDSVKS---EDEDGDMKPAKGQGSQSK----------GSGDDGKDPRR-PKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 272          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|Q60564|LMX1B_MESAU (LIM homeobox transcription factor 1-beta (Fragment) OS=Mesocricetus auratus OX=10036 GN=LMX1B PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.800e-30
Identity = 86/267 (32.21%), Postives = 130/267 (48.69%), Query Frame = 2
Query:  164 LIDNIPMP-FCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            L  + P P  CE C  PI D+ ++ +++  WHE C+ C  C   L   CY F+  K  ++C+ D+ +   +      +  I P++ V++  L+ ++H  CF C  C  +LR GD +VL K+  ++C                                 G+ +   ++ S    D++  +KS    +          +      ++G  P    KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   13 LGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCY-FRDRK--LYCKQDYQQLFAAKCSGCMEK-IAPTEFVMRA-LECVYHLGCFCCCVCERQLRKGDEFVL-KEGQLLC--------------------------------KGDYEKEKDLLSSVSPDESDSVKSE-DEDGDMKPAKGQGSQSKGGGDDGKDPRRP-KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 239          
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Match: sp|Q04650|LMX1A_MESAU (LIM homeobox transcription factor 1-alpha OS=Mesocricetus auratus OX=10036 GN=LMX1A PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 6.311e-30
Identity = 95/283 (33.57%), Postives = 131/283 (46.29%), Query Frame = 2
Query:  113 RNFPYKIELL*NDSDLKLIDNIPMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
             NF   IE   + S L      P   CE C   I D+ +L ++D FWHE CV C  C  PL   C  F  DK+ ++C+  + +K  + KC  C   I P++ V++     ++H SCF C  C  +L+ GD +VL K+  ++C                   + L         ++ + ++      GA    +   K H  P                            KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:    9 ENFQSAIETSASFSSLLGRAVSPKSVCEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTC--FYRDKK-LYCKYHY-EKLFAVKCGGCFEAIAPNEFVMRAQKS-VYHLSCFCCCVCERQLQKGDEFVL-KEGQLLCKG---------DYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGTSEDGKDHKRP----------------------------KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 248          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: A0A210PZJ6 (LIM homeobox transcription factor 1-alpha OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04623 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.139e-35
Identity = 96/258 (37.21%), Postives = 133/258 (51.55%), Query Frame = 2
Query:  188 FCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
             C  C   I D+ +L I D  WHE+CV+C+ C +PL   C+   A  +  +C+ D+ +K     C  C M + PS+LV++     ++H  CF C +CG +L+ GD++V+ +D  + C                    L Y ++ H +                           LSP S      D + S+ +  ++G   G   KRPRTIL  SQRRKFKAAF+ NPKP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:    8 MCAGCQRAIEDRFLLKIMDNSWHEHCVLCSICQMPLTGSCF---ARNRKFYCKLDY-EKMFRVMCNGCGMFVSPSELVMRAQ-GYVYHLQCFMCIECGQQLQKGDQFVV-RDGQLFCR-------------------LDYEKEFHMLP--------------------------LSPKS------DDSESYEDGESDG---GKHPKRPRTILTTSQRRKFKAAFELNPKPCRKVREQLAAETGLSVRVVQVWFQNQRA 205          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: A0A1W4XRF8 (LIM homeobox transcription factor 1-alpha OS=Agrilus planipennis OX=224129 GN=LOC108744208 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 5.969e-33
Identity = 90/254 (35.43%), Postives = 121/254 (47.64%), Query Frame = 2
Query:  200 CGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C  PI D+++L + D F+HE+C+ C  CG  L   CY F+  K  +FC+ D+ +          +  I P +LV+K   D +FH  CF C  CG++L+ GD+YV  +  V     FC                        K +    ++       G    D +   S  S   R                       G KRPRTIL   QRR FKA+F+ +PKPSRK+RENLA +TGLSVR+VQVWFQNQRA
Sbjct:    2 CCRPIHDRYILQVMDVFYHEHCLQCFACGERLYQTCY-FRDSK--LFCKLDYDRIYSKKCLGCSER-ISPEELVMKT-CDSVFHVRCFACVVCGMRLQKGDQYVFKQGQV-----FC------------------------KPDYEKEVEMLQGYNQGDFFCDEFTQSSRSSDGRR-----------------------GPKRPRTILTTQQRRAFKASFEISPKPSRKVRENLAKDTGLSVRIVQVWFQNQRA 198          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: M3ZZA1 (LIM homeobox transcription factor 1, beta a OS=Xiphophorus maculatus OX=8083 PE=4 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 2.071e-32
Identity = 92/264 (34.85%), Postives = 132/264 (50.00%), Query Frame = 2
Query:  170 DNIPMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            D+ P   CE C   I D+ ++ ++  +WH+NC+ C  C  PLI  CY F+  K  +FCR D+ +   +      +  I P++ V++  +  ++H SCF CS C  +L  GD +VL     ++C A            S +S+ L   E     +   ++ +   +T+   IDD+   K  L P                            KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   52 DSPPQAVCEGCSRIISDRFLMRVNGAYWHQNCLQCAACQQPLIATCY-FRDSK--LFCRRDYQRLFSTKCSGCLEK-IAPTEFVMRA-VQSVYHLSCFCCSVCERRLSKGDEFVLKAGQQLLCKADYVKERDLLRTMSPDSSDLEKSE-----DETSDVKSEKFITAEKRIDDS---KDPLRP----------------------------KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 274          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: Q4H388 (transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-Lmx-like PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 4.745e-32
Identity = 86/263 (32.70%), Postives = 133/263 (50.57%), Query Frame = 2
Query:  179 PMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGL--KRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            P   C  C  PI DK+ + +  R WHE CV C+ C  PL++ C  F  D + ++C+ D+ + ++  +C      + P D +++  +   +H  CF C  C  +L+SGD Y++ + Y  +C   C+        +    +     E++   +   + D+        +    +    H  P+      S   +    ++ +G     G   KRPRTIL  +QRRKFKA+F+ + KP RK+RE LASETGLS RVVQVWFQNQRA
Sbjct:   49 PPVLCAGCRQPIYDKYYMWVDQRSWHEECVQCSVCRRPLVESC--FTKDCK-LYCQQDYKQLQRCRRCAG----VIPRDELVRRVIGHPYHVKCFSCDVCHRQLQSGDHYLIDESYNQICCKACH-----DRDDVIFESCFGAGEEDSASDSEKSDDDVFAQPPMHMAGGAHFSPYHGPPHHMGIMRSKNGSKTSPTMQHGSVTSDGKRSKRPRTILTTAQRRKFKASFEVSQKPCRKVRETLASETGLSPRVVQVWFQNQRA 299          
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Match: K1R6C9 (LIM homeobox transcription factor 1-beta OS=Crassostrea gigas OX=29159 GN=CGI_10019450 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 5.121e-32
Identity = 91/257 (35.41%), Postives = 130/257 (50.58%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C +C  PI D+ +L + D  WHE CV+C+ C   L   C  F  ++Q+ +C+ D+ K  + + C  C M + P++ V++     ++H  CF C +CG +LR GD +   KD  + C                                  + +  +N+ +             LSP S      D + S+ +  ++    G   KRPRTIL  SQRRKFK+AF+ NPKP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   10 CASCQYPIEDRFLLRVMDLPWHEQCVVCSVCQTQLTRTC--FHRNRQF-YCKNDYDKLFRRASCNGCGMFVIPTEFVMRAK-GYVYHQQCFNCIECGQQLRQGD-HCAIKDGQLFC--------------------------------GIDFEKEMNMMA-------------LSPRS------DGSDSYEDGESDC---GKHPKRPRTILTTSQRRKFKSAFELNPKPCRKVREQLAAETGLSVRVVQVWFQNQRA 207          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 123.635 bits (309), Expect = 2.691e-31
Identity = 85/263 (32.32%), Postives = 125/263 (47.53%), Query Frame = 2
Query:  179 PMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAIN--VTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            P   C  C  PI D+ +L +++  WHE C+ C  C  PL   CY      + ++C+ D+ +   +      +  I P++ V++  L  ++H  CF C  C  +L  GD +VL KD  ++C                               R  ++ NAI+  ++     D++  +K       + N+ SD +                 KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   27 PQNVCAGCQRPIADRFLLRVNESSWHEECLQCAVCQQPLTMSCY---CRDRKVYCKHDYQRLFATKCSGCLEK-IAPTEFVMRA-LKSVYHLGCFCCCVCERQLCKGDEFVL-KDSQLLC--------------------------KKDYEREKDLLNAISPEMSDSKSEDEDVDVKPEKGSGGQ-NKGSDDSKDSRRP-----------KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 245          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lhx1b (LIM/homeobox protein Lhx1-like [Source:NCBI gene;Acc:103026395])

