Zinc finger protein

Overview
NameZinc finger protein
Smed IDSMED30019808
Length (bp)5739
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger protein (SMED30019808) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger protein (SMED30019808) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger protein (SMED30019808) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger protein (SMED30019808) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019808

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30019808SMESG000048367.1 dd_Smed_v4_5058_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30019808SMESG000048367.1 SmedASXL_016377SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30019808SMESG000048367.1 SmedASXL_016377SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30019808SMESG000048367.1 dd_Smed_v4_5058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019808SMESG000048367.1 dd_Smed_v4_5058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019808SMESG000048367.1 dd_Smed_v4_5058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019808SMESG000048367.1 dd_Smed_v4_5058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019808SMESG000048367.1 dd_Smed_v4_5058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019808SMESG000048367.1 Contig49794newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019808SMESG000048367.1 Contig49794uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF226 (zinc finger protein 226 [Source:HGNC Symbol;Acc:HGNC:13019])

HSP 1 Score: 148.673 bits (374), Expect = 1.751e-35
Identity = 152/603 (25.21%), Postives = 242/603 (40.13%), Query Frame = 1
Query: 2083 VYDH-EIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDH--LHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGL-TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
             +DH  + H G   ++C++ +  F+D+ S+  H      E+ + C    +         ++    + +  +CD+C   F Q   L+ H  +                     +  + + C  CG  +S+   L  H   H +     C  C    G     + HL+DH  LH  E        K   CD C   +    +   HQ    G    P K +E  +         +++   + TG K + C+ C       G      L    G+ T E   +C +C   F     L  H R   + +GE         + C++C               VH    P  Y+C  C +  +     +IH + H   +  F C+EC   F   + L++H     G K    KC  C K FS   ++++H    H G     P++C  C + F   + L AHQ VH G    +C+ C K        + H+  H   + ++C EC   F+  L +  H RV H   +P  Y+C  CGK  +Q S   +H  +H   + Y+C+ CGK F++S+    H R+H GEKPY+C IC + F+ +SNL VH   H
Sbjct:  238 TFDHNSMIHTGQKSYQCNECKKPFSDLSSFDLHQQLQSGEKSLTCVERGKGFCYSPVLPVHQKVHVGEKLKCDECGKEFSQGAHLQTHQKV--------------------HVIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEEC----GRAFSQASHLQDHQRLHTGE--------KPFKCDACGKSFSRNSHLQSHQRVHTG--EKPYKCEECGKGFICSSNLYIHQR--VHTGEKPYKCEECGK-----GFSRPSSLQAHQGVHTGEKSYICTVCGKGFTLSSNLQAHQR---VHTGE-------KPYKCNECGKSFRRNSHYQVHLVVHTGEKP--YKCEICGKGFSQSSYLQIHQKAHSIEK-PFKCEECGQGFNQSSRLQIHQLIHTGEK--PYKCEECGKGFSRRADLKIHC-RIHTG---EKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRV-HTGEKP--YKCGECGKYFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTVHHRIH 777          

HSP 2 Score: 93.2041 bits (230), Expect = 3.114e-18
Identity = 118/494 (23.89%), Postives = 188/494 (38.06%), Query Frame = 1
Query: 2041 SCVFCGREFKASANVYDHEIRHVGLIRFKC-------------HKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHL--HKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVK---HGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEE---NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG 3426
            +C  CGR F  ++++ DH+  H G   FKC               HQ V T  K YK        CE   +  +  +   ++      + P +C++C   F +   L+ H  +  G                     + +IC +CG  ++    L +H   H       CN C    G     + H + HL  H  E        K   C+IC   +        HQ  +   +  P K +E  +   +    ++++L  + TG K + C+ C       G+ + +  D+K      T E    C  C  +F     L  H R   + SGE         F C++C   FG    + AH   VH    P  Y+C  C +       W ++L+ H+     +  + C EC  YF   ++L+LH     G K    KC +C K FS S ++    RVH  E+        P+ C +C + F + + L  H  +H G
Sbjct:  364 NCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYK--------CEECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTG--------------------EKSYICTVCGKGFTLSSNLQAHQRVHTGEKPYKCNEC----GKSFRRNSHYQVHLVVHTGE--------KPYKCEICGKGFSQSSYLQIHQ--KAHSIEKPFKCEECGQGFNQSSRLQIHQL--IHTGEKPYKCEEC-------GKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQR---VHSGE-------KPFKCEECGKSFGRSAHLQAHQ-KVHTGDKP--YKCDECGKGFK----WSLNLDMHQRVHTGEKPYKCGECGKYFSQASSLQLHQSVHTGEK--PYKCDVCGKVFSRSSQLQSHQRVHTGEK--------PYKCEICGKSFSWRSNLTVHHRIHVG 779          

HSP 3 Score: 78.5666 bits (192), Expect = 9.632e-14
Identity = 54/168 (32.14%), Postives = 81/168 (48.21%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH---ESYRDDFG--NYLQIKQRGKPIK 5568
            + C +C + FG   +L +H K+H  D    +   C  C + F+  +    H + +   T  K Y+C  C K     + +  H  +H+ E    C++C K F + S    H R HTGEKPYKC+ICG  FS + N   H + H   +SY+ + G  N  +  Q  K IK
Sbjct:  643 FKCEECGKSFGRSAHLQAHQKVHTGD----KPYKCDECGKGFKWSLNLDMHQRVH---TGEKPYKCGECGKYFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTVHHRIHVGDKSYKSNRGGKNIRESTQEKKSIK 803          

HSP 4 Score: 78.1814 bits (191), Expect = 1.286e-13
Identity = 61/199 (30.65%), Postives = 90/199 (45.23%), Query Frame = 1
Query: 5005 DIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIKKVFNTEK 5589
            D      + NS   H +S+ R +  +K  Y C +C + F    NL  H ++H    T  +   C+ C + F        H   +   T  K Y CT+C K   + + +  H ++H+ E    C  C K F++ S+Y  HL  HTGEKPYKC+ICG  FS+                   +YLQI Q+   I+K F  E+
Sbjct:  394 DACGKSFSRNS---HLQSHQRVHTGEK-PYKCEECGKGFICSSNLYIHQRVH----TGEKPYKCEECGKGFSRPSSLQAHQGVH---TGEKSYICTVCGKGFTLSSNLQAHQRVHTGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKPYKCEICGKGFSQ------------------SSYLQIHQKAHSIEKPFKCEE 563          

HSP 5 Score: 68.5514 bits (166), Expect = 1.024e-10
Identity = 40/127 (31.50%), Postives = 61/127 (48.03%), Query Frame = 1
Query: 5098 CVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEF 5466
            C +C + F    +L +H K+H     + +   CK C + F  +     H K +   T  K Y C  C +     + + +H ++H+ E    C+ C K F + S+   H R HTGEKPYKC+ CG  F
Sbjct:  309 CDECGKEFSQGAHLQTHQKVH----VIEKPYKCKQCGKGFSRRSALNVHCKVH---TAEKPYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYKCEECGKGF 428          

HSP 6 Score: 67.781 bits (164), Expect = 1.856e-10
Identity = 56/187 (29.95%), Postives = 83/187 (44.39%), Query Frame = 1
Query: 5029 ENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHN--KDLT---------------------VNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIH-SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            +N  IL  + N+  +  QK  Y C +C + F  L + + H ++ +  K LT                     V EK+ C  C + F        H K +      K Y+C  C K  +    +N H K+H +E    CE C + F + S+  +H R HTGEKP+KC  CG  FS+    N HL+ H+
Sbjct:  232 DNMKILTFDHNSMIHTGQK-SYQCNECKKPFSDLSSFDLHQQLQSGEKSLTCVERGKGFCYSPVLPVHQKVHVGEKLKCDECGKEFSQGAHLQTHQKVH---VIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSR----NSHLQSHQ 410          

HSP 7 Score: 65.855 bits (159), Expect = 8.486e-10
Identity = 45/142 (31.69%), Postives = 68/142 (47.89%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C  C + F    + +S+++IH K  ++ +   C+ C Q F        H   +   T  K Y+C  C K     A +  H +IH+ E    CE C K F++ S  + H R H+GEKP+KC+ CG  F +  +   H K H
Sbjct:  531 YKCEICGKGF----SQSSYLQIHQKAHSIEKPFKCEECGQGFNQSSRLQIHQLIH---TGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVH 665          

HSP 8 Score: 56.9954 bits (136), Expect = 4.157e-7
Identity = 40/132 (30.30%), Postives = 59/132 (44.70%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSK 5472
            Y C +C + F    +L +H  +H    T  +   C  C + F        H + +   T  K Y+C  C K     N H ++H      E    CEIC K F + SY   H + H+ EKP+KC+ CG  F++
Sbjct:  447 YKCEECGKGFSRPSSLQAHQGVH----TGEKSYICTVCGKGFTLSSNLQAHQRVH---TGEKPYKCNECGKSFR-RNSHYQVHLVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKPFKCEECGQGFNQ 570          
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF226 (zinc finger protein 226 [Source:HGNC Symbol;Acc:HGNC:13019])

HSP 1 Score: 148.673 bits (374), Expect = 1.751e-35
Identity = 152/603 (25.21%), Postives = 242/603 (40.13%), Query Frame = 1
Query: 2083 VYDH-EIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDH--LHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGL-TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
             +DH  + H G   ++C++ +  F+D+ S+  H      E+ + C    +         ++    + +  +CD+C   F Q   L+ H  +                     +  + + C  CG  +S+   L  H   H +     C  C    G     + HL+DH  LH  E        K   CD C   +    +   HQ    G    P K +E  +         +++   + TG K + C+ C       G      L    G+ T E   +C +C   F     L  H R   + +GE         + C++C               VH    P  Y+C  C +  +     +IH + H   +  F C+EC   F   + L++H     G K    KC  C K FS   ++++H    H G     P++C  C + F   + L AHQ VH G    +C+ C K        + H+  H   + ++C EC   F+  L +  H RV H   +P  Y+C  CGK  +Q S   +H  +H   + Y+C+ CGK F++S+    H R+H GEKPY+C IC + F+ +SNL VH   H
Sbjct:  238 TFDHNSMIHTGQKSYQCNECKKPFSDLSSFDLHQQLQSGEKSLTCVERGKGFCYSPVLPVHQKVHVGEKLKCDECGKEFSQGAHLQTHQKV--------------------HVIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEEC----GRAFSQASHLQDHQRLHTGE--------KPFKCDACGKSFSRNSHLQSHQRVHTG--EKPYKCEECGKGFICSSNLYIHQR--VHTGEKPYKCEECGK-----GFSRPSSLQAHQGVHTGEKSYICTVCGKGFTLSSNLQAHQR---VHTGE-------KPYKCNECGKSFRRNSHYQVHLVVHTGEKP--YKCEICGKGFSQSSYLQIHQKAHSIEK-PFKCEECGQGFNQSSRLQIHQLIHTGEK--PYKCEECGKGFSRRADLKIHC-RIHTG---EKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRV-HTGEKP--YKCGECGKYFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTVHHRIH 777          

HSP 2 Score: 93.2041 bits (230), Expect = 3.114e-18
Identity = 118/494 (23.89%), Postives = 188/494 (38.06%), Query Frame = 1
Query: 2041 SCVFCGREFKASANVYDHEIRHVGLIRFKC-------------HKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHL--HKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVK---HGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEE---NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG 3426
            +C  CGR F  ++++ DH+  H G   FKC               HQ V T  K YK        CE   +  +  +   ++      + P +C++C   F +   L+ H  +  G                     + +IC +CG  ++    L +H   H       CN C    G     + H + HL  H  E        K   C+IC   +        HQ  +   +  P K +E  +   +    ++++L  + TG K + C+ C       G+ + +  D+K      T E    C  C  +F     L  H R   + SGE         F C++C   FG    + AH   VH    P  Y+C  C +       W ++L+ H+     +  + C EC  YF   ++L+LH     G K    KC +C K FS S ++    RVH  E+        P+ C +C + F + + L  H  +H G
Sbjct:  364 NCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYK--------CEECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTG--------------------EKSYICTVCGKGFTLSSNLQAHQRVHTGEKPYKCNEC----GKSFRRNSHYQVHLVVHTGE--------KPYKCEICGKGFSQSSYLQIHQ--KAHSIEKPFKCEECGQGFNQSSRLQIHQL--IHTGEKPYKCEEC-------GKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQR---VHSGE-------KPFKCEECGKSFGRSAHLQAHQ-KVHTGDKP--YKCDECGKGFK----WSLNLDMHQRVHTGEKPYKCGECGKYFSQASSLQLHQSVHTGEK--PYKCDVCGKVFSRSSQLQSHQRVHTGEK--------PYKCEICGKSFSWRSNLTVHHRIHVG 779          

HSP 3 Score: 78.5666 bits (192), Expect = 9.632e-14
Identity = 54/168 (32.14%), Postives = 81/168 (48.21%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH---ESYRDDFG--NYLQIKQRGKPIK 5568
            + C +C + FG   +L +H K+H  D    +   C  C + F+  +    H + +   T  K Y+C  C K     + +  H  +H+ E    C++C K F + S    H R HTGEKPYKC+ICG  FS + N   H + H   +SY+ + G  N  +  Q  K IK
Sbjct:  643 FKCEECGKSFGRSAHLQAHQKVHTGD----KPYKCDECGKGFKWSLNLDMHQRVH---TGEKPYKCGECGKYFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTVHHRIHVGDKSYKSNRGGKNIRESTQEKKSIK 803          

HSP 4 Score: 78.1814 bits (191), Expect = 1.286e-13
Identity = 61/199 (30.65%), Postives = 90/199 (45.23%), Query Frame = 1
Query: 5005 DIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIKKVFNTEK 5589
            D      + NS   H +S+ R +  +K  Y C +C + F    NL  H ++H    T  +   C+ C + F        H   +   T  K Y CT+C K   + + +  H ++H+ E    C  C K F++ S+Y  HL  HTGEKPYKC+ICG  FS+                   +YLQI Q+   I+K F  E+
Sbjct:  394 DACGKSFSRNS---HLQSHQRVHTGEK-PYKCEECGKGFICSSNLYIHQRVH----TGEKPYKCEECGKGFSRPSSLQAHQGVH---TGEKSYICTVCGKGFTLSSNLQAHQRVHTGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKPYKCEICGKGFSQ------------------SSYLQIHQKAHSIEKPFKCEE 563          

HSP 5 Score: 68.5514 bits (166), Expect = 1.024e-10
Identity = 40/127 (31.50%), Postives = 61/127 (48.03%), Query Frame = 1
Query: 5098 CVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEF 5466
            C +C + F    +L +H K+H     + +   CK C + F  +     H K +   T  K Y C  C +     + + +H ++H+ E    C+ C K F + S+   H R HTGEKPYKC+ CG  F
Sbjct:  309 CDECGKEFSQGAHLQTHQKVH----VIEKPYKCKQCGKGFSRRSALNVHCKVH---TAEKPYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYKCEECGKGF 428          

HSP 6 Score: 67.781 bits (164), Expect = 1.856e-10
Identity = 56/187 (29.95%), Postives = 83/187 (44.39%), Query Frame = 1
Query: 5029 ENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHN--KDLT---------------------VNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIH-SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            +N  IL  + N+  +  QK  Y C +C + F  L + + H ++ +  K LT                     V EK+ C  C + F        H K +      K Y+C  C K  +    +N H K+H +E    CE C + F + S+  +H R HTGEKP+KC  CG  FS+    N HL+ H+
Sbjct:  232 DNMKILTFDHNSMIHTGQK-SYQCNECKKPFSDLSSFDLHQQLQSGEKSLTCVERGKGFCYSPVLPVHQKVHVGEKLKCDECGKEFSQGAHLQTHQKVH---VIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSR----NSHLQSHQ 410          

HSP 7 Score: 65.855 bits (159), Expect = 8.486e-10
Identity = 45/142 (31.69%), Postives = 68/142 (47.89%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C  C + F    + +S+++IH K  ++ +   C+ C Q F        H   +   T  K Y+C  C K     A +  H +IH+ E    CE C K F++ S  + H R H+GEKP+KC+ CG  F +  +   H K H
Sbjct:  531 YKCEICGKGF----SQSSYLQIHQKAHSIEKPFKCEECGQGFNQSSRLQIHQLIH---TGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVH 665          

HSP 8 Score: 56.9954 bits (136), Expect = 4.157e-7
Identity = 40/132 (30.30%), Postives = 59/132 (44.70%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSK 5472
            Y C +C + F    +L +H  +H    T  +   C  C + F        H + +   T  K Y+C  C K     N H ++H      E    CEIC K F + SY   H + H+ EKP+KC+ CG  F++
Sbjct:  447 YKCEECGKGFSRPSSLQAHQGVH----TGEKSYICTVCGKGFTLSSNLQAHQRVH---TGEKPYKCNECGKSFR-RNSHYQVHLVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKPFKCEECGQGFNQ 570          
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF226 (zinc finger protein 226 [Source:HGNC Symbol;Acc:HGNC:13019])

HSP 1 Score: 148.673 bits (374), Expect = 1.751e-35
Identity = 152/603 (25.21%), Postives = 242/603 (40.13%), Query Frame = 1
Query: 2083 VYDH-EIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDH--LHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGL-TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
             +DH  + H G   ++C++ +  F+D+ S+  H      E+ + C    +         ++    + +  +CD+C   F Q   L+ H  +                     +  + + C  CG  +S+   L  H   H +     C  C    G     + HL+DH  LH  E        K   CD C   +    +   HQ    G    P K +E  +         +++   + TG K + C+ C       G      L    G+ T E   +C +C   F     L  H R   + +GE         + C++C               VH    P  Y+C  C +  +     +IH + H   +  F C+EC   F   + L++H     G K    KC  C K FS   ++++H    H G     P++C  C + F   + L AHQ VH G    +C+ C K        + H+  H   + ++C EC   F+  L +  H RV H   +P  Y+C  CGK  +Q S   +H  +H   + Y+C+ CGK F++S+    H R+H GEKPY+C IC + F+ +SNL VH   H
Sbjct:  238 TFDHNSMIHTGQKSYQCNECKKPFSDLSSFDLHQQLQSGEKSLTCVERGKGFCYSPVLPVHQKVHVGEKLKCDECGKEFSQGAHLQTHQKV--------------------HVIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEEC----GRAFSQASHLQDHQRLHTGE--------KPFKCDACGKSFSRNSHLQSHQRVHTG--EKPYKCEECGKGFICSSNLYIHQR--VHTGEKPYKCEECGK-----GFSRPSSLQAHQGVHTGEKSYICTVCGKGFTLSSNLQAHQR---VHTGE-------KPYKCNECGKSFRRNSHYQVHLVVHTGEKP--YKCEICGKGFSQSSYLQIHQKAHSIEK-PFKCEECGQGFNQSSRLQIHQLIHTGEK--PYKCEECGKGFSRRADLKIHC-RIHTG---EKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRV-HTGEKP--YKCGECGKYFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTVHHRIH 777          