HSP 1 Score: 119.398 bits (298), Expect = 4.342e-29
Identity = 75/257 (29.18%), Postives = 121/257 (47.08%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C  C  PI+D+ +L + DR WH  CV C  C   L + C+  +     ++CRTDF ++  +        +I P+DLV +   + +FH +CF C  C  +L +G+   + ++   +C                      Y   N  +  +  + +A+   S   +  +         +S   Q SD  T   ++ N+    G   + PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHTKCVQCCDCKCNLTEKCFSREG---RLYCRTDFFRRFGTKCAGCS-QVISPTDLVRRAR-NKVFHLNCFTCIMCNKQLSTGEELYILEESKFLCKED-------------------YFSNNSPLKDSTQL-SAVTACSEPSLSPDPQDVHEDGKDSEAGQLSDKETG--STENDEQTSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 233          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lhx5 (LIM/homeobox protein Lhx5 [Source:NCBI gene;Acc:103047421])

HSP 1 Score: 114.775 bits (286), Expect = 1.558e-27
Identity = 83/265 (31.32%), Postives = 121/265 (45.66%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNN------GMCPGGGLKR--PRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C  C  PI+D+ +L + DR WH  CV C  CG  L + C+  +     ++CR DFI ++  +KC  C   I P DLV +     +FH +CF C+ C  +L +G+   +  +   VC                            K +  G     +N+ S +   D  +      P     + +D +T      NN      G C     KR  PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    4 CAGCARPILDRFLLNVLDRAWHAECVQCCECGRALTERCFSREGK---LYCREDFI-RRFGTKCAGCLQGISPGDLVRRAR-GKVFHLNCFTCAACNKQLSTGEELYVIDENKFVC----------------------------KEDYTGTSIREVNLNSVSSCTDRSLSPDLPEPGPDDTKETDNSTCSDKDTNNNENEEQGAC----QKRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 231          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lhx1a (LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:103025442])

HSP 1 Score: 113.62 bits (283), Expect = 4.831e-27
Identity = 80/269 (29.74%), Postives = 125/269 (46.47%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCP---------GGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            M  C  C  PI+D+ +L + DR WH  CV C  C   L + C+  +     ++C+ DF ++  +      Q  I P+DLV +     +FH +CF C  C  +L +G+   +  +   VC                        + ++  N  G   N ++VT+ +           LSP+S+     D   S + +L++   P         GG  + PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    1 MVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKCNLTEKCFSREGK---LYCKNDFFRRFGTKCAGCAQG-ISPNDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVC------------------------KDDYLSNSNGKDTNLLSVTACS--------DPSLSPDSQDPLQDDVKDSEIAALSDKEAPSNEADDQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 232          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Match: lhx9 (LIM homeobox 9 [Source:NCBI gene;Acc:103038813])

HSP 1 Score: 92.0485 bits (227), Expect = 5.011e-20
Identity = 81/273 (29.67%), Postives = 117/273 (42.86%), Query Frame = 2
Query:  188 FCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAF------CYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSP---------NSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
             C  CG+ I D++ LL  D+ WH  C+ C  C + L      F  D   I+C+ D+ ++    +C  C + I  S++V++   D ++H SCF C+ C   L +GD + + ++ V     F       YHA             L Y E   K    G +  A+   +GA        +   SP         NS CN+        L+       P    KR RT     Q R  K+ F  N  P  K  + LA +TGL+ RV+QVWFQN RA
Sbjct:   29 LCAGCGSKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGS-IYCKEDYYRRFSVQRCARCHLGISASEMVMRAR-DSVYHLSCFTCTSCNKTLTTGDHFGMRENLVYCRAHFESLVQGEYHAP------------LNYAELAAK---GGGL--ALPYFNGAGAVQKGRPRKRKSPAMGIDINTYNSGCNEND---ADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARA 279          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009847.1 (pep scaffold:Pmarinus_7.0:GL481168:3356:14379:1 gene:ENSPMAG00000008904.1 transcript:ENSPMAT00000009847.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 9.849e-13
Identity = 29/51 (56.86%), Postives = 38/51 (74.51%), Query Frame = 2
Query:  809 PRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            PRT +   Q    +AAF + PKPSR +RE LA ETGL++RV+QVWFQN+R+
Sbjct:   30 PRTTIKAKQLETLRAAFAATPKPSRHVREQLAQETGLNMRVIQVWFQNRRS 80          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: lmo4b (LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-030131-3570])

HSP 1 Score: 63.1586 bits (152), Expect = 4.228e-12
Identity = 38/111 (34.23%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  179 PMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXX-XXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRY 508
            P   C  CG  I D+ +L   D +WH  C+ C+CC   L D+       +  I CR D+I+    S  C +C   I  S+LV+K   + ++H  CF C+ C  +L  GDR+
Sbjct:   14 PPKRCAGCGGKIADRFLLYSMDCYWHSRCLKCSCCQAQLGDLGTSCYTRQGMILCRDDYIRMFGSSGACNACGQSIPASELVMKTQGN-VYHLKCFACATCRTRLVPGDRF 123          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 60.077 bits (144), Expect = 3.714e-11
Identity = 35/118 (29.66%), Postives = 59/118 (50.00%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXX-XXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVI 532
            M  C  C  PI D+++L   ++FWHE+C+ C+ CG  L ++            CR D+++         SC   I+  ++ +++  D ++H  CFKC+ C      GDRY+L    +I
Sbjct:   27 MLMCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVR-DKVYHLECFKCAACQKHFCVGDRYLLVNSDII 143          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 59.6918 bits (143), Expect = 6.298e-11
Identity = 37/118 (31.36%), Postives = 61/118 (51.69%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXX-XXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVI 532
            M  C  C  PI D+++L   ++FWHE+C+ C+ CG  L ++            CR D+++   Q   C SC   I+  ++ +++  D ++H  CFKC+ C      GDRY+L    +I
Sbjct:   26 MLMCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVR-DKVYHLECFKCAACQKHFCVGDRYLLVNSDII 142          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002189.1 (pep scaffold:Pmarinus_7.0:GL483992:1961:4872:1 gene:ENSPMAG00000001979.1 transcript:ENSPMAT00000002189.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 1.068e-8
Identity = 27/63 (42.86%), Postives = 39/63 (61.90%), Query Frame = 2
Query:  776 NGMCPGGGLK--RPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQR 958
            +G  P G  K  R RT+LN  Q +  +  + +NP+P   ++E L   TGLS RV++VWFQN+R
Sbjct:  107 SGGIPSGPEKATRVRTVLNEKQLQTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKR 169          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: LHX1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9E9])

HSP 1 Score: 111.309 bits (277), Expect = 2.561e-28
Identity = 79/257 (30.74%), Postives = 114/257 (44.36%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C  C  PI DK +L + D  WH  CV C+ C  PL + C+  +     +FC+TDF ++  +      Q  I P+D+V +    L+FH  CF CS C  ++ +GD      D   +C    YH+                           N+D+AI+       D +Y +   L              + L S   G         PRT +   Q    K+ F + PKPSR +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    5 CAGCQLPIADKFLLKVLDGVWHAQCVQCSDCKCPLTERCFSREGK---LFCKTDFYRRYGTKCSGCDQG-ISPNDMVRRAK-HLVFHVDCFVCSYCKRQITTGDELYYIGDGSFICRDDYYHS------------------------HPTNLDDAIDEPK----DLSYGLDEDLD-------------AALASKRRG---------PRTTIKAKQLEALKSTFAATPKPSRNIREKLAQETGLNMRVIQVWFQNRRS 206          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: EDO44223 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW85])