HSP 2 Score: 93.2041 bits (230), Expect = 3.114e-18
Identity = 118/494 (23.89%), Postives = 188/494 (38.06%), Query Frame = 1
Query: 2041 SCVFCGREFKASANVYDHEIRHVGLIRFKC-------------HKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHL--HKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVK---HGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEE---NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG 3426
            +C  CGR F  ++++ DH+  H G   FKC               HQ V T  K YK        CE   +  +  +   ++      + P +C++C   F +   L+ H  +  G                     + +IC +CG  ++    L +H   H       CN C    G     + H + HL  H  E        K   C+IC   +        HQ  +   +  P K +E  +   +    ++++L  + TG K + C+ C       G+ + +  D+K      T E    C  C  +F     L  H R   + SGE         F C++C   FG    + AH   VH    P  Y+C  C +       W ++L+ H+     +  + C EC  YF   ++L+LH     G K    KC +C K FS S ++    RVH  E+        P+ C +C + F + + L  H  +H G
Sbjct:  364 NCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYK--------CEECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTG--------------------EKSYICTVCGKGFTLSSNLQAHQRVHTGEKPYKCNEC----GKSFRRNSHYQVHLVVHTGE--------KPYKCEICGKGFSQSSYLQIHQ--KAHSIEKPFKCEECGQGFNQSSRLQIHQL--IHTGEKPYKCEEC-------GKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQR---VHSGE-------KPFKCEECGKSFGRSAHLQAHQ-KVHTGDKP--YKCDECGKGFK----WSLNLDMHQRVHTGEKPYKCGECGKYFSQASSLQLHQSVHTGEK--PYKCDVCGKVFSRSSQLQSHQRVHTGEK--------PYKCEICGKSFSWRSNLTVHHRIHVG 779          

HSP 3 Score: 78.5666 bits (192), Expect = 9.632e-14
Identity = 54/168 (32.14%), Postives = 81/168 (48.21%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH---ESYRDDFG--NYLQIKQRGKPIK 5568
            + C +C + FG   +L +H K+H  D    +   C  C + F+  +    H + +   T  K Y+C  C K     + +  H  +H+ E    C++C K F + S    H R HTGEKPYKC+ICG  FS + N   H + H   +SY+ + G  N  +  Q  K IK
Sbjct:  643 FKCEECGKSFGRSAHLQAHQKVHTGD----KPYKCDECGKGFKWSLNLDMHQRVH---TGEKPYKCGECGKYFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTVHHRIHVGDKSYKSNRGGKNIRESTQEKKSIK 803          

HSP 4 Score: 78.1814 bits (191), Expect = 1.286e-13
Identity = 61/199 (30.65%), Postives = 90/199 (45.23%), Query Frame = 1
Query: 5005 DIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIKKVFNTEK 5589
            D      + NS   H +S+ R +  +K  Y C +C + F    NL  H ++H    T  +   C+ C + F        H   +   T  K Y CT+C K   + + +  H ++H+ E    C  C K F++ S+Y  HL  HTGEKPYKC+ICG  FS+                   +YLQI Q+   I+K F  E+
Sbjct:  394 DACGKSFSRNS---HLQSHQRVHTGEK-PYKCEECGKGFICSSNLYIHQRVH----TGEKPYKCEECGKGFSRPSSLQAHQGVH---TGEKSYICTVCGKGFTLSSNLQAHQRVHTGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKPYKCEICGKGFSQ------------------SSYLQIHQKAHSIEKPFKCEE 563          

HSP 5 Score: 68.5514 bits (166), Expect = 1.024e-10
Identity = 40/127 (31.50%), Postives = 61/127 (48.03%), Query Frame = 1
Query: 5098 CVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEF 5466
            C +C + F    +L +H K+H     + +   CK C + F  +     H K +   T  K Y C  C +     + + +H ++H+ E    C+ C K F + S+   H R HTGEKPYKC+ CG  F
Sbjct:  309 CDECGKEFSQGAHLQTHQKVH----VIEKPYKCKQCGKGFSRRSALNVHCKVH---TAEKPYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYKCEECGKGF 428          

HSP 6 Score: 67.781 bits (164), Expect = 1.856e-10
Identity = 56/187 (29.95%), Postives = 83/187 (44.39%), Query Frame = 1
Query: 5029 ENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHN--KDLT---------------------VNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIH-SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            +N  IL  + N+  +  QK  Y C +C + F  L + + H ++ +  K LT                     V EK+ C  C + F        H K +      K Y+C  C K  +    +N H K+H +E    CE C + F + S+  +H R HTGEKP+KC  CG  FS+    N HL+ H+
Sbjct:  232 DNMKILTFDHNSMIHTGQK-SYQCNECKKPFSDLSSFDLHQQLQSGEKSLTCVERGKGFCYSPVLPVHQKVHVGEKLKCDECGKEFSQGAHLQTHQKVH---VIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSR----NSHLQSHQ 410          

HSP 7 Score: 65.855 bits (159), Expect = 8.486e-10
Identity = 45/142 (31.69%), Postives = 68/142 (47.89%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C  C + F    + +S+++IH K  ++ +   C+ C Q F        H   +   T  K Y+C  C K     A +  H +IH+ E    CE C K F++ S  + H R H+GEKP+KC+ CG  F +  +   H K H
Sbjct:  531 YKCEICGKGF----SQSSYLQIHQKAHSIEKPFKCEECGQGFNQSSRLQIHQLIH---TGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVH 665          

HSP 8 Score: 56.9954 bits (136), Expect = 4.157e-7
Identity = 40/132 (30.30%), Postives = 59/132 (44.70%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSK 5472
            Y C +C + F    +L +H  +H    T  +   C  C + F        H + +   T  K Y+C  C K     N H ++H      E    CEIC K F + SY   H + H+ EKP+KC+ CG  F++
Sbjct:  447 YKCEECGKGFSRPSSLQAHQGVH----TGEKSYICTVCGKGFTLSSNLQAHQRVH---TGEKPYKCNECGKSFR-RNSHYQVHLVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKPFKCEECGQGFNQ 570          
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF845 (zinc finger protein 845 [Source:HGNC Symbol;Acc:HGNC:25112])

HSP 1 Score: 139.428 bits (350), Expect = 1.996e-32
Identity = 164/650 (25.23%), Postives = 257/650 (39.54%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADIL----RLHL-------DICD-GVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYK--RRTKRMNELSYMA------TGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSN----SQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H+KI+   +   C  C R F   +++  H   H G   +KC+     F+ M S   H      E+   CE   E    ++    +      + P +C+ C   F Q   L    RLH        + CD   SF +          GE L    + C  CG  +S+   L  H   H       CN C         +  H        + + G GK  +  C+ C+  +        H W  H           + E  YK  R  K     SY+A      +G K + C+ C+        +  +H  +  G   E    C  C   F     L+ H R   + +GE         + C++C   FG    ++ H  ++H    P  Y+C  C +  + +     HL  H   +  + C+EC   F  +++L+ H     G K    KC +C+K F      +Q  R+H  E+        P+ C  C + F   + L  H+ +H G    +C+ C K  +   A E+H+  H   + ++C+EC   F  K  + RH R+ H   +P  Y+C  CGK+  Q   ++ H  IH   + Y+C  CGK F  ++    H  IH GEKPY+C+ C + FN+K+ L  H   H
Sbjct:  373 HRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQTSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRIIHTGEKL----YKCNECGKTFSRKSSLTRHCRLHTGEKPYQCNECGKAFRGQSALIYH--------QAIHGIGK--LYKCNDCHQVFSNATTIANH-WRIH-----------NEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKS-NLQRHRRIHTG---EKPYRCNECGKTFSRKSYLTCHRR---LHTGE-------KPYKCNECGKTFGRNSALIIHK-AIHTGEKP--YKCNECGKAFSQKSSLTCHLRLHT-GEKPYKCEECDKVFSRKSSLEKHRRIHTGEK--PYKCKVCDKAFGRDSHLAQHTRIHTGEK--------PYKCNECGKNFRHNSALVIHKAIHSGEKPYKCNECGKTFRHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRL-HTGEKP--YKCNKCGKVFNQQAHLACHHRIHTGEKPYKCNECGKTFRHNSVLVIHKTIHTGEKPYKCNECGKVFNRKAKLARHHRIH 965          

HSP 2 Score: 131.724 bits (330), Expect = 4.789e-30
Identity = 172/732 (23.50%), Postives = 294/732 (40.16%), Query Frame = 1
Query: 1753 AKINPQIDKRNSIQTLYLAPNGMSTTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADIL----RLHL-------DICD-GVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVA--HSTSVHADSNPCLYECPHCPERMADRRL----WRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
             KI  Q++K  +  +L      +S   +   ++   N ++++SL         +E+   F    + K F+       + S+ R  HQ I+   +   C  CG+ F     +  H   H G   +KC+     F+   +   HH     E+   C    +T    +  +++ +    +   +C++C   F Q   L    RLH        + CD   SF +      K   GE      + C  C   +S+   L  H   H       CN C      +  +  H R  LH  E        K   C+ C++ +  K N   H+    G    P K ++  +     +T  +     + TG K + C+ C+        +  +H  +  G   E    C  C   F     L+ H R   + +GE         + C++C     FRG  A  +  ++H      LY+C  C +  ++       WRIH E     + ++ C+ C  +F++ + L +H  T  G K    KC  C++ FS    +    R+H  E+        P+ C  C + F  ++ L  H+ +H G    +C+ C K      A  +H+  H   + ++C EC   F  K ++  H+R+ H   +P  Y+C+ C K+ ++ S    H  IH   + Y+C+ C K F + ++  +H RIH GEKPY+C+ C + F   S L +H   H
Sbjct:  158 GKIGNQVEKSINSASLVSTSQRISCRPKTHISKNYGNNFLNSSLLTQKQEVHMREK--SFQCNESGKAFN-------YSSVLRK-HQIIHLGAKQYKCDVCGKVFNQKRYLACHRRCHTGKKPYKCNDCGKTFSQELTLTCHHRLHTGEKHYKCSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEECDKAFSFKSNLERHRKIHTGEKP----YKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRR--LHTGE--------KPYKCEECDEAFSFKSNLERHRRIHTG--EKPYKCNDCGKTF--SQTSSLVYHRRLHTGEKPYKCEECDEAFSFKS-NLERHRIIHTG---EKLYKCNECGKTFSRKSSLTRHCR---LHTGE-------KPYQCNECGKA--FRGQSALIYHQAIHGIGK--LYKCNDCHQVFSNATTIANHWRIHNE-----ERSYKCNRCGKFFRHRSYLAVHWRTHSGEK--PYKCEECDEAFSFKSNLQRHRRIHTGEK--------PYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGRNSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRL-HTGEKP--YKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIHTGEKPYKCNECGKNFRHNSALVIHKAIH 825          

HSP 3 Score: 115.546 bits (288), Expect = 4.740e-25
Identity = 147/671 (21.91%), Postives = 244/671 (36.36%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALT--------SECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDE------------------SAEPLYK--------RRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINA------------------GIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H +++   +   C  CG+ F  ++ +  H+  H G   +KC++    F+   SY  +H                    L+       C +CDK + +      L  H  I  G            +    +LT         + + C  CG  +S++  L  H   H       C  C         + +H R  +H  E        K   C+ C   +    +  YH+    G    P K +E                  + E LYK         R   +     + TG K + C  C    +  G+  + +    HG+       C  C  +F     +++H R ++ +     N                     +  + C++C     F+  +     +H    P  Y C  C +  + +     H   H   +  + C+EC   F   +AL +H     G K    KC+ C K FS    +  H L  H G     P+ C  C + F  ++ L+ H+ +H G    +C +C K          H   H   + ++C EC   FR   A+  H  + H   +P  Y+C  CGK     + + +H  IH   + Y+C  CGK F + A  + H R+H GEKPY+C+ C + FN++++L  H   H
Sbjct:  289 HHRLHTGEKHYKCSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQT-SYLVYHRR------------------LHTGEKPYKCEECDKAFSF---KSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRR--IHTGE--------KPYKCNDCGKTFSQTSSLVYHRRLHTG--EKPYKCEECDEAFSFKSNLERHRIIHTGEKLYKCNECGKTFSRKSSLTRHCRLHTGEKPYQCNECGKAFR--GQSALIYHQAIHGIGKLYK--CNDCHQVFSNATTIANHWRIHNEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKSNLQRHRRIHTGEKP--YRCNECGKTFSRKSYLTCHRRLHT-GEKPYKCNECGKTFGRNSALIIHKAIHTGEK--PYKCNECGKAFSQKSSLTCH-LRLHTG---EKPYKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIHTGEKPYKCNECGKNFRHNSALVIHKAI-HSGEKP--YKCNECGKTFRHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLHTGEKPYKCNKCGKVFNQQAHLACHHRIH 909          

HSP 4 Score: 93.5893 bits (231), Expect = 2.811e-18
Identity = 100/393 (25.45%), Postives = 164/393 (41.73%), Query Frame = 1
Query: 2734 KRMNELSYMA------TGMKKFSCKFCNAEVKVAGRDYVKHLDVK--HGL-TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEE---NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRD 3846
            K  N+  Y+A      TG K + C  C       G+ + + L +   H L T E    C  C   F     L  H         + I+ G +S + C++C         + +   +H    P  Y+C  C +  +    ++ +LE+H +    +  + C+EC   F  +++L  H     G K    KC+ C K FS    +    R+H  E+        P+ C  C E F F++ L+ H+ +H G    +C+ C K      +   HR  H   + ++C EC   F  K  + RH R+ H     + Y+C  CGK  ++   ++ H  +H   + YQC  CGK F   +    H  IH   K Y+C+ C + F+  + +  H   H + R 
Sbjct:  250 KVFNQKRYLACHRRCHTGKKPYKCNDC-------GKTFSQELTLTCHHRLHTGEKHYKCSECGKTFSRNSALVIH---------KAIHTGEKS-YKCNECGKTFSQTSYLVYHRRLHTGEKP--YKCEECDKAFS----FKSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEK--PYKCNDCGKTFSQMSSLVYHRRLHTGEK--------PYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQTSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERH-RIIHTG--EKLYKCNECGKTFSRKSSLTRHCRLHTGEKPYQCNECGKAFRGQSALIYHQAIHGIGKLYKCNDCHQVFSNATTIANHWRIHNEERS 606          

HSP 5 Score: 78.1814 bits (191), Expect = 1.430e-13
Identity = 44/131 (33.59%), Postives = 68/131 (51.91%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSK 5472
            Y C  C++VF     + +H +IHN++ +      C  C + F+++   A H +++   +  K Y+C  C +  +F   +  H +IH+ E    C  C K F +KSY   H R HTGEKPYKC  CG  F +
Sbjct:  579 YKCNDCHQVFSNATTIANHWRIHNEERSYK----CNRCGKFFRHRSYLAVHWRTH---SGEKPYKCEECDEAFSFKSNLQRHRRIHTGEKPYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGR 702          

HSP 6 Score: 74.3294 bits (181), Expect = 1.993e-12
Identity = 46/129 (35.66%), Postives = 65/129 (50.39%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEF 5466
            Y C +C + FG     NS + IH    T  +   C  C + F  K     H++ +   T  K Y+C  C KV +    + +H +IH+ E    C++CDK F + S+  +H R HTGEKPYKC  CG  F
Sbjct:  691 YKCNECGKTFGR----NSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRLH---TGEKPYKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIHTGEKPYKCNECGKNF 812          

HSP 7 Score: 74.3294 bits (181), Expect = 2.243e-12
Identity = 48/131 (36.64%), Postives = 65/131 (49.62%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSK 5472
            Y C +C++ F    NL  H KIH    T  +   C  CS+ F  K    +H + +   T  K Y+C  C K  + ++    H ++H+ E    CE CD+ F  KS    H R HTGEKPYKC  CG  FS+
Sbjct:  355 YKCEECDKAFSFKSNLERHRKIH----TGEKPYKCNECSRTFSRKSSLTRHRRLH---TGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQ 478          

HSP 8 Score: 70.8626 bits (172), Expect = 2.528e-11
Identity = 51/143 (35.66%), Postives = 67/143 (46.85%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            +Y C  C +VF   R L  H + H    T  +   C  C + F  ++    H + +   T  K Y+C+ C K  +  +    H  IH+ E S  C  C K F + SY V H R HTGEKPYKC+ C   FS K N   H K H
Sbjct:  242 QYKCDVCGKVFNQKRYLACHRRCH----TGKKPYKCNDCGKTFSQELTLTCHHRLH---TGEKHYKCSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEECDKAFSFKSNLERHRKIH 377          

HSP 9 Score: 70.0922 bits (170), Expect = 4.096e-11
Identity = 50/138 (36.23%), Postives = 68/138 (49.28%), Query Frame = 1
Query: 5104 KCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            KCNE   T R+ NS ++IH    T  +   C  C ++F  K   ++H + +   T  K Y+C  C KV    A +  H +IH+ E    C  C K F+  S  V H   HTGEKPYKC  CG  F++K     H + H
Sbjct:  832 KCNECGKTFRH-NSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLH---TGEKPYKCNKCGKVFNQQAHLACHHRIHTGEKPYKCNECGKTFRHNSVLVIHKTIHTGEKPYKCNECGKVFNRKAKLARHHRIH 965          

HSP 10 Score: 69.3218 bits (168), Expect = 7.162e-11
Identity = 57/192 (29.69%), Postives = 88/192 (45.83%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSEP-SIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH---ESYR-DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTSDYPDLELI 5643
            Y C +C + F    +L  H ++H    T  +   C  C + F+ +     H ++ H +   K Y+C  C +V +    I  H +IH+E  S  C  C K F+ +SY   H R H+GEKPYKC+ C   FS K N   H + H   + YR ++ G     K      +++   EK     +CG +   +  LI
Sbjct:  523 YKCNECGKTFSRKSSLTRHCRLH----TGEKPYQCNECGKAFRGQSALIYH-QAIHGIG--KLYKCNDCHQVFSNATTIANHWRIHNEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKSNLQRHRRIHTGEKPYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGRNSALI 707          