HSP 1 Score: 82.0333 bits (201), Expect = 3.353e-18
Identity = 38/53 (71.70%), Postives = 44/53 (83.02%), Query Frame = 2
Query:  803 KRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            KRPRTIL   QR+ FK+AF+ + KP RK+RE L+ ETGLSVRVVQVWFQNQRA
Sbjct:  128 KRPRTILTSQQRKVFKSAFEISSKPCRKVREELSRETGLSVRVVQVWFQNQRA 180          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: EDO46073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR95])

HSP 1 Score: 84.7297 bits (208), Expect = 4.266e-18
Identity = 62/258 (24.03%), Postives = 112/258 (43.41%), Query Frame = 2
Query:  188 FCEACGNPIIDKHVLLIS-DRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQR 958
             C  CG+ I D+++L ++ D  WH +C+ C  C + L + C  F  + +  +C+ D+++   +   +   +    +D V++   + I+H  CF+C  C  +L  GD + L +D                          L+ + +H+I     ++ A        + +N    S     +      D T S   +            R RT+LN  Q    +  +++NP+P   ++E L   TGLS RV++VWFQN+R
Sbjct:   16 MCVGCGSQIHDQYILRVAPDLEWHASCLKCADCHMYLDEKCTCFVREGK-TYCKRDYVRLFGTKCAKCS-LNFSKNDFVMRAR-NKIYHIDCFRCVACSRQLVPGDEFALREDG-------------------------LFCKADHEI-----VEKATATAQATHVRNNGQRSSQSGGQTNGQTTPDSTPSKRKTDRP--------TRVRTVLNEKQLHTLRTCYNANPRPDAMMKEQLVEMTGLSPRVIRVWFQNKR 232          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: EDO43354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYP5])

HSP 1 Score: 76.2554 bits (186), Expect = 1.288e-15
Identity = 66/259 (25.48%), Postives = 108/259 (41.70%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHK--INRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C  CG+ I+++  L+  D+ WH +C+ C+ C + L +    F  D   I CR D+ ++    KC SC   I   +LV++   D ++H +CF C +C   L +G+ + +                           + +Y +++++  +         IN  S        +  +  S  +     SD         +      G  KR RT     Q R  K  F  N  P  K  + L+ +TGL+ RV+QVWFQN RA
Sbjct:    9 CAGCGSRILERFYLMAVDQEWHADCLKCSDCELRLDNELTCFSKDG-VILCREDYYRRFSVKKCSSCSQAISSKELVMRAR-DQVYHVNCFACDRCKRMLATGEYFGM-------------------------RGIRIYCKEDYEELLREESRNPTKINSLSKGRPRKRRIATAIESITNLGYDLSDRPGELTTGAD------GRPKRVRTSFKHHQLRAMKTYFAMNHNPDAKDLKQLSQKTGLTKRVLQVWFQNARA 234          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Match: EDO37316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG43])

HSP 1 Score: 71.2478 bits (173), Expect = 8.593e-15
Identity = 40/110 (36.36%), Postives = 62/110 (56.36%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXX-XXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRY 508
            M  C  CG  IID+ +LL  D++WH NC+ C+CC   L +I     +    I C+TD+++   +S     C  LI  ++LV+K+ L  ++H  CF C+ C  +L  GDR+
Sbjct:   16 MRVCAGCGEKIIDRFLLLALDQYWHVNCLKCSCCEARLGEIGTSCYSKGGMILCKTDYVRLYGNSGACAVCAKLIPATELVMKV-LGKVYHLHCFTCTTCHNQLVPGDRF 124          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lmx1a (LIM homeobox transcription factor 1-alpha-like [Source:NCBI gene;Acc:101175472])

HSP 1 Score: 132.494 bits (332), Expect = 4.276e-34
Identity = 92/257 (35.80%), Postives = 127/257 (49.42%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C  C   I D+ +L ++D  WHE CV C  CG  L + C+  +   + ++C+ D+     +  C  C   I PS+LV++     +FH SCF CS C   L++GDR +L +D  ++C    YH              L     +  I ++G  D+     S  ++D     +SH   N R                         KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:   16 CVGCQRRITDRFLLRVADGLWHERCVRCAACGDALRNSCFLLE---RKLYCKRDY-SSLFAVHCGGCAEAISPSELVMRAGA-AVFHLSCFTCSVCFHHLKTGDRCIL-QDGRLLCAREDYHQ-------------LQASPPSSDIGKSG--DDEEEEPSAKVMDKP--GRSHDQENKR------------------------PKRPRTILTTQQRRTFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 225          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lmx1ba (LIM/homeobox protein LMX-1.2-like [Source:NCBI gene;Acc:101158371])

HSP 1 Score: 124.02 bits (310), Expect = 3.810e-31
Identity = 88/263 (33.46%), Postives = 122/263 (46.39%), Query Frame = 2
Query:  179 PMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNG--MCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            P   C+ C   I D+ +L ++   WHE C+ C  C  PL   CY    +   ++CR D+ +   +      +  I  +DLVI+  L+ ++H SCF C  C  +L  GD +VL +                           L+ ++++   R  +     N  S    DD      H            F T+   S +N     P    KRPRTIL   QRR FKA+F+ + KP RK+RE LA+ETGLSVRVVQVWFQNQRA
Sbjct:    9 PRAVCQGCRRVICDRFLLWVNGACWHEECLRCAACRQPLATTCY---VNDSKLYCRRDYRRLFSAKCSGCLER-IAATDLVIRA-LERVYHLSCFCCCICEHQLCKGDEFVLKEGQ-------------------------LFCKKDYDKERNLSSTGGDNSDSDKSRDDFEAESEH------------FVTAVKGSDDNKDPFRP----KRPRTILTTQQRRTFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRA 225          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lhx1b (LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:101155626])

HSP 1 Score: 112.079 bits (279), Expect = 1.288e-26
Identity = 79/264 (29.92%), Postives = 125/264 (47.35%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYI----EQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            M  C +C  PI+D+ +L + DR WH  CV C  C   L + C  F  D + ++C+ DF ++  +      Q ++ PSDLV +     +FH +CF C  C  +L +G+   +  ++  VC     ++ G          +LL +    E +   +     D+  +  SG           HLS    C   +D  ++            G  + PRT +   Q    KAAF + PKP+R +RE L+ ETGL++RV+QVWFQN+R+
Sbjct:    1 MLHCTSCEKPILDRFLLKVLDRPWHVKCVQCCECKCSLTEKC--FSRDGR-LYCKNDFFRRFGTKCGGCSQGIL-PSDLVRRAK-SKVFHLNCFTCVMCNKQLSTGEELYILDEFKFVCKEDYQNSNG-------KDTILLSVTTCSEPSLSPDSQDPQDDGKDSESG-----------HLSDKDACGNDNDEQSAV-----------GKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLSRETGLNMRVIQVWFQNRRS 230          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lhx1a (LIM homeobox 1 [Source:NCBI gene;Acc:100049230])

HSP 1 Score: 112.079 bits (279), Expect = 1.436e-26
Identity = 76/260 (29.23%), Postives = 126/260 (48.46%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            M  C  C  PI+D+ +L + DR WH  CV C  C   L + C+  +     ++C+ DF ++  +      Q  I P+DLV +     +FH +CF C  C  +L +G+   +  +   VC       +               ++  + ++     D +++  S   + D+ ++K     ++     SD  T  +N+ N+    GG  + PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    1 MVHCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREG---RLYCKNDFFRRFGTKCGGCSQG-ISPNDLVRRAR-SKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLSNSS--------------VKDTNLLSVTACSDPSLSPDSQDPLQDDVVLK-----DTEIAALSDKET--VNNENDDQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 234          
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Match: lhx5 (LIM homeobox 5 [Source:NCBI gene;Acc:101166400])

HSP 1 Score: 104.375 bits (259), Expect = 6.830e-24
Identity = 79/264 (29.92%), Postives = 118/264 (44.70%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNN----GMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            M  C  C  PI+D+ +L + DR WH  CV C  C   L + C  F  D + ++C+ DF ++  +      Q  I P+DLV K     +FH +CF C  C  +L +G+   +  +   VC                                 G+I   +++ S +   D  +      P     + +D +TS     NN        G   + PRT +   Q    KAAF + PKP+R +RE LA ETGL++RV+QVWFQN+R+
Sbjct:    2 MVLCAGCERPILDRFLLNVLDRAWHAKCVQCCDCNCNLTEKC--FSRDGK-LYCKMDFFRRFGTKCAGCLQG-ISPNDLVRKAR-SKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVC--------------------------KEDYLSPGSI-KEVSLNSVSSCTDRSLSPDLPDPTQDDIKETDNSTSSDKETNNIENEEQNSGAKRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQNRRS 233          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000039808.1 (SMESG000039808.1)

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 394/397 (99.24%), Postives = 396/397 (99.75%), Query Frame = 2
Query:  182 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRAXXXXXXXXXXXXXXMTNRLSGKSVMXXXXXXXXXXXXXXXXXXXEYSEILTDIVDGSQCEKVLXXXXXXXXXXXQNSASKVPNREHENLPNLSTMLFTTSQSQNDMISCQSSPICAPLYSYLYFPNSQNKTPISFYN 1372
            MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIKKKQSSKCQSCQMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGSSSINSTNSNVLLYIEQNHKINRAGNIDN+INVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRAKEKKNSKKSSIRSKMTNRLSGKSVMDDRSSNDLDDSVDDAEDGDEYSEILTDIVDGSQCE VLSLSPSSKDTSSQNSASKVPNREHENLPNLSTMLFTTSQSQND+ISCQSSPICAPLYSYLYFPNSQNKTPISFYN
Sbjct:    1 MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIKKKQSSKCQSCQMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGSSSINSTNSNVLLYIEQNHKINRAGNIDNSINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRAKEKKNSKKSSIRSKMTNRLSGKSVMDDRSSNDLDDSVDDAEDGDEYSEILTDIVDGSQCEMVLSLSPSSKDTSSQNSASKVPNREHENLPNLSTMLFTTSQSQNDIISCQSSPICAPLYSYLYFPNSQNKTPISFYN 397          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000022856.1 (SMESG000022856.1)