HSP 11 Score: 67.781 bits (164), Expect = 2.284e-10
Identity = 47/142 (33.10%), Postives = 67/142 (47.18%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C + F     L  H ++H    T  +   C  C + F        H K+ H  T  K Y+C  C K  +    +  H+++H+ E    CE CDK F +KS   +H R HTGEKPYKCK+C   F +  +   H + H
Sbjct:  663 YRCNECGKTFSRKSYLTCHRRLH----TGEKPYKCNECGKTFGRNSALIIH-KAIH--TGEKPYKCNECGKAFSQKSSLTCHLRLHTGEKPYKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIH 797          

HSP 12 Score: 65.855 bits (159), Expect = 7.534e-10
Identity = 48/145 (33.10%), Postives = 65/145 (44.83%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            K  Y C  C + F     L  H ++H    T  +   C  C + F        H K+ H  T  K Y+C  C K     +++  H ++H+ E    CE CDK F  KS    H + HTGEKPYKC  C   FS+K +   H + H
Sbjct:  268 KKPYKCNDCGKTFSQELTLTCHHRLH----TGEKHYKCSECGKTFSRNSALVIH-KAIH--TGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEECDKAFSFKSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLH 405          

HSP 13 Score: 65.4698 bits (158), Expect = 9.712e-10
Identity = 49/142 (34.51%), Postives = 67/142 (47.18%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C++VF    +L  H +IH    T  +   CK C + F      A+H + +   T  K Y+C  C K     + +  H  IHS E    C  C K F+  S    H   HTGEKPYKC  CG  F++K N + H + H
Sbjct:  747 YKCEECDKVFSRKSSLEKHRRIH----TGEKPYKCKVCDKAFGRDSHLAQHTRIH---TGEKPYKCNECGKNFRHNSALVIHKAIHSGEKPYKCNECGKTFRHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLH 881          

HSP 14 Score: 64.3142 bits (155), Expect = 2.170e-9
Identity = 46/142 (32.39%), Postives = 65/142 (45.77%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C + F     L  H ++H    T  +   C+ C + F  K    +H K +   T  K Y+C  C +     + +  H ++H+ E    C  C K F + S  V H R HTGEKPYKC+ C   FS K N   H + H
Sbjct:  327 YKCNECGKTFSQTSYLVYHRRLH----TGEKPYKCEECDKAFSFKSNLERHRKIH---TGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIH 461          

HSP 15 Score: 62.7734 bits (151), Expect = 7.722e-9
Identity = 45/142 (31.69%), Postives = 66/142 (46.48%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C  C + F  + +L  H ++H    T  +   C+ C + F  K    +H + +   T  K Y+C  C K  +  +    H ++H+ E    CE CD+ F  KS    H   HTGEK YKC  CG  FS+K +   H + H
Sbjct:  411 YKCNDCGKTFSQMSSLVYHRRLH----TGEKPYKCEECDEAFSFKSNLERHRRIH---TGEKPYKCNDCGKTFSQTSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRIIHTGEKLYKCNECGKTFSRKSSLTRHCRLH 545          
BLAST of Zinc finger protein vs. Ensembl Human
Match: ZNF845 (zinc finger protein 845 [Source:HGNC Symbol;Acc:HGNC:25112])

HSP 1 Score: 139.428 bits (350), Expect = 1.996e-32
Identity = 164/650 (25.23%), Postives = 257/650 (39.54%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADIL----RLHL-------DICD-GVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYK--RRTKRMNELSYMA------TGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSN----SQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H+KI+   +   C  C R F   +++  H   H G   +KC+     F+ M S   H      E+   CE   E    ++    +      + P +C+ C   F Q   L    RLH        + CD   SF +          GE L    + C  CG  +S+   L  H   H       CN C         +  H        + + G GK  +  C+ C+  +        H W  H           + E  YK  R  K     SY+A      +G K + C+ C+        +  +H  +  G   E    C  C   F     L+ H R   + +GE         + C++C   FG    ++ H  ++H    P  Y+C  C +  + +     HL  H   +  + C+EC   F  +++L+ H     G K    KC +C+K F      +Q  R+H  E+        P+ C  C + F   + L  H+ +H G    +C+ C K  +   A E+H+  H   + ++C+EC   F  K  + RH R+ H   +P  Y+C  CGK+  Q   ++ H  IH   + Y+C  CGK F  ++    H  IH GEKPY+C+ C + FN+K+ L  H   H
Sbjct:  373 HRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQTSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRIIHTGEKL----YKCNECGKTFSRKSSLTRHCRLHTGEKPYQCNECGKAFRGQSALIYH--------QAIHGIGK--LYKCNDCHQVFSNATTIANH-WRIH-----------NEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKS-NLQRHRRIHTG---EKPYRCNECGKTFSRKSYLTCHRR---LHTGE-------KPYKCNECGKTFGRNSALIIHK-AIHTGEKP--YKCNECGKAFSQKSSLTCHLRLHT-GEKPYKCEECDKVFSRKSSLEKHRRIHTGEK--PYKCKVCDKAFGRDSHLAQHTRIHTGEK--------PYKCNECGKNFRHNSALVIHKAIHSGEKPYKCNECGKTFRHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRL-HTGEKP--YKCNKCGKVFNQQAHLACHHRIHTGEKPYKCNECGKTFRHNSVLVIHKTIHTGEKPYKCNECGKVFNRKAKLARHHRIH 965          

HSP 2 Score: 131.724 bits (330), Expect = 4.789e-30
Identity = 172/732 (23.50%), Postives = 294/732 (40.16%), Query Frame = 1
Query: 1753 AKINPQIDKRNSIQTLYLAPNGMSTTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADIL----RLHL-------DICD-GVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVA--HSTSVHADSNPCLYECPHCPERMADRRL----WRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
             KI  Q++K  +  +L      +S   +   ++   N ++++SL         +E+   F    + K F+       + S+ R  HQ I+   +   C  CG+ F     +  H   H G   +KC+     F+   +   HH     E+   C    +T    +  +++ +    +   +C++C   F Q   L    RLH        + CD   SF +      K   GE      + C  C   +S+   L  H   H       CN C      +  +  H R  LH  E        K   C+ C++ +  K N   H+    G    P K ++  +     +T  +     + TG K + C+ C+        +  +H  +  G   E    C  C   F     L+ H R   + +GE         + C++C     FRG  A  +  ++H      LY+C  C +  ++       WRIH E     + ++ C+ C  +F++ + L +H  T  G K    KC  C++ FS    +    R+H  E+        P+ C  C + F  ++ L  H+ +H G    +C+ C K      A  +H+  H   + ++C EC   F  K ++  H+R+ H   +P  Y+C+ C K+ ++ S    H  IH   + Y+C+ C K F + ++  +H RIH GEKPY+C+ C + F   S L +H   H
Sbjct:  158 GKIGNQVEKSINSASLVSTSQRISCRPKTHISKNYGNNFLNSSLLTQKQEVHMREK--SFQCNESGKAFN-------YSSVLRK-HQIIHLGAKQYKCDVCGKVFNQKRYLACHRRCHTGKKPYKCNDCGKTFSQELTLTCHHRLHTGEKHYKCSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEECDKAFSFKSNLERHRKIHTGEKP----YKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRR--LHTGE--------KPYKCEECDEAFSFKSNLERHRRIHTG--EKPYKCNDCGKTF--SQTSSLVYHRRLHTGEKPYKCEECDEAFSFKS-NLERHRIIHTG---EKLYKCNECGKTFSRKSSLTRHCR---LHTGE-------KPYQCNECGKA--FRGQSALIYHQAIHGIGK--LYKCNDCHQVFSNATTIANHWRIHNE-----ERSYKCNRCGKFFRHRSYLAVHWRTHSGEK--PYKCEECDEAFSFKSNLQRHRRIHTGEK--------PYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGRNSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRL-HTGEKP--YKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIHTGEKPYKCNECGKNFRHNSALVIHKAIH 825          

HSP 3 Score: 115.546 bits (288), Expect = 4.740e-25
Identity = 147/671 (21.91%), Postives = 244/671 (36.36%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALT--------SECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDE------------------SAEPLYK--------RRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINA------------------GIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H +++   +   C  CG+ F  ++ +  H+  H G   +KC++    F+   SY  +H                    L+       C +CDK + +      L  H  I  G            +    +LT         + + C  CG  +S++  L  H   H       C  C         + +H R  +H  E        K   C+ C   +    +  YH+    G    P K +E                  + E LYK         R   +     + TG K + C  C    +  G+  + +    HG+       C  C  +F     +++H R ++ +     N                     +  + C++C     F+  +     +H    P  Y C  C +  + +     H   H   +  + C+EC   F   +AL +H     G K    KC+ C K FS    +  H L  H G     P+ C  C + F  ++ L+ H+ +H G    +C +C K          H   H   + ++C EC   FR   A+  H  + H   +P  Y+C  CGK     + + +H  IH   + Y+C  CGK F + A  + H R+H GEKPY+C+ C + FN++++L  H   H
Sbjct:  289 HHRLHTGEKHYKCSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQT-SYLVYHRR------------------LHTGEKPYKCEECDKAFSF---KSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRR--IHTGE--------KPYKCNDCGKTFSQTSSLVYHRRLHTG--EKPYKCEECDEAFSFKSNLERHRIIHTGEKLYKCNECGKTFSRKSSLTRHCRLHTGEKPYQCNECGKAFR--GQSALIYHQAIHGIGKLYK--CNDCHQVFSNATTIANHWRIHNEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKSNLQRHRRIHTGEKP--YRCNECGKTFSRKSYLTCHRRLHT-GEKPYKCNECGKTFGRNSALIIHKAIHTGEK--PYKCNECGKAFSQKSSLTCH-LRLHTG---EKPYKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIHTGEKPYKCNECGKNFRHNSALVIHKAI-HSGEKP--YKCNECGKTFRHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLHTGEKPYKCNKCGKVFNQQAHLACHHRIH 909          

HSP 4 Score: 93.5893 bits (231), Expect = 2.811e-18
Identity = 100/393 (25.45%), Postives = 164/393 (41.73%), Query Frame = 1
Query: 2734 KRMNELSYMA------TGMKKFSCKFCNAEVKVAGRDYVKHLDVK--HGL-TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEE---NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRD 3846
            K  N+  Y+A      TG K + C  C       G+ + + L +   H L T E    C  C   F     L  H         + I+ G +S + C++C         + +   +H    P  Y+C  C +  +    ++ +LE+H +    +  + C+EC   F  +++L  H     G K    KC+ C K FS    +    R+H  E+        P+ C  C E F F++ L+ H+ +H G    +C+ C K      +   HR  H   + ++C EC   F  K  + RH R+ H     + Y+C  CGK  ++   ++ H  +H   + YQC  CGK F   +    H  IH   K Y+C+ C + F+  + +  H   H + R 
Sbjct:  250 KVFNQKRYLACHRRCHTGKKPYKCNDC-------GKTFSQELTLTCHHRLHTGEKHYKCSECGKTFSRNSALVIH---------KAIHTGEKS-YKCNECGKTFSQTSYLVYHRRLHTGEKP--YKCEECDKAFS----FKSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEK--PYKCNDCGKTFSQMSSLVYHRRLHTGEK--------PYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQTSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERH-RIIHTG--EKLYKCNECGKTFSRKSSLTRHCRLHTGEKPYQCNECGKAFRGQSALIYHQAIHGIGKLYKCNDCHQVFSNATTIANHWRIHNEERS 606          

HSP 5 Score: 78.1814 bits (191), Expect = 1.430e-13
Identity = 44/131 (33.59%), Postives = 68/131 (51.91%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSK 5472
            Y C  C++VF     + +H +IHN++ +      C  C + F+++   A H +++   +  K Y+C  C +  +F   +  H +IH+ E    C  C K F +KSY   H R HTGEKPYKC  CG  F +
Sbjct:  579 YKCNDCHQVFSNATTIANHWRIHNEERSYK----CNRCGKFFRHRSYLAVHWRTH---SGEKPYKCEECDEAFSFKSNLQRHRRIHTGEKPYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGR 702          

HSP 6 Score: 74.3294 bits (181), Expect = 1.993e-12
Identity = 46/129 (35.66%), Postives = 65/129 (50.39%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEF 5466
            Y C +C + FG     NS + IH    T  +   C  C + F  K     H++ +   T  K Y+C  C KV +    + +H +IH+ E    C++CDK F + S+  +H R HTGEKPYKC  CG  F
Sbjct:  691 YKCNECGKTFGR----NSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRLH---TGEKPYKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIHTGEKPYKCNECGKNF 812          

HSP 7 Score: 74.3294 bits (181), Expect = 2.243e-12
Identity = 48/131 (36.64%), Postives = 65/131 (49.62%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSK 5472
            Y C +C++ F    NL  H KIH    T  +   C  CS+ F  K    +H + +   T  K Y+C  C K  + ++    H ++H+ E    CE CD+ F  KS    H R HTGEKPYKC  CG  FS+
Sbjct:  355 YKCEECDKAFSFKSNLERHRKIH----TGEKPYKCNECSRTFSRKSSLTRHRRLH---TGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQ 478          

HSP 8 Score: 70.8626 bits (172), Expect = 2.528e-11
Identity = 51/143 (35.66%), Postives = 67/143 (46.85%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            +Y C  C +VF   R L  H + H    T  +   C  C + F  ++    H + +   T  K Y+C+ C K  +  +    H  IH+ E S  C  C K F + SY V H R HTGEKPYKC+ C   FS K N   H K H
Sbjct:  242 QYKCDVCGKVFNQKRYLACHRRCH----TGKKPYKCNDCGKTFSQELTLTCHHRLH---TGEKHYKCSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEECDKAFSFKSNLERHRKIH 377          

HSP 9 Score: 70.0922 bits (170), Expect = 4.096e-11
Identity = 50/138 (36.23%), Postives = 68/138 (49.28%), Query Frame = 1
Query: 5104 KCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            KCNE   T R+ NS ++IH    T  +   C  C ++F  K   ++H + +   T  K Y+C  C KV    A +  H +IH+ E    C  C K F+  S  V H   HTGEKPYKC  CG  F++K     H + H
Sbjct:  832 KCNECGKTFRH-NSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLH---TGEKPYKCNKCGKVFNQQAHLACHHRIHTGEKPYKCNECGKTFRHNSVLVIHKTIHTGEKPYKCNECGKVFNRKAKLARHHRIH 965          

HSP 10 Score: 69.3218 bits (168), Expect = 7.162e-11
Identity = 57/192 (29.69%), Postives = 88/192 (45.83%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSEP-SIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH---ESYR-DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTSDYPDLELI 5643
            Y C +C + F    +L  H ++H    T  +   C  C + F+ +     H ++ H +   K Y+C  C +V +    I  H +IH+E  S  C  C K F+ +SY   H R H+GEKPYKC+ C   FS K N   H + H   + YR ++ G     K      +++   EK     +CG +   +  LI
Sbjct:  523 YKCNECGKTFSRKSSLTRHCRLH----TGEKPYQCNECGKAFRGQSALIYH-QAIHGIG--KLYKCNDCHQVFSNATTIANHWRIHNEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKSNLQRHRRIHTGEKPYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGRNSALI 707          

HSP 11 Score: 67.781 bits (164), Expect = 2.284e-10
Identity = 47/142 (33.10%), Postives = 67/142 (47.18%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C + F     L  H ++H    T  +   C  C + F        H K+ H  T  K Y+C  C K  +    +  H+++H+ E    CE CDK F +KS   +H R HTGEKPYKCK+C   F +  +   H + H
Sbjct:  663 YRCNECGKTFSRKSYLTCHRRLH----TGEKPYKCNECGKTFGRNSALIIH-KAIH--TGEKPYKCNECGKAFSQKSSLTCHLRLHTGEKPYKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIH 797          

HSP 12 Score: 65.855 bits (159), Expect = 7.534e-10
Identity = 48/145 (33.10%), Postives = 65/145 (44.83%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            K  Y C  C + F     L  H ++H    T  +   C  C + F        H K+ H  T  K Y+C  C K     +++  H ++H+ E    CE CDK F  KS    H + HTGEKPYKC  C   FS+K +   H + H
Sbjct:  268 KKPYKCNDCGKTFSQELTLTCHHRLH----TGEKHYKCSECGKTFSRNSALVIH-KAIH--TGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEECDKAFSFKSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLH 405          

HSP 13 Score: 65.4698 bits (158), Expect = 9.712e-10
Identity = 49/142 (34.51%), Postives = 67/142 (47.18%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C++VF    +L  H +IH    T  +   CK C + F      A+H + +   T  K Y+C  C K     + +  H  IHS E    C  C K F+  S    H   HTGEKPYKC  CG  F++K N + H + H
Sbjct:  747 YKCEECDKVFSRKSSLEKHRRIH----TGEKPYKCKVCDKAFGRDSHLAQHTRIH---TGEKPYKCNECGKNFRHNSALVIHKAIHSGEKPYKCNECGKTFRHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLH 881          

HSP 14 Score: 64.3142 bits (155), Expect = 2.170e-9
Identity = 46/142 (32.39%), Postives = 65/142 (45.77%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C + F     L  H ++H    T  +   C+ C + F  K    +H K +   T  K Y+C  C +     + +  H ++H+ E    C  C K F + S  V H R HTGEKPYKC+ C   FS K N   H + H
Sbjct:  327 YKCNECGKTFSQTSYLVYHRRLH----TGEKPYKCEECDKAFSFKSNLERHRKIH---TGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIH 461          

HSP 15 Score: 62.7734 bits (151), Expect = 7.722e-9
Identity = 45/142 (31.69%), Postives = 66/142 (46.48%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C  C + F  + +L  H ++H    T  +   C+ C + F  K    +H + +   T  K Y+C  C K  +  +    H ++H+ E    CE CD+ F  KS    H   HTGEK YKC  CG  FS+K +   H + H
Sbjct:  411 YKCNDCGKTFSQMSSLVYHRRLH----TGEKPYKCEECDEAFSFKSNLERHRRIH---TGEKPYKCNDCGKTFSQTSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRIIHTGEKLYKCNECGKTFSRKSSLTRHCRLH 545          
BLAST of Zinc finger protein vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058845:1063187:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 86.2705 bits (212), Expect = 1.395e-16
Identity = 78/320 (24.38%), Postives = 127/320 (39.69%), Query Frame = 1
Query: 2878 LCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHL----NLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVH 3819
            +C +C   F     L  H R +H     Y     Q  F+  K T   H R         H    P  Y+C +C +  A      +H +        + C +C     + +AL  H +T HG K    +C  C K F+    +++H+ + HE     +   C  C + F +   LQ H   H G     C  C K   S    + H   H   R + C  CQ TF  K  +  H    HL    ++ P+     I   +   ++ H ++     Y+C +C K++  ++    H+R H  +  Y C  C + +++K +LN+H
Sbjct:  105 ICTVCGKGFSYFSILESHKR-SHTGEKPYNCHFCQKTFA-QKATLQVHER--------THTGERP--YKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKT-HGDK--TFRCDFCPKTFALKNYLKLHVKQVHEQNERKH--VCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAH-ESTHLTQKHSVNPDSTTADIL-PVAGSVTDHQMV---GNYECTFCNKKYPYASSLYIHMRKHTEKSAYSCDGCGKPYSQKISLNIH 402          