HSP 1 Score: 122.479 bits (306), Expect = 1.101e-30
Identity = 86/273 (31.50%), Postives = 129/273 (47.25%), Query Frame = 2
Query:  176 IPMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQN-HKINRA----GNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGG------LKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            + +P C  C  PI DK +  I D  WH+ C+ CN C   L   C+E   D +++ C  D+ +KK     +    +  PSD V+      IFH +CF+C+ C  KL SGDRY       ++   F Y++             L   + N  +IN+      +ID+  N           ++ ++ S +S  N + D  +    S++   C           + PRT +  SQ    KA F   PKPSR++RE LA  TGLS+RV+QVWFQN+R+
Sbjct:    1 MTVPICYKCNKPINDKFITRIRDHSWHDQCLRCNQCSCQLTSKCFEL--DNEFL-CPEDYSRKKFKKCSKCKGPIF-PSDKVLYTDSLSIFHQNCFRCNYCDQKLISGDRYYTYSPGSVIVCQFDYNSLKHE---------LFGDDSNCEQINKTELIFSDIDSQENNKGNVFHKFTTIISNYRSRSSSGNLYDDLVSEIDPSVDETYCSDNDKSCEIRRRTPRTTIKASQLDSLKATFSITPKPSRQMREKLAECTGLSMRVIQVWFQNRRS 260          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000053732.1 (SMESG000053732.1)

HSP 1 Score: 100.138 bits (248), Expect = 3.500e-23
Identity = 89/257 (34.63%), Postives = 119/257 (46.30%), Query Frame = 2
Query:  191 CEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            C  C   I D++ L +S    HE+C +C  C  PL D C+        IFC+ D+         Q  + ++ P   V+K+    I+H  C  C+ C   L SGD  V T D  + C                         QN         D  I++           M+   + NS C+   + +    +S +N  C     KRPRTIL  SQRR+FK AF+ N KP+RK+RE LASETGL+VRVVQVWFQNQRA
Sbjct:   17 CIICNQMIYDQYYLKVSKDSIHEHCSVCCVCHCPLNDRCF---LKHGQIFCKLDYYNCFSIRCYQCME-VVWPGSAVMKI-FHRIYHVKCLSCTICQKHLTSGD-MVFTTDVGVFC-------------------------QN---------DYEISMQQ--------CMELGCTSNSDCDLDDNDSFEDSDSDSNKNC-----KRPRTILTTSQRRRFKTAFELNSKPTRKIRETLASETGLNVRVVQVWFQNQRA 220          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000005304.1 (SMESG000005304.1)

HSP 1 Score: 101.293 bits (251), Expect = 7.840e-23
Identity = 82/269 (30.48%), Postives = 134/269 (49.81%), Query Frame = 2
Query:  161 KLIDNIPMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTK-DYVIVCVAFCYHATGXXXXXXXXXXVLLYIEQNHKINRAGNIDNAINVTSGAIIDDNYMMKSHLSPNSR-CNQFSDFTTSFLNSLNNGMCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            K +DN   P C  C   I DK++  ++D FWH++C +C+ C   L + C+  K +K  +FCR  + K   ++KC  C + +Q  ++ +   L+ ++H +CF CS C   L+ GD ++L   + ++VC A   + +G+    S+N+        +HK +   ++   + ++     D      S  S N +  N FS + +                KRPRT L   Q+R+    F +   P+ K RE LA E  L ++VVQVWFQNQRA
Sbjct:   27 KKVDN---PSCTGCNGVINDKYLFSLNDTFWHKSCALCSICEEVLEESCFMLKDNK--LFCRNHYYKSSFATKCSGCNLPMQTHEVAMHA-LNRVYHVTCFACSCCKQLLQRGDEFILHGPESLLVCRAD--YESGAYLHCSSNTLNDCDQSFSHKDSNETSM-KELQISYQYHEDGTGKHSSTDSSNGKQYNYFSSYNSKV------------SSKRPRTTLTFDQKRRLMVFFKTCQNPNYKQREALAEEMKLPLKVVQVWFQNQRA 274          
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Match: SMESG000016568.1 (SMESG000016568.1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.165e-16
Identity = 42/120 (35.00%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  179 PMPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQYIFCRTDFIXXXXXXXXXXXXMLIQPSDLVIKLHLDLIFHYSCFKCSQCGIKLRSGDRYVLTKDYVIVC 538
            P+P C +C  PIID+++  I+D+FWH  C+ C  C IPL + C+E       +FC  D+ K+  +       +++ P+DLV       +FH  CF C  C  +L +GD Y L +++  VC
Sbjct:   35 PVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGK---LFCSKDYRKRVSAKCSLCLNIIL-PTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVC 150          