HSP 2 Score: 85.5001 bits (210), Expect = 1.983e-16
Identity = 66/227 (29.07%), Postives = 98/227 (43.17%), Query Frame = 1
Query: 3172 CDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQE-VHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            C  C   F   + L+ H  +  G K     C  C+K F+    ++VH    H G     P+ C  C++ F        H++  H G+   +C  C K+  S  A   H+  H   + F+C  C  TF  K  ++ H++  H   E  ++ C  C K       + +H+  H   R Y C++C K F        H R H GE+PY C  CQR F +KS L  H + H
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEK--PYNCHFCQKTFAQKATLQVH-ERTHTG---ERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTH-GDKTFRCDFCPKTFALKNYLKLHVKQVHEQNE-RKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTH 324          

HSP 3 Score: 78.1814 bits (191), Expect = 3.631e-14
Identity = 57/204 (27.94%), Postives = 87/204 (42.65%), Query Frame = 1
Query: 3262 CSICEKDFSNSQEIRVHILEEHEGC-VELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELH-RMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVT-----QISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            C++C K FS        ILE H+       P++C  CQ+ F  +  LQ H+  H G    +C  C+K         +H +  H   R ++C +C     S  A+  H +  H +   + + C  C K        ++ +  +  +N R + C YC K F  +     HVR H GE+PY C  C + F  + NL  H   H   R
Sbjct:  106 CTVCGKGFS-----YFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKT-HGD---KTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGER 300          

HSP 4 Score: 65.4698 bits (158), Expect = 3.246e-10
Identity = 42/142 (29.58%), Postives = 62/142 (43.66%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C KC+++  +   L +H K H      ++   C  C + F  K     H+K  H   E +K+ C  C K  A+      H++ H+ E    C+ C K F  +     H R HTGE+PY C+ C   F +K     H   H
Sbjct:  189 YKCPKCDKLLSSPSALYTHKKTHG-----DKTFRCDFCPKTFALKNYLKLHVKQVHEQNE-RKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTH 324          

HSP 5 Score: 64.3142 bits (155), Expect = 7.053e-10
Identity = 65/268 (24.25%), Postives = 102/268 (38.06%), Query Frame = 1
Query: 3136 LEKHEEN---QLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG-MMQCDLCQKVCKSMKAYELH--RMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEK-------------P-------------YECHICQRRFNKKSNLNVHINFH 3831
            LE H+ +   +  + C  CQ  F  +A L++H  T  G  +   KC  CEK F+      VH    H G   +  + C  C +     + L  H++ HG    +CD C K        +LH  ++     R   C  C   F    +++ H+R  H    P  Y C+ C K       +  H   H   R Y C++C + F + +    H   H  +K             P             YEC  C +++   S+L +H+  H
Sbjct:  119 LESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTG--ERPYKCRYCEKTFAQYGTKTVHEKSAHLG---IRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRT-HTGERP--YVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAGSVTDHQMVGNYECTFCNKKYPYASSLYIHMRKH 378          

HSP 6 Score: 60.8474 bits (146), Expect = 7.938e-9
Identity = 50/188 (26.60%), Postives = 76/188 (40.43%), Query Frame = 1
Query: 5053 ESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSEPSIACEICDKKFKKKSY---YVE---------------------------HLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            ES+ R++  +K  YNC  C + F     L  H + H    T      C++C + F        H KS H     + Y+C  C K+++    +  H K H + +  C+ C K F  K+Y   +V+                           H+R HTGE+PY CK C   F+ + N   H + H   R
Sbjct:  120 ESHKRSHTGEK-PYNCHFCQKTFAQKATLQVHERTH----TGERPYKCRYCEKTFAQYGTKTVHEKSAH--LGIRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGER 300          

HSP 7 Score: 55.0694 bits (131), Expect = 5.657e-7
Identity = 25/56 (44.64%), Postives = 31/56 (55.36%), Query Frame = 1
Query: 3676 RYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            R+ C  CGK F+  +    H R H GEKPY CH CQ+ F +K+ L VH   H   R
Sbjct:  103 RHICTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGER 158          
BLAST of Zinc finger protein vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058695:1067525:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 86.2705 bits (212), Expect = 1.395e-16
Identity = 78/320 (24.38%), Postives = 127/320 (39.69%), Query Frame = 1
Query: 2878 LCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHL----NLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVH 3819
            +C +C   F     L  H R +H     Y     Q  F+  K T   H R         H    P  Y+C +C +  A      +H +        + C +C     + +AL  H +T HG K    +C  C K F+    +++H+ + HE     +   C  C + F +   LQ H   H G     C  C K   S    + H   H   R + C  CQ TF  K  +  H    HL    ++ P+     I   +   ++ H ++     Y+C +C K++  ++    H+R H  +  Y C  C + +++K +LN+H
Sbjct:  105 ICTVCGKGFSYFSILESHKR-SHTGEKPYNCHFCQKTFA-QKATLQVHER--------THTGERP--YKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKT-HGDK--TFRCDFCPKTFALKNYLKLHVKQVHEQNERKH--VCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAH-ESTHLTQKHSVNPDSTTADIL-PVAGSVTDHQMV---GNYECTFCNKKYPYASSLYIHMRKHTEKSAYSCDGCGKPYSQKISLNIH 402          

HSP 2 Score: 85.5001 bits (210), Expect = 1.983e-16
Identity = 66/227 (29.07%), Postives = 98/227 (43.17%), Query Frame = 1
Query: 3172 CDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQE-VHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            C  C   F   + L+ H  +  G K     C  C+K F+    ++VH    H G     P+ C  C++ F        H++  H G+   +C  C K+  S  A   H+  H   + F+C  C  TF  K  ++ H++  H   E  ++ C  C K       + +H+  H   R Y C++C K F        H R H GE+PY C  CQR F +KS L  H + H
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEK--PYNCHFCQKTFAQKATLQVH-ERTHTG---ERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTH-GDKTFRCDFCPKTFALKNYLKLHVKQVHEQNE-RKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTH 324          

HSP 3 Score: 78.1814 bits (191), Expect = 3.631e-14
Identity = 57/204 (27.94%), Postives = 87/204 (42.65%), Query Frame = 1
Query: 3262 CSICEKDFSNSQEIRVHILEEHEGC-VELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELH-RMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVT-----QISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            C++C K FS        ILE H+       P++C  CQ+ F  +  LQ H+  H G    +C  C+K         +H +  H   R ++C +C     S  A+  H +  H +   + + C  C K        ++ +  +  +N R + C YC K F  +     HVR H GE+PY C  C + F  + NL  H   H   R
Sbjct:  106 CTVCGKGFS-----YFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKT-HGD---KTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGER 300          

HSP 4 Score: 65.4698 bits (158), Expect = 3.246e-10
Identity = 42/142 (29.58%), Postives = 62/142 (43.66%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C KC+++  +   L +H K H      ++   C  C + F  K     H+K  H   E +K+ C  C K  A+      H++ H+ E    C+ C K F  +     H R HTGE+PY C+ C   F +K     H   H
Sbjct:  189 YKCPKCDKLLSSPSALYTHKKTHG-----DKTFRCDFCPKTFALKNYLKLHVKQVHEQNE-RKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTH 324          

HSP 5 Score: 64.3142 bits (155), Expect = 7.053e-10
Identity = 65/268 (24.25%), Postives = 102/268 (38.06%), Query Frame = 1
Query: 3136 LEKHEEN---QLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG-MMQCDLCQKVCKSMKAYELH--RMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEK-------------P-------------YECHICQRRFNKKSNLNVHINFH 3831
            LE H+ +   +  + C  CQ  F  +A L++H  T  G  +   KC  CEK F+      VH    H G   +  + C  C +     + L  H++ HG    +CD C K        +LH  ++     R   C  C   F    +++ H+R  H    P  Y C+ C K       +  H   H   R Y C++C + F + +    H   H  +K             P             YEC  C +++   S+L +H+  H
Sbjct:  119 LESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTG--ERPYKCRYCEKTFAQYGTKTVHEKSAHLG---IRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRT-HTGERP--YVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAGSVTDHQMVGNYECTFCNKKYPYASSLYIHMRKH 378          

HSP 6 Score: 60.8474 bits (146), Expect = 7.938e-9
Identity = 50/188 (26.60%), Postives = 76/188 (40.43%), Query Frame = 1
Query: 5053 ESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSEPSIACEICDKKFKKKSY---YVE---------------------------HLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            ES+ R++  +K  YNC  C + F     L  H + H    T      C++C + F        H KS H     + Y+C  C K+++    +  H K H + +  C+ C K F  K+Y   +V+                           H+R HTGE+PY CK C   F+ + N   H + H   R
Sbjct:  120 ESHKRSHTGEK-PYNCHFCQKTFAQKATLQVHERTH----TGERPYKCRYCEKTFAQYGTKTVHEKSAH--LGIRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGER 300          

HSP 7 Score: 55.0694 bits (131), Expect = 5.657e-7
Identity = 25/56 (44.64%), Postives = 31/56 (55.36%), Query Frame = 1
Query: 3676 RYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            R+ C  CGK F+  +    H R H GEKPY CH CQ+ F +K+ L VH   H   R
Sbjct:  103 RHICTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGER 158          
BLAST of Zinc finger protein vs. Ensembl Celegans
Match: pag-3 (Zinc finger protein PAG-3 [Source:UniProtKB/TrEMBL;Acc:G5EDE1])

HSP 1 Score: 82.8037 bits (203), Expect = 2.666e-16
Identity = 42/112 (37.50%), Postives = 67/112 (59.82%), Query Frame = 1
Query: 3508 RIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            + F C +C   F +  A+ +H +V   ++  +++EC+ CGK     + +S H+LIH + R Y CEYCGKRF + +   +H  IH GEKP++C +C + F++ SNL  H   H
Sbjct:  124 KPFHCQKCTKLFSTIAALEQHQQV---HVSDKQFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKH 232          

HSP 2 Score: 77.0258 bits (188), Expect = 1.988e-14
Identity = 42/143 (29.37%), Postives = 71/143 (49.65%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
             ++C KC ++F T+  L  H ++H  D    ++  CK C + F+     + H+  +   ++T+ Y C  C K     + + +H  IH+ E    C +C K F + S  + H R HTG KP+ C +CG  F +K +   H + H
Sbjct:  125 PFHCQKCTKLFSTIAALEQHQQVHVSD----KQFECKQCGKTFKRSSTLSTHLLIH---SDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRESH 260          

HSP 3 Score: 74.3294 bits (181), Expect = 1.802e-13
Identity = 44/136 (32.35%), Postives = 67/136 (49.26%), Query Frame = 1
Query: 3436 CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            C  C K+  ++ A E H+  H   + F+C +C  TF+    +  H+ + H +  P  Y C+ CGK   Q S    H  IH   + ++C  CGK F++S+    H R H G KP+ C +C R F +K +   H   H
Sbjct:  128 CQKCTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFKRSSTLSTHLLI-HSDTRP--YPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRESH 260          

HSP 4 Score: 57.3806 bits (137), Expect = 5.284e-8
Identity = 47/163 (28.83%), Postives = 71/163 (43.56%), Query Frame = 1
Query: 3166 FTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMM--QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS 3648
            F C +C   F   AAL+ H +     KQ   +C  C K F  S  +  H+L   +      P+ C  C ++F  +++++ H  +H G    +C +C K          H  KH   + F C  C  TF+ K+  RRH R  H    PE  EC    +I + +S
Sbjct:  126 FHCQKCTKLFSTIAALEQHQQVHVSDKQ--FECKQCGKTFKRSSTLSTHLLIHSD----TRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRH-RESHHPGHPE--ECVSASQISSDLS 279          
BLAST of Zinc finger protein vs. Ensembl Celegans
Match: zfp-2 (Zinc finger protein zfp-2 [Source:UniProtKB/Swiss-Prot;Acc:Q20082])

HSP 1 Score: 78.1814 bits (191), Expect = 1.674e-14
Identity = 59/196 (30.10%), Postives = 85/196 (43.37%), Query Frame = 1
Query: 3259 KCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHG---GMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEK 3837
            +C+ C+  F N +  + HI E H    +  PF CF C  +F  +  +  H + H     M  CD C ++   +++   H   HF TR   C  C   F ++ A+R H    H    P  ++     + +      +   K+ARY C YC  RF        H RIH GEKPY C  C + F +   L  HI  H K
Sbjct:  172 RCTNCKTYFGNKEVYQRHIQEVHG---DARPFRCFNCGMRFANKTSMTHHLKDHSLLKPMFSCDYCPRIFSKLESKTRHHKMHF-TRS-TCQTCMRFFTTEDALRHHQSTAH----PATFDSGPPPEDL------LPNGKSARYSCSYCNLRFHFKKDMLVHERIHTGEKPYSCGYCMKSFAQSQALTAHIRTHTK 352          

HSP 2 Score: 65.4698 bits (158), Expect = 2.107e-10
Identity = 52/222 (23.42%), Postives = 85/222 (38.29%), Query Frame = 1
Query: 2974 GIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYP-------------FSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLN 3591
             +  ++ C  C T+FG+      H   VH D+ P  + C +C  R A++     HL+ H   +  F+CD C   F    +   H    H +      C  C + F+    +R H    H    +  P             +SC  C  +F F+ ++  H+ +H G     C  C K     +A   H   H +   + C +C   FR    +R+H    H +
Sbjct:  166 ALAGLYRCTNCKTYFGNKEVYQRHIQEVHGDARP--FRCFNCGMRFANKTSMTHHLKDHSLLKPMFSCDYCPRIFSKLESKTRH----HKMHFTRSTCQTCMRFFTTEDALRHHQSTAHPATFDSGPPPEDLLPNGKSARYSCSYCNLRFHFKKDMLVHERIHTGEKPYSCGYCMKSFAQSQALTAHIRTHTKELPYGCGKCDKRFRDNSCLRKHELAAHTD 381          

HSP 3 Score: 51.2174 bits (121), Expect = 5.409e-6
Identity = 41/160 (25.62%), Postives = 64/160 (40.00%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLT--------------ETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            K  ++C  C  +F  L +   H K+H    T      C+ C + F  +     H  + H  T              ++ +Y C+ C     F  +   H +IH+ E   +C  C K F +      H+R HT E PY C  C     K++  N  L++HE
Sbjct:  226 KPMFSCDYCPRIFSKLESKTRHHKMHFTRST------CQTCMRFFTTEDALRHHQSTAHPATFDSGPPPEDLLPNGKSARYSCSYCNLRFHFKKDMLVHERIHTGEKPYSCGYCMKSFAQSQALTAHIRTHTKELPYGCGKC----DKRFRDNSCLRKHE 375          
BLAST of Zinc finger protein vs. Ensembl Celegans
Match: fezf-1 (FEZ Family zinc finger protein [Source:UniProtKB/TrEMBL;Acc:O62425])

HSP 1 Score: 69.3218 bits (168), Expect = 1.238e-12
Identity = 41/111 (36.94%), Postives = 61/111 (54.95%), Query Frame = 1
Query: 3514 FQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHE 3834
            F C  C   F +   + RH+ V H    P  + C++CGK   Q S    H +IH +++ ++C+ CGK F +S+  N HVRIH+G KP+ C IC + F++  N   H   HE
Sbjct:   52 FPCEICGKQFNAHYNLTRHMPV-HTGERP--FVCKVCGKAFRQASTLCRHKIIHTDSKPHKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHE 159          

HSP 2 Score: 67.3958 bits (163), Expect = 6.229e-12
Identity = 43/143 (30.07%), Postives = 70/143 (48.95%), Query Frame = 1
Query: 3430 MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRD 3846
              C++C K   +      H   H   R F C  C   FR    + RH ++ H + +P  ++C+ CGK     + ++ H+ IH+  + + CE CGK F ++  Y  H   H+  K + C IC R F++  NL  H+  HE+H+ 
Sbjct:   52 FPCEICGKQFNAHYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRH-KIIHTDSKP--HKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLAFHMFTHEEHKP 191          

HSP 3 Score: 66.6254 bits (161), Expect = 1.194e-11
Identity = 44/163 (26.99%), Postives = 74/163 (45.40%), Query Frame = 1
Query: 3352 FSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHI 3822
            F C +C ++F     L  H  VH G     C +C K  +       H++ H  ++  +C  C   F     +  H+R+ H   +P  + C+ICGK   Q      H L H++ + + C  C + F +S     H+  H+  KP+ CH+C + F +  +L  H+
Sbjct:   52 FPCEICGKQFNAHYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRHKIIHTDSKPHKCKTCGKCFNRSSTLNTHVRI-HQGFKP--FVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLAFHMFTHEEHKPFTCHVCSKGFCRNFDLKKHL 211          

HSP 4 Score: 65.855 bits (159), Expect = 1.950e-11
Identity = 49/169 (28.99%), Postives = 74/169 (43.79%), Query Frame = 1
Query: 5026 TENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD 5520
            + NSI     S +  N ++K  + C  C + F    NL  H+ +H    T      CK C + F+      +H K  H  T++K ++C  C K     + +N H++IH       CEIC K F +   Y  H   H   K + C IC   F + YN   H+  HE ++ 
Sbjct:   32 SSNSIFAESSSGDDENSRKK--FPCEICGKQFNAHYNLTRHMPVH----TGERPFVCKVCGKAFRQASTLCRH-KIIH--TDSKPHKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLAFHMFTHEEHKP 191          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: CG12299 (gene:FBgn0032295 transcript:FBtr0080113)

HSP 1 Score: 119.783 bits (299), Expect = 7.224e-27
Identity = 76/259 (29.34%), Postives = 130/259 (50.19%), Query Frame = 1
Query: 3079 YECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYEL---HRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHE 3834
            ++C HC     +      H+  H  N+  F C  CQ  F +  +L  H+    G K    KC +C K F+ S  + VH +  H       P  C  C + F+  + L  HQ+ H    +  +C +  +  KA  L   H   H +  ++QC  C+  FR+   + +H++ +H+  +P  + C +C +  TQ   +++HM IH   + +QC+ C K FT+++  + H++IH GEKPY C IC + +++++ LN HI  H+
Sbjct:  254 FQCTHCEASFPNAGDLSKHVRSHITNK-PFQCSICQKTFTHIGSLNTHIRIHSGEK--PYKCELCPKAFTQSSSLMVH-MRSHS---VRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICPECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMK-NHMGEKP--FTCSLCDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQAYLNKHIQAHQ 502          

HSP 2 Score: 110.153 bits (274), Expect = 7.958e-24
Identity = 71/233 (30.47%), Postives = 112/233 (48.07%), Query Frame = 1
Query: 3154 NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHG--GMMQCDLCQKVCKSMKAYELHRMKHFR-TRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICG---KIVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            NQ  F C  C+  F N   L  H+ +   +     +CSIC+K F++   +  HI   H G     P+ C +C + F   + L  H   H      QC  C K   +  +  LH+  H   T  F C EC+  F+++  +  H+R+    L    Y+C IC    +  +++  HM  H   + + C  C + FT+S   N H+RIH GEKP++C +C + F + S+L+VH+  H
Sbjct:  250 NQKCFQCTHCEASFPNAGDLSKHVRSH--ITNKPFQCSICQKTFTHIGSLNTHI-RIHSG---EKPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICPECEREFKAEALLDEHMRMHTQEL---VYQCAICREAFRASSELVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIH 473          

HSP 3 Score: 84.7297 bits (208), Expect = 4.894e-16
Identity = 49/169 (28.99%), Postives = 86/169 (50.89%), Query Frame = 1
Query: 5014 KNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            K  I  +S++LH+    +T+      + C +C   F     L+ H+++H ++L       C  C + F+      +HMK++      K + C++C +       +N HM+IH+ E    C++CDK F + S    H++ H GEKPY C ICG  +S++   N H++ H+
Sbjct:  345 KGFINYSSLLLHQ----KTHIAPTETFICPECEREFKAEALLDEHMRMHTQELVYQ----CAICREAFRASSELVQHMKNHMG---EKPFTCSLCDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQAYLNKHIQAHQ 502          

HSP 4 Score: 80.4925 bits (197), Expect = 9.955e-15
Identity = 80/302 (26.49%), Postives = 126/302 (41.72%), Query Frame = 1
Query: 2707 AEPLYKRRTKRMN----ELSYMATGMKK-FSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHL 3588
            + P+ +RR +R N     +     G +K F C  C A    AG D  KH  V+  +T +    C IC   F     L+ H+R   I SGE         + C+ C   F     ++ H  S H+   P  ++C  C +   +     +H + H     TF C EC+  FK EA L  H+      ++   +C+IC + F  S E+  H ++ H G     PF+C +C   F     L  H  +H G    QC LC K      +  +H   H   + + C  C  ++  +  + +HI+   +
Sbjct:  225 STPIKRRRGRRSNIGAPVMDPALNGNQKCFQCTHCEASFPNAG-DLSKH--VRSHITNK-PFQCSICQKTFTHIGSLNTHIR---IHSGE-------KPYKCELCPKAFTQSSSLMVHMRS-HSVRKP--HQCVQCDKGFINYSSLLLHQKTHIAPTETFICPECEREFKAEALLDEHMRMH--TQELVYQCAICREAFRASSELVQH-MKNHMG---EKPFTCSLCDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQAYLNKHIQAHQM 503          

HSP 5 Score: 73.1738 bits (178), Expect = 2.250e-12
Identity = 44/176 (25.00%), Postives = 82/176 (46.59%), Query Frame = 1
Query: 5068 TNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYH--------------------------NLTETKKYQCTICK---KVVAFINEHMKIHSEPSI-ACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            TNK     + C  C + F  + +LN+H++IH+ +    +   C+ C + F        HM+S+                           ++  T+ + C  C+   K  A ++EHM++H++  +  C IC + F+  S  V+H++ H GEKP+ C +C   F++  + N H++ H
Sbjct:  278 TNKP----FQCSICQKTFTHIGSLNTHIRIHSGE----KPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICPECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIHMRIH 445          

HSP 6 Score: 68.5514 bits (166), Expect = 4.989e-11
Identity = 43/137 (31.39%), Postives = 67/137 (48.91%), Query Frame = 1
Query: 5131 RNLNSHVKIHNKDLTVNEK-IPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDF 5526
            R  N    + +  L  N+K   C HC   F N    +KH++S+      K +QC+IC+K    +  +N H++IHS E    CE+C K F + S  + H+R H+  KP++C  C   F    +   H K H +  + F
Sbjct:  234 RRSNIGAPVMDPALNGNQKCFQCTHCEASFPNAGDLSKHVRSH---ITNKPFQCSICQKTFTHIGSLNTHIRIHSGEKPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETF 367          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: CG5245 (gene:FBgn0038047 transcript:FBtr0082589)

HSP 1 Score: 115.161 bits (287), Expect = 4.991e-26
Identity = 114/454 (25.11%), Postives = 187/454 (41.19%), Query Frame = 1
Query: 2485 LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVK-HLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHI-LEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNA-RYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHI 3822
              C  C+      + +  HLR H           + +   C  C+  +G + +Y  H          P K    ++   +  +  + +  +  TG + F C  C+     A + +++ HL      + E    C  C   F+    L +HLR  H ++           F C  C+     R ++      HA+ +   ++C  CP+        +IHL  H   +  F C  C   F   + L+LHL    G  +  LKCS C   F+     RVH+ L   E       + C  C + F  ++ L  HQ+VH G    +C  C K  K      +H + H   ++ +C+ C   F+    +  H++ +H      ++EC  C K  T  S   MH+  H     ++C +C K F +SA + EH+R H GEKPY+C  C  R+ +KS+L  H+
Sbjct:   82 FKCTQCQKTFTRKENLESHLRLH----------AEERPFECSHCSKSFGRRTHYKRHLLKHEKR---PHKCSHCSKTFTQNSS--LKQHLHEHTGERPFKCTQCS--TSFARKSHLQVHLRTH---SEERPFECTHCEKAFKNNSHLQEHLR-THQEA---------RPFKCSHCSKSFKLRSILQKHLLTHAERS---FKCTQCPKTFLQNDSLQIHLRVHA-GEDPFKCPHCSETFARNSRLQLHLLEHAG--KEPLKCSQCSATFAMRSLYRVHVRLHTRE-----RQYKCAECSKSFFKKSHLVEHQQVHTGERPFKCTHCFKDFKCRTHLRVHMLDHIGEKVPKCSYCSKEFKLSSQLLVHLQ-EHTG--KNQFECPHCSKSYTTSSTLHMHLRTHTGELPFKCSHCSKLFARSAEHQEHLRTHTGEKPYKCSHCSTRYTQKSSLGRHL 491          

HSP 2 Score: 105.916 bits (263), Expect = 4.867e-23
Identity = 80/270 (29.63%), Postives = 123/270 (45.56%), Query Frame = 1
Query: 3052 VHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVH--GGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            +HA+  P  +EC HC +    R  ++ HL KHE+      C  C   F   ++LK HL    G  +   KC+ C   F+    ++VH+        E  PF C  C++ F   + LQ H   H      +C  C K  K     + H + H   R F+CT+C  TF    +++ H+RV H   +P  ++C  C +     +++ +H+L H      +C  C   F   + Y  HVR+H  E+ Y+C  C + F KKS+L  H   H   R
Sbjct:  103 LHAEERP--FECSHCSKSFGRRTHYKRHLLKHEKR--PHKCSHCSKTFTQNSSLKQHLHEHTG--ERPFKCTQCSTSFARKSHLQVHLRTH----SEERPFECTHCEKAFKNNSHLQEHLRTHQEARPFKCSHCSKSFKLRSILQKHLLTHAE-RSFKCTQCPKTFLQNDSLQIHLRV-HAGEDP--FKCPHCSETFARNSRLQLHLLEHAGKEPLKCSQCSATFAMRSLYRVHVRLHTRERQYKCAECSKSFFKKSHLVEHQQVHTGER 358          

HSP 3 Score: 104.76 bits (260), Expect = 1.362e-22
Identity = 91/336 (27.08%), Postives = 145/336 (43.15%), Query Frame = 1
Query: 2848 KHGLTVELDTL-CRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFG---HF-RGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM-MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHI 3822
            K  L  + DT  C  C   F   E L  HLR +            +  F C  C+  FG   H+ R ++ H    H        +C HC +        + HL +H   +  F C +C T F  ++ L++HL T    ++   +C+ CEK F N+  ++ H+    E      PF C  C + F   + LQ H   H     +C  C K      + ++H   H     F+C  C  TF     ++ H+ ++H   EP   +C  C       S+   H+ +H   R Y+C  C K F K ++  EH ++H GE+P++C  C + F  +++L VH+
Sbjct:   72 KRPLRKQTDTFKCTQCQKTFTRKENLESHLRLH----------AEERPFECSHCSKSFGRRTHYKRHLLKHEKRPH--------KCSHCSKTFTQNSSLKQHLHEHT-GERPFKCTQCSTSFARKSHLQVHLRTH--SEERPFECTHCEKAFKNNSHLQEHLRTHQEA----RPFKCSHCSKSFKLRSILQKHLLTHAERSFKCTQCPKTFLQNDSLQIHLRVHAGEDPFKCPHCSETFARNSRLQLHL-LEHAGKEP--LKCSQCSATFAMRSLYRVHVRLHTRERQYKCAECSKSFFKKSHLVEHQQVHTGERPFKCTHCFKDFKCRTHLRVHM 379          

HSP 4 Score: 102.064 bits (253), Expect = 9.134e-22
Identity = 105/387 (27.13%), Postives = 162/387 (41.86%), Query Frame = 1
Query: 2773 KKFSCKFCNAEVKVAGR--DYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAM------------------------RRHIRVDHLNLEPERY-ECQICGK---IVTQISMHMLIHKNA-RYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            + F C  C+   K  GR   Y +HL +KH    +    C  C+  F     L  HL E+   +GE         F C +C T F     +  H    H++  P  +EC HC +   +    + HL  H+E +  F C  C   FK  + L+ HL T     +   KC+ C K F  +  +++H L  H G     PF C  C E F   + LQ H   H G   ++C  C         Y +H   H R R ++C EC  +F  K  +                        R H+RV  L+   E+  +C  C K   + +Q+ +H+  H    +++C +C K +T S+  + H+R H GE P++C  C + F + +    H+  H
Sbjct:  108 RPFECSHCS---KSFGRRTHYKRHL-LKHE---KRPHKCSHCSKTFTQNSSLKQHLHEH---TGE-------RPFKCTQCSTSFARKSHLQVH-LRTHSEERP--FECTHCEKAFKNNSHLQEHLRTHQEAR-PFKCSHCSKSFKLRSILQKHLLTH---AERSFKCTQCPKTFLQNDSLQIH-LRVHAG---EDPFKCPHCSETFARNSRLQLHLLEHAGKEPLKCSQCSATFAMRSLYRVHVRLHTRERQYKCAECSKSFFKKSHLVEHQQVHTGERPFKCTHCFKDFKCRTHLRVHMLDHIGEKVPKCSYCSKEFKLSSQLLVHLQEHTGKNQFECPHCSKSYTTSSTLHMHLRTHTGELPFKCSHCSKLFARSAEHQEHLRTH 466          

HSP 5 Score: 93.2041 bits (230), Expect = 6.031e-19
Identity = 65/248 (26.21%), Postives = 108/248 (43.55%), Query Frame = 1
Query: 3094 CPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHI 3822
            C  ++A +R  R   +       TF C +CQ  F  +  L+ HL      ++   +CS C K F      + H+L+      E  P  C  C + F   + L+ H   H G    +C  C          ++H   H   R F+CT C+  F++   ++ H+R  H    P  ++C  C K   + + +  H+L H    ++C  C K F ++     H+R+H GE P++C  C   F + S L +H+
Sbjct:   65 CKSKIAKKRPLRKQTD-------TFKCTQCQKTFTRKENLESHLRLH--AEERPFECSHCSKSFGRRTHYKRHLLKH-----EKRPHKCSHCSKTFTQNSSLKQHLHEHTGERPFKCTQCSTSFARKSHLQVHLRTHSEERPFECTHCEKAFKNNSHLQEHLRT-HQEARP--FKCSHCSKSFKLRSILQKHLLTHAERSFKCTQCPKTFLQNDSLQIHLRVHAGEDPFKCPHCSETFARNSRLQLHL 295          

HSP 6 Score: 78.1814 bits (191), Expect = 3.790e-14
Identity = 47/134 (35.07%), Postives = 72/134 (53.73%), Query Frame = 1
Query: 3451 KVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            K CKS  A +  R    +T  F+CT+CQ TF  K  +  H+R   L+ E   +EC  C K     T    H+L H+   ++C +C K FT+++   +H+  H GE+P++C  C   F +KS+L VH+  H + R
Sbjct:   63 KTCKSKIAKK--RPLRKQTDTFKCTQCQKTFTRKENLESHLR---LHAEERPFECSHCSKSFGRRTHYKRHLLKHEKRPHKCSHCSKTFTQNSSLKQHLHEHTGERPFKCTQCSTSFARKSHLQVHLRTHSEER 191          

HSP 7 Score: 75.485 bits (184), Expect = 2.420e-13
Identity = 51/204 (25.00%), Postives = 96/204 (47.06%), Query Frame = 1
Query: 4924 DEEFSDLDQEWSIEESDMEHSMWNISRDI--VKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + +F +L+ E  IE      +  +  +D+  VK   ++      K +  R  +KQ   + C +C + F    NL SH+++H ++        C HCS+ F  +  + +H+  +    E + ++C+ C K     + + +H+  H+ E    C  C   F +KS+   HLR H+ E+P++C  C   F    +  +HL+ H+  R
Sbjct:   30 NSDFEELESEIKIE------NFCSYGKDLEPVKGVPSKLKTCKSKIAKKRPLRKQTDTFKCTQCQKTFTRKENLESHLRLHAEE----RPFECSHCSKSFGRRTHYKRHLLKH----EKRPHKCSHCSKTFTQNSSLKQHLHEHTGERPFKCTQCSTSFARKSHLQVHLRTHSEERPFECTHCEKAFKNNSHLQEHLRTHQEAR 219          

HSP 8 Score: 69.707 bits (169), Expect = 1.556e-11
Identity = 44/167 (26.35%), Postives = 78/167 (46.71%), Query Frame = 1
Query: 5023 ITENSII---LHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
             T+NS +   LH+ +  R        + C +C+  F    +L  H++ H+++        C HC + F+N     +H++++    E + ++C+ C K   + + + +H+  H+E S  C  C K F +      HLR H GE P+KC  C   F++      HL  H
Sbjct:  146 FTQNSSLKQHLHEHTGERP-------FKCTQCSTSFARKSHLQVHLRTHSEE----RPFECTHCEKAFKNNSHLQEHLRTH---QEARPFKCSHCSKSFKLRSILQKHLLTHAERSFKCTQCPKTFLQNDSLQIHLRVHAGEDPFKCPHCSETFARNSRLQLHLLEH 298          

HSP 9 Score: 68.9366 bits (167), Expect = 2.902e-11
Identity = 41/143 (28.67%), Postives = 67/143 (46.85%), Query Frame = 1
Query: 3427 MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
              +C  CQK     +  E H   H   R F+C+ C  +F  +   +RH+    L  E   ++C  C K  TQ   +  H+  H   R ++C  C   F + ++   H+R H  E+P+EC  C++ F   S+L  H+  H++ R
Sbjct:   81 TFKCTQCQKTFTRKENLESHLRLHAEERPFECSHCSKSFGRRTHYKRHL----LKHEKRPHKCSHCSKTFTQNSSLKQHLHEHTGERPFKCTQCSTSFARKSHLQVHLRTHSEERPFECTHCEKAFKNNSHLQEHLRTHQEAR 219          

HSP 10 Score: 67.781 bits (164), Expect = 7.195e-11
Identity = 43/138 (31.16%), Postives = 73/138 (52.90%), Query Frame = 1
Query: 5104 KCNEVFGTLRNLNSHVKIHNKDLTVNEKIP-CKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKR 5502
            KC   F   +   +H+++H  D  + EK+P C +CS+ F+       H++ +   T   +++C  C K     + ++ H++ H+ E    C  C K F + + + EHLR HTGEKPYKC  C   +++K +   HL+R
Sbjct:  361 KCTHCFKDFK-CRTHLRVHMLD-HIGEKVPKCSYCSKEFKLSSQLLVHLQEH---TGKNQFECPHCSKSYTTSSTLHMHLRTHTGELPFKCSHCSKLFARSAEHQEHLRTHTGEKPYKCSHCSTRYTQKSSLGRHLRR 493          

HSP 11 Score: 63.1586 bits (152), Expect = 1.912e-9
Identity = 38/136 (27.94%), Postives = 65/136 (47.79%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHL 5496
            + C +C + F    +L  H+++H  +    +   C HCS+ F        H+  +      K  QC+    + +    H+++H+ E    C  C K F KKS+ VEH + HTGE+P+KC  C  +F  + +   H+
Sbjct:  248 FKCTQCPKTFLQNDSLQIHLRVHAGE----DPFKCPHCSETFARNSRLQLHLLEHAGKEPLKCSQCSATFAMRSLYRVHVRLHTRERQYKCAECSKSFFKKSHLVEHQQVHTGERPFKCTHCFKDFKCRTHLRVHM 379          