HSP 2 Score: 67.781 bits (164), Expect = 8.544e-12
Identity = 31/57 (54.39%), Postives = 41/57 (71.93%), Query Frame = 2
Query:  797 GLKR--PRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRVVQVWFQNQRA 961
            G KR  PRT +   Q    KAAF + PKP+R +RE LA +TGL++RV+QVWFQN+R+
Sbjct:  398 GTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRS 454          
The following BLAST results are available for this feature:
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMX1A2.728e-3235.11LIM homeobox transcription factor 1 alpha [Source:... [more]
LMX1A2.728e-3235.11LIM homeobox transcription factor 1 alpha [Source:... [more]
LMX1A2.728e-3235.11LIM homeobox transcription factor 1 alpha [Source:... [more]
LMX1B6.469e-3233.71LIM homeobox transcription factor 1 beta [Source:H... [more]
LMX1B6.517e-3233.71LIM homeobox transcription factor 1 beta [Source:H... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-111.532e-2431.13pep chromosome:WBcel235:I:10248256:10255327:1 gene... [more]
mec-35.229e-2328.46Mechanosensory protein 3 [Source:UniProtKB/Swiss-... [more]
mec-31.929e-2026.98Mechanosensory protein 3 [Source:UniProtKB/Swiss-... [more]
lim-63.591e-2079.25LIM domain family [Source:UniProtKB/TrEMBL;Acc:G4... [more]
mec-35.196e-2028.57Mechanosensory protein 3 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmx1a8.500e-2930.15gene:FBgn0052105 transcript:FBtr0075953[more]
Lmx1a9.288e-2930.15gene:FBgn0052105 transcript:FBtr0333837[more]
Lim15.311e-2630.60gene:FBgn0026411 transcript:FBtr0071279[more]
CG43284.638e-1974.07gene:FBgn0036274 transcript:FBtr0301071[more]
Awh3.854e-1728.40gene:FBgn0013751 transcript:FBtr0073155[more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx1b1.796e-2930.94LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
lhx1b1.796e-2930.94LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
lhx1a4.255e-2629.66LIM homeobox 1a [Source:NCBI gene;Acc:30463][more]
lhx51.673e-2229.23LIM homeobox 5 [Source:NCBI gene;Acc:30465][more]
lhx2a7.812e-2129.04LIM homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-091118-1... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcp1b4.430e-3232.95decapping mRNA 1B [Source:Xenbase;Acc:XB-GENE-8771... [more]
LMX1A7.961e-3035.38LIM homeobox transcription factor 1 alpha [Source:... [more]
klf21.363e-2631.15Kruppel-like factor 2 [Source:Xenbase;Acc:XB-GENE-... [more]
gfm23.070e-2529.50G elongation factor, mitochondrial 2 [Source:Xenba... [more]
gfm21.136e-2430.00G elongation factor, mitochondrial 2 [Source:Xenba... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmx1b2.933e-3233.71LIM homeobox transcription factor 1 beta [Source:M... [more]
Lmx1b3.423e-3233.71LIM homeobox transcription factor 1 beta [Source:M... [more]
Lmx1a1.120e-3033.57LIM homeobox transcription factor 1 alpha [Source:... [more]
Lmx1a1.120e-3033.57LIM homeobox transcription factor 1 alpha [Source:... [more]
Lhx13.277e-2528.85LIM homeobox protein 1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TE12|LMX1A_HUMAN1.310e-3135.11LIM homeobox transcription factor 1-alpha OS=Homo ... [more]
sp|O88609|LMX1B_MOUSE3.130e-3133.71LIM homeobox transcription factor 1-beta OS=Mus mu... [more]
sp|O60663|LMX1B_HUMAN4.062e-3133.71LIM homeobox transcription factor 1-beta OS=Homo s... [more]
sp|Q60564|LMX1B_MESAU1.800e-3032.21LIM homeobox transcription factor 1-beta (Fragment... [more]
sp|Q04650|LMX1A_MESAU6.311e-3033.57LIM homeobox transcription factor 1-alpha OS=Mesoc... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PZJ63.139e-3537.21LIM homeobox transcription factor 1-alpha OS=Mizuh... [more]
A0A1W4XRF85.969e-3335.43LIM homeobox transcription factor 1-alpha OS=Agril... [more]
M3ZZA12.071e-3234.85LIM homeobox transcription factor 1, beta a OS=Xip... [more]
Q4H3884.745e-3232.70transcription factor protein OS=Ciona intestinalis... [more]
K1R6C95.121e-3235.41LIM homeobox transcription factor 1-beta OS=Crasso... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmx1ba2.691e-3132.32LIM homeobox transcription factor 1, beta a [Sourc... [more]
lhx1b4.342e-2929.18LIM/homeobox protein Lhx1-like [Source:NCBI gene;A... [more]
lhx51.558e-2731.32LIM/homeobox protein Lhx5 [Source:NCBI gene;Acc:10... [more]
lhx1a4.831e-2729.74LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:10... [more]
lhx95.011e-2029.67LIM homeobox 9 [Source:NCBI gene;Acc:103038813][more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009847.19.849e-1356.86pep scaffold:Pmarinus_7.0:GL481168:3356:14379:1 ge... [more]
lmo4b4.228e-1234.23LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
lmo23.714e-1129.66LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
lmo26.298e-1131.36LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
ENSPMAT00000002189.11.068e-842.86pep scaffold:Pmarinus_7.0:GL483992:1961:4872:1 gen... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
LHX12.561e-2830.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442233.353e-1871.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460734.266e-1824.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433541.288e-1525.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373168.593e-1536.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmx1a4.276e-3435.80LIM homeobox transcription factor 1-alpha-like [So... [more]
lmx1ba3.810e-3133.46LIM/homeobox protein LMX-1.2-like [Source:NCBI gen... [more]
lhx1b1.288e-2629.92LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:10... [more]
lhx1a1.436e-2629.23LIM homeobox 1 [Source:NCBI gene;Acc:100049230][more]
lhx56.830e-2429.92LIM homeobox 5 [Source:NCBI gene;Acc:101166400][more]
back to top
BLAST of LIM homeobox transcription factor 1-alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039808.10.000e+099.24SMESG000039808.1[more]
SMESG000022856.11.101e-3031.50SMESG000022856.1[more]
SMESG000053732.13.500e-2334.63SMESG000053732.1[more]
SMESG000005304.17.840e-2330.48SMESG000005304.1[more]
SMESG000016568.11.165e-1635.00SMESG000016568.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019821 ID=SMED30019821|Name=LIM homeobox transcription factor 1-alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1502bp
CTGTAAAAATATATTAAAATAAGAAATCACTTTTCTTACAAGTTGATAAT
TTTTATTGCTACCCGATTGTGATTCGCTGTTTAGATTCGCATAATCTTCC
AACGGTGATTGGCGGAATTTTCCATATAAAATAGAATTGCTTTAGAATGA
CTCAGATTTGAAATTAATTGACAATATACCGATGCCATTCTGTGAAGCAT
GTGGAAATCCTATTATTGATAAACATGTCTTACTGATCAGTGATCGATTC
TGGCATGAAAACTGTGTAATTTGCAATTGTTGTGGCATTCCATTGATTGA
TATTTGTTATGAATTCAAGGCTGACAAACAATACATTTTTTGCCGGACCG
ATTTTATCAAAAAGAAGCAGTCGAGTAAATGTCAAAGTTGTCAAATGTTA
ATCCAACCTTCCGATTTGGTGATCAAGTTGCATTTGGATCTGATTTTTCA
TTATTCTTGTTTCAAATGCTCTCAATGTGGCATAAAACTGAGATCGGGTG
ACCGATATGTGTTGACTAAAGATTATGTCATAGTCTGCGTGGCATTCTGC
TATCACGCAACAGGCTCAAGCTCAATCAATTCCACCAACTCCAATGTGCT
GCTGTATATCGAACAGAATCATAAAATCAACAGAGCCGGAAATATTGATA
ATGCCATAAATGTCACATCTGGTGCAATAATTGATGATAATTACATGATG
AAGTCACATTTGAGCCCCAATTCGAGATGTAACCAATTTTCAGATTTCAC
CACTTCATTTCTAAACAGTCTCAACAACGGAATGTGCCCAGGAGGAGGTT
TAAAACGGCCTAGAACCATTCTCAATCCCAGCCAAAGGCGGAAATTTAAA
GCTGCATTCGATAGTAATCCTAAGCCATCGAGAAAGTTGAGAGAAAATCT
CGCCTCGGAAACTGGACTGTCGGTTCGTGTGGTTCAGGTCTGGTTTCAGA
ATCAAAGAGCAAAAGAGAAAAAAAATAGCAAAAAATCATCAATTCGGTCC
AAAATGACAAACAGGCTATCTGGAAAATCAGTCATGGATGATAGAAGCAG
CAATGATCTTGATGATTCGGTGGATGACGCCGAAGATGGAGATGAATATA
GTGAAATATTAACTGACATAGTTGATGGTTCGCAATGTGAGAAGGTTTTG
TCGTTATCCCCATCTAGTAAAGATACTTCATCTCAAAATTCTGCATCGAA
AGTCCCAAATCGAGAACATGAAAACTTACCGAATCTTTCAACAATGTTGT
TTACGACATCACAATCACAAAATGATATGATATCTTGTCAGTCTTCACCA
ATCTGTGCTCCATTATATTCTTATTTATATTTCCCAAATTCTCAAAACAA
GACTCCTATTAGTTTTTATAATTGATATATTATTATGAACTGAAAATCGT
ATATACCACTGATATAAATTTGTCGGATTTATGTAAATAATCTTTCATTT
TATAATTCATTTTCAAGCTACTCAAATTATAAATAATGAAATGTTTATAC
AC
back to top