HSP 12 Score: 62.7734 bits (151), Expect = 2.292e-9
Identity = 100/466 (21.46%), Postives = 168/466 (36.05%), Query Frame = 1
Query: 2263 SDCPQCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPL--------YKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEE---NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMM--QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIR 3576
            +D  +C +C   F + + L  HL +        C     SF  RT         E    +C     C   +++   L  H++ H       C  C T       +  HLR H           + +   C  C   +    +   H           ++T + A P         +K R+     L  +    + F C  C  +  +       HL V  G   E    C  C++ F    RL  HL E+         AG + +  C +C+     R +      +H       Y+C  C +        + HL +H++    +  F C  C   FK    L++H+     + +   KCS C K+F  S ++ VH L+EH G  +   F C  C + +   + L  H   H G +  +C  C K+      ++ H   H   + ++C+ C   +  K ++ RH+R
Sbjct:   79 TDTFKCTQCQKTFTRKENLESHLRLHAEERPFECSHCSKSFGRRTHYKRHLLKHEKRPHKC---SHCSKTFTQNSSLKQHLHEHTGERPFKCTQCSTSFARKSHLQVHLRTH----------SEERPFECTHCEKAFKNNSHLQEH-----------LRTHQEARPFKCSHCSKSFKLRSILQKHL--LTHAERSFKCTQC-PKTFLQNDSLQIHLRVHAG---EDPFKCPHCSETFARNSRLQLHLLEH---------AGKEPL-KCSQCSATFAMRSLYRVHVRLHTRERQ--YKCAECSKSF----FKKSHLVEHQQVHTGERPFKCTHCFKDFKCRTHLRVHM--LDHIGEKVPKCSYCSKEFKLSSQLLVH-LQEHTGKNQ---FECPHCSKSYTTSSTLHMHLRTHTGELPFKCSHCSKLFARSAEHQEHLRTHTGEKPYKCSHCSTRYTQKSSLGRHLR 492          

HSP 13 Score: 55.0694 bits (131), Expect = 5.735e-7
Identity = 39/143 (27.27%), Postives = 65/143 (45.45%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            +Y C +C++ F    +L  H ++H    T      C HC + F+ +     HM  +      K  +C+ C K     ++   H++ H+ +    C  C K +   S    HLR HTGE P+KC  C   F++   + +HL+ H
Sbjct:  331 QYKCAECSKSFFKKSHLVEHQQVH----TGERPFKCTHCFKDFKCRTHLRVHMLDH---IGEKVPKCSYCSKEFKLSSQLLVHLQEHTGKNQFECPHCSKSYTTSSTLHMHLRTHTGELPFKCSHCSKLFARSAEHQEHLRTH 466          

HSP 14 Score: 52.373 bits (124), Expect = 4.023e-6
Identity = 41/175 (23.43%), Postives = 69/175 (39.43%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS------------------------------EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + C  C + F    +L  H++ H +         C HCS+ F+ + +  KH+ ++      + ++CT C K       +  H+++H+                              EP + C  C   F  +S Y  H+R HT E+ YKC  C   F KK +  +H + H   R
Sbjct:  193 FECTHCEKAFKNNSHLQEHLRTHQEA----RPFKCSHCSKSFKLRSILQKHLLTH----AERSFKCTQCPKTFLQNDSLQIHLRVHAGEDPFKCPHCSETFARNSRLQLHLLEHAGKEP-LKCSQCSATFAMRSLYRVHVRLHTRERQYKCAECSKSFFKKSHLVEHQQVHTGER 358          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: CG11247 (gene:FBgn0037120 transcript:FBtr0078458)

HSP 1 Score: 107.842 bits (268), Expect = 1.447e-23
Identity = 74/264 (28.03%), Postives = 124/264 (46.97%), Query Frame = 1
Query: 3052 VHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVT---QISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            +H+D  P  ++C  C +        + H+    E++  F C +C   F  +  L+LH+    G K     C +C+K F+   +++ H++  H+  ++   F+C  C   F     L+ H E H   M+                HR          C+ C+  F ++LA+R HI  +H  L   ++EC+IC K++     ++ HM  H   + + CE C   FT+ + YN H+R+H GE+PY+C IC + F   S L +HI  H
Sbjct:  114 IHSDERP--HKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEK--PYPCDLCDKKFARGGQLQQHMVSHHKTSIQ--QFNCTKCSASFSTNANLRVHMERHEQGME----------------HR----------CSICENQFANELALRAHINQEHHKLT--QFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKH 343          

HSP 2 Score: 90.8929 bits (224), Expect = 3.845e-18
Identity = 69/264 (26.14%), Postives = 112/264 (42.42%), Query Frame = 1
Query: 3079 YECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAH--QEVHG-GMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRR--FNKKSNLNVHINFHEKHRDDY 3852
            + C  CP+  A +   R+H+  H   +  + CD C   F     L+ H+ + H        C+ C   FS +  +RVH +E HE  +E     C +C+ +F  E  L+AH  QE H     +C++C K+ +  +    H  +H   +   C  C   F  K                            +Q ++HM +H   R YQC  C + F  S+    H+R H GEKP+ C +C+    F++ ++L  H+    K +  Y
Sbjct:  150 FVCSQCPKSFALKERLRLHMRLHS-GEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVH-MERHEQGME---HRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQK----------------------------SQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPY 380          

HSP 3 Score: 80.8777 bits (198), Expect = 5.770e-15
Identity = 50/158 (31.65%), Postives = 85/158 (53.80%), Query Frame = 1
Query: 5047 HKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHM-KSYHNLTETKKYQCTICKKVVAF---INEHMKIHSEPSI-ACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            H  S+++T+ +Q   +NC KC+  F T  NL  H++ H + +       C  C   F N++    H+ + +H LT+   ++C IC K++     +  HM+ H+      CE+C+  F +KS Y  H+R HTGE+PY+C+IC   F+       H+++H
Sbjct:  196 HMVSHHKTSIQQ---FNCTKCSASFSTNANLRVHMERHEQGMEHR----CSICENQFANELALRAHINQEHHKLTQ---FECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKH 343          

HSP 4 Score: 78.1814 bits (191), Expect = 3.706e-14
Identity = 98/435 (22.53%), Postives = 155/435 (35.63%), Query Frame = 1
Query: 2539 HLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELD----TLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHV-RIHKGEKPYECHICQRRFNKKSNLNVHI 3822
            +++  L K+     P KRK  +C  C+  +G K +   H           I +DE                       +   CK C       G+ Y + +++K+ +T   +     +C  C   F   ERL  H+R   + SGE         + CD C       G +      H  ++   + C  C    +     R+H+E+HE+  +   C  C+  F NE AL                              R HI +EH    +L  F C +C +    + +L  H + H  +    C++C         Y +H   H   R +QC  C  TF     ++ HIR  H   +P  + CQ+C   V                       F++ A+   H+ +IHK +KPY C  C   F  K  L  H+
Sbjct:   73 YVQPQLKKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHML---------IHSDE-----------------------RPHKCKDC-------GKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMR---LHSGE-------KPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQG-MEHRCSICENQFANELAL------------------------------RAHINQEHH---KLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIR-KHTGEKP--FRCQLCEDEVA----------------------FSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVELQSHV 399          

HSP 5 Score: 56.6102 bits (135), Expect = 1.974e-7
Identity = 35/111 (31.53%), Postives = 54/111 (48.65%), Query Frame = 1
Query: 3520 CTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNARYQ--CEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEK 3837
            C++C   F  K  ++RH+ + H +  P  ++C+ CGK   Q   +  H+      R Q  C  C K F        H+R+H GEKPY C +C ++F +   L  H+  H K
Sbjct:   95 CSQCSKEFGGKTDLQRHMLI-HSDERP--HKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHK 202          

HSP 6 Score: 53.9138 bits (128), Expect = 1.205e-6
Identity = 40/184 (21.74%), Postives = 73/184 (39.67%), Query Frame = 1
Query: 5068 TNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSE----------------------------------PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            T  + + ++ C +C + F     L  H+++H+ +    +  PC  C + F       +HM S+H  T  +++ CT C    +  N ++++H E                                      CEIC K  +       H++ HT  K + C++C   F++K  YN H++ H   R
Sbjct:  142 TAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGE----KPYPCDLCDKKFARGGQLQQHMVSHHK-TSIQQFNCTKCSASFS-TNANLRVHMERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGER 319          

HSP 7 Score: 51.2174 bits (121), Expect = 9.820e-6
Identity = 36/152 (23.68%), Postives = 61/152 (40.13%), Query Frame = 1
Query: 5050 KESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            K+S  +    ++  + C +C++ FG   +L  H+ IH+ +        CK C + ++  +    H+ + H                     EH K        C  C K F  K     H+R H+GEKPY C +C  +F++      H+  H
Sbjct:   79 KKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHK----CKDCGKSYRQAVNLKNHITTAH---------------------EHRK-----QFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSH 200          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: CG11247 (gene:FBgn0037120 transcript:FBtr0078459)

HSP 1 Score: 107.842 bits (268), Expect = 1.447e-23
Identity = 74/264 (28.03%), Postives = 124/264 (46.97%), Query Frame = 1
Query: 3052 VHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVT---QISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            +H+D  P  ++C  C +        + H+    E++  F C +C   F  +  L+LH+    G K     C +C+K F+   +++ H++  H+  ++   F+C  C   F     L+ H E H   M+                HR          C+ C+  F ++LA+R HI  +H  L   ++EC+IC K++     ++ HM  H   + + CE C   FT+ + YN H+R+H GE+PY+C IC + F   S L +HI  H
Sbjct:  114 IHSDERP--HKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEK--PYPCDLCDKKFARGGQLQQHMVSHHKTSIQ--QFNCTKCSASFSTNANLRVHMERHEQGME----------------HR----------CSICENQFANELALRAHINQEHHKLT--QFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKH 343          

HSP 2 Score: 90.8929 bits (224), Expect = 3.845e-18
Identity = 69/264 (26.14%), Postives = 112/264 (42.42%), Query Frame = 1
Query: 3079 YECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAH--QEVHG-GMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRR--FNKKSNLNVHINFHEKHRDDY 3852
            + C  CP+  A +   R+H+  H   +  + CD C   F     L+ H+ + H        C+ C   FS +  +RVH +E HE  +E     C +C+ +F  E  L+AH  QE H     +C++C K+ +  +    H  +H   +   C  C   F  K                            +Q ++HM +H   R YQC  C + F  S+    H+R H GEKP+ C +C+    F++ ++L  H+    K +  Y
Sbjct:  150 FVCSQCPKSFALKERLRLHMRLHS-GEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVH-MERHEQGME---HRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQK----------------------------SQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPY 380          

HSP 3 Score: 80.8777 bits (198), Expect = 5.770e-15
Identity = 50/158 (31.65%), Postives = 85/158 (53.80%), Query Frame = 1
Query: 5047 HKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHM-KSYHNLTETKKYQCTICKKVVAF---INEHMKIHSEPSI-ACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            H  S+++T+ +Q   +NC KC+  F T  NL  H++ H + +       C  C   F N++    H+ + +H LT+   ++C IC K++     +  HM+ H+      CE+C+  F +KS Y  H+R HTGE+PY+C+IC   F+       H+++H
Sbjct:  196 HMVSHHKTSIQQ---FNCTKCSASFSTNANLRVHMERHEQGMEHR----CSICENQFANELALRAHINQEHHKLTQ---FECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKH 343          

HSP 4 Score: 78.1814 bits (191), Expect = 3.706e-14
Identity = 98/435 (22.53%), Postives = 155/435 (35.63%), Query Frame = 1
Query: 2539 HLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELD----TLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHV-RIHKGEKPYECHICQRRFNKKSNLNVHI 3822
            +++  L K+     P KRK  +C  C+  +G K +   H           I +DE                       +   CK C       G+ Y + +++K+ +T   +     +C  C   F   ERL  H+R   + SGE         + CD C       G +      H  ++   + C  C    +     R+H+E+HE+  +   C  C+  F NE AL                              R HI +EH    +L  F C +C +    + +L  H + H  +    C++C         Y +H   H   R +QC  C  TF     ++ HIR  H   +P  + CQ+C   V                       F++ A+   H+ +IHK +KPY C  C   F  K  L  H+
Sbjct:   73 YVQPQLKKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHML---------IHSDE-----------------------RPHKCKDC-------GKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMR---LHSGE-------KPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQG-MEHRCSICENQFANELAL------------------------------RAHINQEHH---KLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIR-KHTGEKP--FRCQLCEDEVA----------------------FSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVELQSHV 399          

HSP 5 Score: 56.6102 bits (135), Expect = 1.974e-7
Identity = 35/111 (31.53%), Postives = 54/111 (48.65%), Query Frame = 1
Query: 3520 CTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNARYQ--CEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEK 3837
            C++C   F  K  ++RH+ + H +  P  ++C+ CGK   Q   +  H+      R Q  C  C K F        H+R+H GEKPY C +C ++F +   L  H+  H K
Sbjct:   95 CSQCSKEFGGKTDLQRHMLI-HSDERP--HKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHK 202          

HSP 6 Score: 53.9138 bits (128), Expect = 1.205e-6
Identity = 40/184 (21.74%), Postives = 73/184 (39.67%), Query Frame = 1
Query: 5068 TNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSE----------------------------------PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            T  + + ++ C +C + F     L  H+++H+ +    +  PC  C + F       +HM S+H  T  +++ CT C    +  N ++++H E                                      CEIC K  +       H++ HT  K + C++C   F++K  YN H++ H   R
Sbjct:  142 TAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGE----KPYPCDLCDKKFARGGQLQQHMVSHHK-TSIQQFNCTKCSASFS-TNANLRVHMERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGER 319          

HSP 7 Score: 51.2174 bits (121), Expect = 9.820e-6
Identity = 36/152 (23.68%), Postives = 61/152 (40.13%), Query Frame = 1
Query: 5050 KESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            K+S  +    ++  + C +C++ FG   +L  H+ IH+ +        CK C + ++  +    H+ + H                     EH K        C  C K F  K     H+R H+GEKPY C +C  +F++      H+  H
Sbjct:   79 KKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHK----CKDCGKSYRQAVNLKNHITTAH---------------------EHRK-----QFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSH 200          
BLAST of Zinc finger protein vs. Ensembl Fly
Match: CG11247 (gene:FBgn0037120 transcript:FBtr0113184)

HSP 1 Score: 107.842 bits (268), Expect = 1.447e-23
Identity = 74/264 (28.03%), Postives = 124/264 (46.97%), Query Frame = 1
Query: 3052 VHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVT---QISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            +H+D  P  ++C  C +        + H+    E++  F C +C   F  +  L+LH+    G K     C +C+K F+   +++ H++  H+  ++   F+C  C   F     L+ H E H   M+                HR          C+ C+  F ++LA+R HI  +H  L   ++EC+IC K++     ++ HM  H   + + CE C   FT+ + YN H+R+H GE+PY+C IC + F   S L +HI  H
Sbjct:  114 IHSDERP--HKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEK--PYPCDLCDKKFARGGQLQQHMVSHHKTSIQ--QFNCTKCSASFSTNANLRVHMERHEQGME----------------HR----------CSICENQFANELALRAHINQEHHKLT--QFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKH 343          

HSP 2 Score: 90.8929 bits (224), Expect = 3.845e-18
Identity = 69/264 (26.14%), Postives = 112/264 (42.42%), Query Frame = 1
Query: 3079 YECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAH--QEVHG-GMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRR--FNKKSNLNVHINFHEKHRDDY 3852
            + C  CP+  A +   R+H+  H   +  + CD C   F     L+ H+ + H        C+ C   FS +  +RVH +E HE  +E     C +C+ +F  E  L+AH  QE H     +C++C K+ +  +    H  +H   +   C  C   F  K                            +Q ++HM +H   R YQC  C + F  S+    H+R H GEKP+ C +C+    F++ ++L  H+    K +  Y
Sbjct:  150 FVCSQCPKSFALKERLRLHMRLHS-GEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVH-MERHEQGME---HRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQK----------------------------SQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPY 380          

HSP 3 Score: 80.8777 bits (198), Expect = 5.770e-15
Identity = 50/158 (31.65%), Postives = 85/158 (53.80%), Query Frame = 1
Query: 5047 HKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHM-KSYHNLTETKKYQCTICKKVVAF---INEHMKIHSEPSI-ACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            H  S+++T+ +Q   +NC KC+  F T  NL  H++ H + +       C  C   F N++    H+ + +H LT+   ++C IC K++     +  HM+ H+      CE+C+  F +KS Y  H+R HTGE+PY+C+IC   F+       H+++H
Sbjct:  196 HMVSHHKTSIQQ---FNCTKCSASFSTNANLRVHMERHEQGMEHR----CSICENQFANELALRAHINQEHHKLTQ---FECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKH 343          

HSP 4 Score: 78.1814 bits (191), Expect = 3.706e-14
Identity = 98/435 (22.53%), Postives = 155/435 (35.63%), Query Frame = 1
Query: 2539 HLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELD----TLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHV-RIHKGEKPYECHICQRRFNKKSNLNVHI 3822
            +++  L K+     P KRK  +C  C+  +G K +   H           I +DE                       +   CK C       G+ Y + +++K+ +T   +     +C  C   F   ERL  H+R   + SGE         + CD C       G +      H  ++   + C  C    +     R+H+E+HE+  +   C  C+  F NE AL                              R HI +EH    +L  F C +C +    + +L  H + H  +    C++C         Y +H   H   R +QC  C  TF     ++ HIR  H   +P  + CQ+C   V                       F++ A+   H+ +IHK +KPY C  C   F  K  L  H+
Sbjct:   73 YVQPQLKKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHML---------IHSDE-----------------------RPHKCKDC-------GKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMR---LHSGE-------KPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQG-MEHRCSICENQFANELAL------------------------------RAHINQEHH---KLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIR-KHTGEKP--FRCQLCEDEVA----------------------FSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVELQSHV 399          

HSP 5 Score: 56.6102 bits (135), Expect = 1.974e-7
Identity = 35/111 (31.53%), Postives = 54/111 (48.65%), Query Frame = 1
Query: 3520 CTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNARYQ--CEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEK 3837
            C++C   F  K  ++RH+ + H +  P  ++C+ CGK   Q   +  H+      R Q  C  C K F        H+R+H GEKPY C +C ++F +   L  H+  H K
Sbjct:   95 CSQCSKEFGGKTDLQRHMLI-HSDERP--HKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHK 202          

HSP 6 Score: 53.9138 bits (128), Expect = 1.205e-6
Identity = 40/184 (21.74%), Postives = 73/184 (39.67%), Query Frame = 1
Query: 5068 TNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSE----------------------------------PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            T  + + ++ C +C + F     L  H+++H+ +    +  PC  C + F       +HM S+H  T  +++ CT C    +  N ++++H E                                      CEIC K  +       H++ HT  K + C++C   F++K  YN H++ H   R
Sbjct:  142 TAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGE----KPYPCDLCDKKFARGGQLQQHMVSHHK-TSIQQFNCTKCSASFS-TNANLRVHMERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGER 319          

HSP 7 Score: 51.2174 bits (121), Expect = 9.820e-6
Identity = 36/152 (23.68%), Postives = 61/152 (40.13%), Query Frame = 1
Query: 5050 KESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            K+S  +    ++  + C +C++ FG   +L  H+ IH+ +        CK C + ++  +    H+ + H                     EH K        C  C K F  K     H+R H+GEKPY C +C  +F++      H+  H
Sbjct:   79 KKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHK----CKDCGKSYRQAVNLKNHITTAH---------------------EHRK-----QFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSH 200          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: znf1026 (zinc finger protein 1026 [Source:ZFIN;Acc:ZDB-GENE-110913-157])