protein sequence of SMED30019821-orf-1

>SMED30019821-orf-1 ID=SMED30019821-orf-1|Name=SMED30019821-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=398bp
MPFCEACGNPIIDKHVLLISDRFWHENCVICNCCGIPLIDICYEFKADKQ
YIFCRTDFIKKKQSSKCQSCQMLIQPSDLVIKLHLDLIFHYSCFKCSQCG
IKLRSGDRYVLTKDYVIVCVAFCYHATGSSSINSTNSNVLLYIEQNHKIN
RAGNIDNAINVTSGAIIDDNYMMKSHLSPNSRCNQFSDFTTSFLNSLNNG
MCPGGGLKRPRTILNPSQRRKFKAAFDSNPKPSRKLRENLASETGLSVRV
VQVWFQNQRAKEKKNSKKSSIRSKMTNRLSGKSVMDDRSSNDLDDSVDDA
EDGDEYSEILTDIVDGSQCEKVLSLSPSSKDTSSQNSASKVPNREHENLP
NLSTMLFTTSQSQNDMISCQSSPICAPLYSYLYFPNSQNKTPISFYN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR001781Znf_LIM
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 3..57
e-value: 2.1E-6
score: 37.3
coord: 66..122
e-value: 7.4E-5
score: 32.1
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 67..125
e-value: 8.8E-8
score: 32.3
coord: 4..61
e-value: 4.3E-8
score: 33.3
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 4..38
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 67..103
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 2..64
score: 11.969
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 65..130
score: 11.336
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 207..269
e-value: 6.6E-22
score: 88.8
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 208..264
e-value: 2.8E-18
score: 65.5
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 205..265
score: 17.459
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 208..260
e-value: 1.23261E-18
score: 77.2836
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 1..62
e-value: 3.4E-13
score: 51.2
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 207..268
e-value: 2.9E-21
score: 76.9
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 63..165
e-value: 7.7E-13
score: 50.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 324..349
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 258..302
NoneNo IPR availablePANTHERPTHR24208:SF166LIM HOMEOBOX TRANSCRIPTION FACTOR 1 ALPHA, ISOFORM Bcoord: 3..361
NoneNo IPR availablePANTHERPTHR24208FAMILY NOT NAMEDcoord: 3..361
NoneNo IPR availableCDDcd08368LIMcoord: 4..58
e-value: 1.68772E-9
score: 51.1643
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 2..29
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 240..263
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 203..270