HSP 1 Score: 163.696 bits (413), Expect = 1.011e-40
Identity = 160/637 (25.12%), Postives = 252/637 (39.56%), Query Frame = 1
Query: 1975 ISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            IS   S +   H +I+   +  +C  CGR F  S+++  H   H G   F C +    F    +   H      E+ I C    ++  + +    ++     + P  C +C   F Q+    LH+ I  G                     + F C  CG ++ +   L  HM  H      +C  C         ++QH+R  +H  E        K + C  C   +    + Y H     G    P    +  +   +  +   N    + TG K  +C  C      +   Y KH+ +  G   E    C  C   F    RLS   R   I +GE         F+C +C   F     ++ H   +H    P  + C  C +  ++      H+  H   +  FTC +C   F+  + L LH+      ++   KC+ C K FS S  +  HI+  H G     PF C  C + F+  + L  H  +H G     C  C K  +   +   HRM H   + F C +C+ +F    ++ +H+R+ H   +P  + C  CGK   Q S    HM IH   + + C  CGK F +S++ N H+RIH GEKP+ C  C + F++ S+LN H+  H
Sbjct:  128 ISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSHLNHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTG--------------------EKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIR--IHTGE--------KPITCTQCGKSFRQSSSLYRHMRIHTG--EKPFTCTQCGKSFSQ--SSNFNLHMRIHTGEKPITCTQCGKSFHQSSSLY-KHMRIHTG---EKPFTCTQCGKSFS---RLSHLNRHMMIHTGE-------KPFTCTQCGKSFSRLSHLIRHMM-IHTGEKP--FTCSQCRKSFSNLSSLYRHMRIHT-GEKPFTCTQCGKSFRQSSNLNLHMMIH--TEEKPFKCTQCGKSFSQSSHLNQHIMI-HTG---EKPFKCTQCGKSFIQSSSLNQHMMIHTGEKPFTCPKCGKSFRKSSSLNEHRMIHTGEKPFTCPKCEMSFSQSSSLNKHMRI-HTGEKP--FTCTQCGKSFNQTSSLKDHMRIHTGEKPFTCPKCGKSFNQSSHLNHHMRIHTGEKPFTCTQCGKSFSRPSSLNKHMKIH 703          

HSP 2 Score: 122.865 bits (307), Expect = 1.185e-27
Identity = 124/492 (25.20%), Postives = 190/492 (38.62%), Query Frame = 1
Query: 2413 CFICGICG---LNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNS----QEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            CF C  CG    + SKL I   HM  H      +C  C         +++H+R  +H  E        K   C  C   +    + Y  Q         P    +        R+  +N    + TG K F+C  C      +  +  +H+ +  G   E    C +C   F     LS H+R     +GE         F+C +C   F        H   +H    P  + C  C +          H+  H   +  FTC +C   F   + L  H+    G K   + C+ C K F  S    + +R+H  E+        PF+C  C + F   +    H  +H G   + C  C K      +   H   H   + F CT+C  +F     + RH+ + H   +P  + C  CGK  +++S    HM+IH   + + C  C K F+  +    H+RIH GEKP+ C  C + F + SNLN+H+  H
Sbjct:   64 CFTCTQCGKILASKSKLKI---HMIIHTGEKPFTCTQCGKSFRQASSLNKHMR--IHTGE--------KPFTCTQCGISFN--CSSYLKQHMRIHTGEKPFTCTQCGRSF--NRSSHLNHHMRIHTGEKPFTCTQCGKSFNRSS-NLDQHIRIHTG---EKPITCTLCGKSFRQSSSLSKHMR---THTGE-------KPFTCTQCGKSFSQSSNFNLH-MRIHTGEKP--FTCTQCGKSFRQASSLNKHMRTHT-GEKPFTCTQCGKSFNRSSHLNQHIRIHTGEK--PITCTQCGKSFRQSSSLYRHMRIHTGEK--------PFTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFSRLSHLNRHMMI-HTGEKP--FTCTQCGKSFSRLSHLIRHMMIHTGEKPFTCSQCRKSFSNLSSLYRHMRIHTGEKPFTCTQCGKSFRQSSNLNLHMMIH 507          

HSP 3 Score: 91.2781 bits (225), Expect = 6.404e-18
Identity = 61/198 (30.81%), Postives = 93/198 (46.97%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTS 5619
            RT+  +K  + C +C + F    N N H++IH    T  +   C  C + F+      KHM+++   T  K + CT C K     + +N+H++IH+ E  I C  C K F++ S    H+R HTGEKP+ C  CG  FS+  N+N H++ H   +      +   Q GK            ++   EK     QCG S
Sbjct:  225 RTHTGEK-PFTCTQCGKSFSQSSNFNLHMRIH----TGEKPFTCTQCGKSFRQASSLNKHMRTH---TGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYRHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKP-----ITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKS 409          

HSP 4 Score: 85.1149 bits (209), Expect = 5.409e-16
Identity = 104/487 (21.36%), Postives = 181/487 (37.17%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHP---PIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG 3426
            H +I+   +  +C  CG+ F+ S+++Y H   H G   F C +    F+   ++  H      E+ I C    ++  + +    ++     + P  C +C   F +   L  H+ I  G                     + F C  CG ++S+L  L  HM  H      +C+ C+    ++  + +H+R  +H  E        K   C  C   +    N      N H ++H    P K  +  +   +  +  +N+   + TG K F C  C     +      +H+ +  G   E    C  C   F     L++H     I +GE         F+C KC         +     +H    P  + C  C +        + H+  H   +  FTC +C   F   + L  H+    G K     C+ C K FS    +  H ++ H G   +  + C  C++ F+   +L+ HQ +H G
Sbjct:  307 HIRIHTGEKPITCTQCGKSFRQSSSLYRHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFSRLSHLNRHMMIHTG--------------------EKPFTCTQCGKSFSRLSHLIRHMMIHTGEKPFTCSQCRKSFSNLSSLYRHMR--IHTGE--------KPFTCTQCGKSFRQSSN-----LNLHMMIHTEEKPFKCTQCGKSFSQ--SSHLNQHIMIHTGEKPFKCTQCGKSF-IQSSSLNQHMMIHTG---EKPFTCPKCGKSFRKSSSLNEHRM---IHTGE-------KPFTCPKCEMSFSQSSSLNKHMRIHTGEKP--FTCTQCGKSFNQTSSLKDHMRIHT-GEKPFTCPKCGKSFNQSSHLNHHMRIHTGEK--PFTCTQCGKSFSRPSSLNKH-MKIHTG---VRAYMCLKCKKTFITAEDLKRHQRIHTG 733          

HSP 5 Score: 83.5741 bits (205), Expect = 1.834e-15
Identity = 52/151 (34.44%), Postives = 77/151 (50.99%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            RT+  +K  + C +C + F    +LN H++IH    T  + I C  C + F+      +HM+ +   T  K + CT C K  +     N HM+IH+ E  I C  C K F + S   +H+R HTGEKP+ C  CG  FS+  + N H+  H
Sbjct:  281 RTHTGEK-PFTCTQCGKSFNRSSHLNQHIRIH----TGEKPITCTQCGKSFRQSSSLYRHMRIH---TGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFSRLSHLNRHMMIH 423          

HSP 6 Score: 82.0333 bits (201), Expect = 4.344e-15
Identity = 50/146 (34.25%), Postives = 69/146 (47.26%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + C KC + F    +LN H  IH    T  +   C  C   F       KHM+ +   T  K + CT C K     + + +HM+IH+ E    C  C K F + S+   H+R HTGEKP+ C  CG  FS+  + N H+K H   R
Sbjct:  569 FTCPKCGKSFRKSSSLNEHRMIH----TGEKPFTCPKCEMSFSQSSSLNKHMRIH---TGEKPFTCTQCGKSFNQTSSLKDHMRIHTGEKPFTCPKCGKSFNQSSHLNHHMRIHTGEKPFTCTQCGKSFSRPSSLNKHMKIHTGVR 707          

HSP 7 Score: 81.6481 bits (200), Expect = 6.712e-15
Identity = 113/547 (20.66%), Postives = 190/547 (34.73%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEAL--------TSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRV 3579
            H +I+   +  +C  CG+ F+ ++++  H   H G   F C +    F        H      E+ I C    ++  + +    ++     + P  C +C   F Q+    LH+ I  G      T     +    +L          + F C  CG ++S+L  L  HM  H      +C  C      +  + +H+   +H  E        K   C  C   +    + Y H     G    P    +  +    R++  +N    + T  K F C  C      +     +H+ +  G   E    C  C   F     L+ H+    I +GE         F+C KC         +     +H    P  + CP C    +       H+  H   +  FTC +C   F   ++LK H+    G K     C  C K F+ S  +    R+H  E+        PF+C  C + F   + L  H ++H G+                          R + C +C+ TF +   ++RH R+
Sbjct:  251 HMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYRHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFSRLSHLNRHMMIHTGEKPFTCTQCGKSFSRLSHLIRHMM--IHTGE--------KPFTCSQCRKSFSNLSSLYRHMRIHTG--EKPFTCTQCGKSF--RQSSNLNLHMMIHTEEKPFKCTQCGKSFSQSS-HLNQHIMIHTG---EKPFKCTQCGKSFIQSSSLNQHMM---IHTGE-------KPFTCPKCGKSFRKSSSLNEHRMIHTGEKP--FTCPKCEMSFSQSSSLNKHMRIHT-GEKPFTCTQCGKSFNQTSSLKDHMRIHTGEK--PFTCPKCGKSFNQSSHLNHHMRIHTGEK--------PFTCTQCGKSFSRPSSLNKHMKIHTGV--------------------------RAYMCLKCKKTFITAEDLKRHQRI 730          

HSP 8 Score: 80.8777 bits (198), Expect = 1.101e-14
Identity = 55/189 (29.10%), Postives = 84/189 (44.44%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTS 5619
            + C +C   F     L  H++IH    T  +   C  C + F        HM+ +   T  K + CT C K     + +++H++IH+ E  I C +C K F++ S   +H+R HTGEKP+ C  CG  FS+  N+N H++ H   +          Q GK  +         +    EK     QCG S
Sbjct:  121 FTCTQCGISFNCSSYLKQHMRIH----TGEKPFTCTQCGRSFNRSSHLNHHMRIH---TGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKP-----FTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKS 297          

HSP 9 Score: 77.7962 bits (190), Expect = 9.527e-14
Identity = 56/189 (29.63%), Postives = 81/189 (42.86%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIKKVFN---------TEKIVNSVQCGTS 5619
            + C +C + F    N N H++IH    T  + I C  C + F       KHM+ +   T  K + CT C K    ++ +N HM IH+ E    C  C K F + S+ + H+  HTGEKP+ C  C   FS   +   H++ H   +          Q GK  ++  N          EK     QCG S
Sbjct:  345 FTCTQCGKSFSQSSNFNLHMRIH----TGEKPITCTQCGKSFHQSSSLYKHMRIH---TGEKPFTCTQCGKSFSRLSHLNRHMMIHTGEKPFTCTQCGKSFSRLSHLIRHMMIHTGEKPFTCSQCRKSFSNLSSLYRHMRIHTGEKP-----FTCTQCGKSFRQSSNLNLHMMIHTEEKPFKCTQCGKS 521          

HSP 10 Score: 77.411 bits (189), Expect = 1.252e-13
Identity = 44/157 (28.03%), Postives = 77/157 (49.04%), Query Frame = 1
Query: 5047 HKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICK---KVVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            H +++    ++ K  + C +C ++  +   L  H+ IH    T  +   C  C + F+      KHM+ +   T  K + CT C       +++ +HM+IH+ E    C  C + F + S+   H+R HTGEKP+ C  CG  F++  N + H++ H
Sbjct:   50 HLQTDGILKRRDKNCFTCTQCGKILASKSKLKIHMIIH----TGEKPFTCTQCGKSFRQASSLNKHMRIH---TGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSHLNHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIH 199          

HSP 11 Score: 75.0998 bits (183), Expect = 6.161e-13
Identity = 47/142 (33.10%), Postives = 69/142 (48.59%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C +C + F  L +L  H+ IH    T  +   C  C + F N     +HM+ +   T  K + CT C K     + +N HM IH+E     C  C K F + S+  +H+  HTGEKP+KC  CG  F +  + N H+  H
Sbjct:  429 FTCTQCGKSFSRLSHLIRHMMIH----TGEKPFTCSQCRKSFSNLSSLYRHMRIH---TGEKPFTCTQCGKSFRQSSNLNLHMMIHTEEKPFKCTQCGKSFSQSSHLNQHIMIHTGEKPFKCTQCGKSFIQSSSLNQHMMIH 563          

HSP 12 Score: 75.0998 bits (183), Expect = 6.540e-13
Identity = 58/221 (26.24%), Postives = 90/221 (40.72%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSY--------------------HNL-----TETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTSDYPDLEL 5640
            + C +C + F    NL+ H++IH    T  + I C  C + F+     +KHM+++                     NL     T  K + CT C K     + +N+HM+ H+ E    C  C K F + S+  +H+R HTGEKP  C  CG  F +  +   H++ H   +          Q GK            ++   EK +   QCG S +    L
Sbjct:  177 FTCTQCGKSFNRSSNLDQHIRIH----TGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYRHMRIHTGEKP-----FTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFHQSSSL 388          

HSP 13 Score: 60.8474 bits (146), Expect = 1.391e-8
Identity = 43/143 (30.07%), Postives = 64/143 (44.76%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            + C KC   F    +LN H++IH    T  +   C  C + F        HM+ +   T  K + C  C K     + +N HM+IH+ E    C  C K F + S   +H++ HTG + Y C  C     K +   + LKRH+
Sbjct:  597 FTCPKCEMSFSQSSSLNKHMRIH----TGEKPFTCTQCGKSFNQTSSLKDHMRIH---TGEKPFTCPKCGKSFNQSSHLNHHMRIHTGEKPFTCTQCGKSFSRPSSLNKHMKIHTGVRAYMCLKC----KKTFITAEDLKRHQ 728          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: znf1026 (zinc finger protein 1026 [Source:ZFIN;Acc:ZDB-GENE-110913-157])

HSP 1 Score: 150.214 bits (378), Expect = 1.119e-36
Identity = 158/649 (24.35%), Postives = 247/649 (38.06%), Query Frame = 1
Query: 1975 ISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIR-HVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC--------TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            IS   S +   H +I+   +  +C  CGR F  S+N+ DH +R H G   F C +    F    +   H      E+ I C    ++  + +    ++     + P  C +C   F Q+    LH+ I  G                     + F C  CG ++ +   L  HM  H      +C  C         ++QH+R  +H  E        K + C  C   +    + Y H     G    P    +  +   +  +   N    + TG K  +C  C      +   Y KH+ +  G   E    C  C   F     L+ H+R   I +GE          +C +C        + + H R        +H    P  + C  C +          H+  H   +  FTC +C   F   + LK H+    G K     C+ C + F+ S  +    R+H  E+        PF+C  C + F   + L  H  +H G   + C LC K  +   +   H   H   + F CT+C  +F     + +HIR+ H   +P  + C  CGK   Q S    HM  H   + + C  CGK F +S++ N+H+RIH GEKP  C  C + F + S+L  H+  H
Sbjct:   67 ISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNL-DHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTG--------------------EKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIR--IHTGE--------KPITCTQCGKSFRQSSSLYKHMRIHTG--EKPFTCTQCGKSFSQ--SSNFNLHMRIHTGEKPITCTQCGKSFHQSSSLY-KHMRIHTG---EKPFTCTQCGKSFRQASSLNKHMR---IHTGE-------KPITCTQCGKSFRQSSSLYKHMR--------IHTGEKP--FTCTQCGKSFRQTSSLNKHMRIHT-GEKPFTCTQCGISFNCSSYLKQHMRIHTGEK--PFTCTQCGRSFNRSSNLDHHMRIHTGEK--------PFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFNRSSNLDQHIRI-HTGEKP--FTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPIMCTQCGKSFRQSSSLYKHMRIH 642          

HSP 2 Score: 136.732 bits (343), Expect = 2.549e-32
Identity = 132/545 (24.22%), Postives = 209/545 (38.35%), Query Frame = 1
Query: 2278 CDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNS----QEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICG---KIVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            C +C   F QA  L  H+ I        C   G+SFN  + L    +   GE      F C  CG ++++   L  HM  H      +C  C         + QH+R  +H  E        K + C +C   +                                R++  +++     TG K F+C  C      +  ++  H+ +  G   E    C  C   F     L+ H+R     +GE         F+C +C    +    +     +H    P    C  C +          H+  H   +  FTC +C   F   +   LH+    G K   + C+ C K F  S    + +R+H  E+        PF+C  C + F   + L  H  +H G   + C  C K  +   +   H   H   + F CT+C  +FR   ++ +H+R+ H   +P  + C  CG      + +  HM IH   + + C  CG+ F +S+  + H+RIH GEKP+ C  C + FN+ SNL+ HI  H
Sbjct:   34 CTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKP----FTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIR--IHTGE--------KPITCTLCGKSF--------------------------------RQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSS-NFNLHMRIHTG---EKPFTCTQCGKSFRQASSLNKHMR---THTGE-------KPFTCTQCGKSFNRSSHLNQHIRIHTGEKP--ITCTQCGKSFRQSSSLYKHMRIHT-GEKPFTCTQCGKSFSQSSNFNLHMRIHTGEK--PITCTQCGKSFHQSSSLYKHMRIHTGEK--------PFTCTQCGKSFRQASSLNKHMRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFRQTSSLNKHMRI-HTGEKP--FTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIH 502          

HSP 3 Score: 134.42 bits (337), Expect = 1.633e-31
Identity = 122/483 (25.26%), Postives = 189/483 (39.13%), Query Frame = 1
Query: 2416 FICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            F+C  CG ++ +   L  HM  H      +C  C         + QH+R  +H  E        K   C  C   +    N  +H     G    P    +  +     R+  +++   + TG K  +C  C    + +     KH+    G   E    C  C   F      + H+R   I +GE         F+C +C     FR   + +  +   +    + C  C +          H+  H   +   TC +C   F+  ++L  H+    G K     C+ C K FS S    +H +  H G     P +C  C + F   + L  H  +H G     C  C K  +   +   H   H   +   CT+C  +FR   ++ +H+R+ H   +P  + C  CGK   Q S    HM IH   + + C  CG  F  S+Y  +H+RIH GEKP+ C  C R FN+ SNL+ H+  H
Sbjct:   32 FMCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMR--IHTGE--------KPFTCTQCGRSFNRSSNLDHHMRIHTG--EKPFTCTQCGKSF--NRSSNLDQHIRIHTGEKPITCTLCGKSFRQSS-SLSKHMRTHTG---EKPFTCTQCGKSFSQSSNFNLHMR---IHTGE-------KPFTCTQCG--KSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIH-TGEKPITCTQCGKSFRQSSSLYKHMRIHTGEK--PFTCTQCGKSFSQSSNFNLH-MRIHTG---EKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPITCTQCGKSFRQSSSLYKHMRI-HTGEKP--FTCTQCGKSFRQTSSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNLDHHMRIH 474          

HSP 4 Score: 94.7449 bits (234), Expect = 4.933e-19
Identity = 61/198 (30.81%), Postives = 94/198 (47.47%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPI---------KKVFNTEKIVNSVQCGTS 5619
            RT+  +K  + C +C + F    N N H++IH    T  +   C  C + F+      KHM+++   T  K + CT C K     + +N+H++IH+ E  I C  C K F++ S   +H+R HTGEKP+ C  CG  FS+  N+N H++ H   +      +   Q GK            ++   EK     QCG S
Sbjct:  164 RTHTGEK-PFTCTQCGKSFSQSSNFNLHMRIH----TGEKPFTCTQCGKSFRQASSLNKHMRTH---TGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKP-----ITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKS 348          

HSP 5 Score: 90.5077 bits (223), Expect = 9.231e-18
Identity = 57/184 (30.98%), Postives = 84/184 (45.65%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD----DFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            + C +C + F    N N H++IH    T  + I C  C + F       KHM+ +   T  K + CT C K     + +N+HM+IH+ E  I C  C K F++ S   +H+R HTGEKP+ C  CG  F +  + N H++ H   +       G         K   ++   EK     QCG S
Sbjct:  284 FTCTQCGKSFSQSSNFNLHMRIH----TGEKPITCTQCGKSFHQSSSLYKHMRIH---TGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFRQTSSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRS 460          

HSP 6 Score: 86.6557 bits (213), Expect = 1.484e-16
Identity = 46/142 (32.39%), Postives = 77/142 (54.23%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C +C + F    NL+ H++IH    T  + I C  C + F+     +KHM+++   T  K + CT C K     + +++H++IH+ E    C  C K F++ S   +H+R HTGEKP+ C  CG  F++  + N H++ H
Sbjct:  480 FTCTQCGKSFNRSSNLDQHIRIH----TGEKPITCTLCGKSFRQSSSLSKHMRTH---TGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIH 614          

HSP 7 Score: 83.5741 bits (205), Expect = 1.469e-15
Identity = 55/189 (29.10%), Postives = 84/189 (44.44%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTS 5619
            + C +C   F     L  H++IH    T  +   C  C + F        HM+ +   T  K + CT C K     + +++H++IH+ E  I C +C K F++ S   +H+R HTGEKP+ C  CG  FS+  N+N H++ H   +          Q GK  +         +    EK     QCG S
Sbjct:   60 FTCTQCGISFNCSSYLKQHMRIH----TGEKPFTCTQCGRSFNRSSNLDHHMRIH---TGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKP-----FTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKS 236          

HSP 8 Score: 80.4925 bits (197), Expect = 1.243e-14
Identity = 51/167 (30.54%), Postives = 77/167 (46.11%), Query Frame = 1
Query: 3349 PFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            PF C  C + F   + L  H  +H G     C  C          + H   H   + F CT+C  +F     +  H+R+ H   +P  + C  CGK   + S    H+ IH   +   C  CGK F +S+  ++H+R H GEKP+ C  C + F++ SN N+H+  H
Sbjct:   31 PFMCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNLDHHMRI-HTGEKP--FTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIH 194          

HSP 9 Score: 79.7221 bits (195), Expect = 2.265e-14
Identity = 53/189 (28.04%), Postives = 83/189 (43.92%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTS 5619
            + C +C   F     L  H++IH    T  +   C  C + F        HM+ +   T  K + CT C K     + +++H++IH+ E  I C +C K F++ S   +H+R HTGEKP+ C  CG  F++  N + H++ H   +          Q GK  +         +    EK     QCG S
Sbjct:  424 FTCTQCGISFNCSSYLKQHMRIH----TGEKPFTCTQCGRSFNRSSNLDHHMRIH---TGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKP-----FTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKS 600          

HSP 10 Score: 77.411 bits (189), Expect = 1.163e-13
Identity = 58/221 (26.24%), Postives = 90/221 (40.72%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSY--------------------HNL-----TETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTSDYPDLEL 5640
            + C +C + F    NL+ H++IH    T  + I C  C + F+     +KHM+++                     NL     T  K + CT C K     + +N+HM+ H+ E    C  C K F + S+  +H+R HTGEKP  C  CG  F +  +   H++ H   +          Q GK            ++   EK +   QCG S +    L
Sbjct:  116 FTCTQCGKSFNRSSNLDQHIRIH----TGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKP-----FTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFHQSSSL 327          

HSP 11 Score: 76.6406 bits (187), Expect = 2.081e-13
Identity = 44/131 (33.59%), Postives = 70/131 (53.44%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKC 5445
            RT+  +K  + C +C + F    NL+ H++IH    T  +   C  C + F+      KHM+++   T  K + CT C K     + +N+H++IH+ E  I C  C K F++ S   +H+R HTGEKP+ C
Sbjct:  528 RTHTGEK-PFTCTQCGKSFNRSSNLDQHIRIH----TGEKPFTCTQCGKSFRQASSLNKHMRTH---TGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPIMCTQCGKSFRQSSSLYKHMRIHTGEKPFTC 650          

HSP 12 Score: 67.3958 bits (163), Expect = 1.542e-10
Identity = 38/123 (30.89%), Postives = 61/123 (49.59%), Query Frame = 1
Query: 5155 IHNKDLTVNEKIP--CKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICK---KVVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            +  +DL    + P  C  C + F+      KHM+ +   T  K + CT C       +++ +HM+IH+ E    C  C + F + S    H+R HTGEKP+ C  CG  F++  N + H++ H
Sbjct:   19 VKQEDLQEQTEKPFMCTQCGKSFRQASSLNKHMRIH---TGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIH 138          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: znf985 (zinc finger protein 985 [Source:ZFIN;Acc:ZDB-GENE-110914-127])

HSP 1 Score: 148.288 bits (373), Expect = 5.896e-36
Identity = 155/644 (24.07%), Postives = 244/644 (37.89%), Query Frame = 1
Query: 1990 SIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIR-HVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC--------TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            S +   H +I+   +  +C  CG+ F  S+N+ DH +R H G   F C +    F    +   H      E+ I C    ++  + +    ++     + P  C +C   F Q+    LH+ I  G                     + F C  CG ++ +   L  HM  H      +C  C         ++QH+R  +H  E        K + C  C   +    + Y H     G    P    +  +   +  +   N    + TG K  +C  C      +   Y KH+ +  G   E    C  C   F     L+ H+R   I +GE          +C +C        + + H R        +H    P  + C  C +          H+  H   +  FTC +C   F   + LK H+    G K     C+ C + F+ S  +    R+H  E+        PF+C  C + F   + L  H  +H G   + C LC K  +   +   H   H   + F CT+C  +F        H+R+ H   +P  + C  CGK   Q S    HM IH   + + C  CGK F +S++ N+H+RIH GEKP  C  C + F + S+L  H+  H
Sbjct:   73 SSYLKQHMRIHTGEKPFTCTQCGKSFNRSSNL-DHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTG--------------------EKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIR--IHTGE--------KPITCTQCGKSFRQSSSLYKHMRIHTG--EKPFTCTQCGKSFSQ--SSNFNLHMRIHTGEKPITCTQCGKSFHQSSSLY-KHIRIHTG---EKPFTCTQCGKSFRQASSLNKHMR---IHTGE-------KPITCTQCGKSFRQSSSLYKHMR--------IHTGEKP--FTCTQCGKSFRQTSSLNKHMRIHT-GKKPFTCTQCGISFNCSSYLKQHMRIHTGEK--PFTCTQCGRSFNRSSNLDHHMRIHTGEK--------PFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRI-HTGEKP--FTCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMTIH 643          

HSP 2 Score: 92.0485 bits (227), Expect = 3.209e-18
Identity = 58/189 (30.69%), Postives = 89/189 (47.09%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTS 5619
            + C +C + F    N N H++IH    T  +   C  C + F+      KHM+++   T  K + CT C K     + +N+H++IH+ E  I C  C K F++ S   +H+R HTGEKP+ C  CG  FS+  N+N H++ H   +      +   Q GK            ++   EK     QCG S
Sbjct:  173 FTCTQCGKSFSQSSNFNLHMRIH----TGEKPFTCTQCGKSFRQASSLNKHMRTH---TGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKP-----ITCTQCGKSFHQSSSLYKHIRIHTGEKPFTCTQCGKS 349          

HSP 3 Score: 87.4261 bits (215), Expect = 8.657e-17
Identity = 56/184 (30.43%), Postives = 84/184 (45.65%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            + C +C + F    N N H++IH    T  + I C  C + F       KH++ +   T  K + CT C K     + +N+HM+IH+ E  I C  C K F++ S   +H+R HTGEKP+ C  CG  F +  + N H++ H   +       G         K   ++   EK     QCG S
Sbjct:  285 FTCTQCGKSFSQSSNFNLHMRIH----TGEKPITCTQCGKSFHQSSSLYKHIRIH---TGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFRQTSSLNKHMRIHTGKKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRS 461          

HSP 4 Score: 87.0409 bits (214), Expect = 1.319e-16
Identity = 48/142 (33.80%), Postives = 75/142 (52.82%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C +C + F    NL+ H++IH    T  + I C  C + F+     +KHM+++   T  K + CT C K  +     N HM+IH+ E    C  C K F++ S   +H+R HTGEKP+ C  CG  F++  + N H++ H
Sbjct:  481 FTCTQCGKSFNRSSNLDQHIRIH----TGEKPITCTLCGKSFRQSSSLSKHMRTH---TGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGKSFNRSSHLNQHIRIH 615          

HSP 5 Score: 82.4185 bits (202), Expect = 3.132e-15
Identity = 56/192 (29.17%), Postives = 86/192 (44.79%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTS 5619
            K  + C +C   F     L  H++IH    T  +   C  C + F        HM+ +   T  K + CT C K     + +++H++IH+ E  I C +C K F++ S   +H+R HTGEKP+ C  CG  FS+  N+N H++ H   +          Q GK  +         ++   EK     QCG S
Sbjct:  422 KKPFTCTQCGISFNCSSYLKQHMRIH----TGEKPFTCTQCGRSFNRSSNLDHHMRIH---TGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKP-----FTCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGKS 601          

HSP 6 Score: 78.5666 bits (192), Expect = 5.253e-14
Identity = 55/193 (28.50%), Postives = 87/193 (45.08%), Query Frame = 1
Query: 5080 QKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTS 5619
            ++ + NC  C        N +S++K H +  T  +   C  C + F        HM+ +   T  K + CT C K     + +++H++IH+ E  I C +C K F++ S   +H+R HTGEKP+ C  CG  FS+  N+N H++ H   +          Q GK  +         +    EK     QCG S
Sbjct:   58 KRRDKNCFTCTHF-----NCSSYLKQHMRIHTGEKPFTCTQCGKSFNRSSNLDHHMRIH---TGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKP-----FTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKS 237          

HSP 7 Score: 76.2554 bits (186), Expect = 3.038e-13
Identity = 59/221 (26.70%), Postives = 90/221 (40.72%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSY--------------------HNL-----TETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIKKVFN---------TEKIVNSVQCGTSDYPDLEL 5640
            + C +C + F    NL+ H++IH    T  + I C  C + F+     +KHM+++                     NL     T  K + CT C K     + +N+HM+ H+ E    C  C K F + S+  +H+R HTGEKP  C  CG  F +  +   H++ H   +          Q GK   +  N          EK +   QCG S +    L
Sbjct:  117 FTCTQCGKSFNRSSNLDQHIRIH----TGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKP-----FTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFHQSSSL 328          

HSP 8 Score: 70.4774 bits (171), Expect = 1.661e-11
Identity = 40/122 (32.79%), Postives = 62/122 (50.82%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKC 5445
            + C +C + F    N N H++IH    T  +   C  C + F+      KHM+ +   T  K + CT C K     + +N+H++IH+ E  I C  C K F++ S   +H+  HTGEKP+ C
Sbjct:  537 FTCTQCGKSFSQSSNFNLHMRIH----TGEKPFTCTQCGKSFRQASSLNKHMRIH---TGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMTIHTGEKPFTC 651          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: znf1104 (zinc finger protein 1104 [Source:ZFIN;Acc:ZDB-GENE-110913-152])

HSP 1 Score: 145.591 bits (366), Expect = 4.124e-35
Identity = 139/541 (25.69%), Postives = 210/541 (38.82%), Query Frame = 1
Query: 2278 CDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHG--GMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            C +C   F Q+     H+ I        C   G+SFN  + L    +   GE      F C  CG ++++L  L  HM  H      +C  C         + QH+R  +H  E        K + C  C   +    + Y H     G    P    +  +   +  +   N    + TG+K F+C  C    + A     KH+    G   E    C  C   F     L+ H+R   I +GE          +C +C         +     +H    P  + C  C +  +    + +H+  H   +  FTC +C   F   +   LH+    G K     C+ C K F  +  +  H +  H G     PF+C  C + F   + L  H  +H       C  C +          H   H   + F CT+C  +F     + +HIR+ H   +P    C  CGK   Q S    HM IH   + + C  CGK F++S+ +N H+RIH GEKP+ C +C + FNK S+LN H+  H
Sbjct:  123 CTQCGKSFRQSSSFNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKP----FTCTQCGRSFNRLSHLNHHMRIHTGEKPFTCTQCWKSFNRSSHLDQHIR--IHTGE--------KPITCTQCGKSFRQSSSLYKHMRIHTG--EKPFTCTQCGKSFSQ--SSSFNLHMRIHTGVKPFTCTQCGKSFRQAS-SLNKHMRTHTG---EKPFTCTQCGKSFNRSSTLNQHIR---IHTGE-------KPITCTQCGKSFRQASSLNKHMRIHTGEKP--FTCTQCGKSFSQSSNFNLHMRIHT-GEKPFTCTQCGKSFIQSSNFNLHMRIHTGEK--PFTCTQCGKSFRQASSLNKH-MRTHTG---EKPFTCTQCGKSFNRSSRLDQHIRIHTREKPFTCTECGRSFNRSSHLNHHMRIHTGEKPFTCTQCGKSFNRSSTLNQHIRI-HTGEKP--ITCSQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTLCGKSFNKSSHLNRHMRIH 619          

HSP 2 Score: 142.895 bits (359), Expect = 3.369e-34
Identity = 154/635 (24.25%), Postives = 243/635 (38.27%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCD---KCYDYFPQADILRLHLD----ICD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNS----QEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H  I+   +  +C  C + F  S+++  H   H G   F C +    F    S+  H                     ++       C QC     C  Y  Q   +R+H       C   G SFN  + L+   +   GE      F C  C  ++++   L  H+  H     ++C  C         + +H+R  +H  E        K   C  C   +    ++  H     GV   P    +  +    R+   +N+     TG K F+C  C      +     +H+ +  G   E    C  C   F     L+ H+R   I +GE         F+C +C   F        H   +H    P  + C  C +       + +H+  H   +  FTC +C   F+  ++L  H+ T  G K     C+ C K F+ S    Q IR+H  E+        PF+C  C   F   + L  H  +H G     C  C K          H   H   +   C++C  +FR   ++ +H+R+ H   +P  + C  CGK  +Q S   +HM IH   + + C  CGK F KS++ N H+RIH  EKP+ C  C + F++ S+L +H+  H
Sbjct:   83 HMIIHTGGKPFTCTQCRKSFNRSSHLDQHIRIHTGEKPFMCTQCGKSFRQSSSFNKH-------------------MRIHTGEKPFTCTQCGISFNCSSYLKQH--MRIHTGEKPFTCTQCGRSFNRLSHLNHHMRIHTGEKP----FTCTQCWKSFNRSSHLDQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMR--IHTGE--------KPFTCTQCGKSFSQSSSFNLHMRIHTGV--KPFTCTQCGKSF--RQASSLNKHMRTHTGEKPFTCTQCGKSFNRSS-TLNQHIRIHTG---EKPITCTQCGKSFRQASSLNKHMR---IHTGE-------KPFTCTQCGKSFSQSSNFNLH-MRIHTGEKP--FTCTQCGKSFIQSSNFNLHMRIH-TGEKPFTCTQCGKSFRQASSLNKHMRTHTGEK--PFTCTQCGKSFNRSSRLDQHIRIHTREK--------PFTCTECGRSFNRSSHLNHHMRIHTGEKPFTCTQCGKSFNRSSTLNQHIRIHTGEKPITCSQCGKSFRQSSSLYKHMRI-HTGEKP--FTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTLCGKSFNKSSHLNRHMRIHTAEKPFTCTQCGKSFSESSSLTLHMMRH 647          

HSP 3 Score: 137.117 bits (344), Expect = 2.445e-32
Identity = 133/523 (25.43%), Postives = 208/523 (39.77%), Query Frame = 1
Query: 2413 CFICGICG---LNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAE-PLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGL---TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC--------TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNS----QEIRVHILEEHEGCVEL--------------------YPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            CFIC  CG    + SKL I   HM  H      +C  C+        + QH+R  +H  E        K  +C  C   +    ++     N+H  +H   K     +  +    +  + +   + TG K F+C  C       GR + +   + H +   T E    C  C   F     L  H+R   I +GE          +C +C        + + H R        +H    P  + C  C +  +    + +H+  H   +  FTC +C   F+  ++L  H+ T  G K     C+ C K F+ S    Q IR+H  E+   C +                      PF+C  C + F   +    H  +H G     C  C K       + LH   H   + F CT+C  +FR   ++ +H+R  H   +P  + C  CGK     +++  H+ IH   + + C  CG+ F +S++ N H+RIH GEKP+ C  C + FN+ S LN HI  H
Sbjct:   64 CFICTQCGKILASKSKLKI---HMIIHTGGKPFTCTQCRKSFNRSSHLDQHIR--IHTGE--------KPFMCTQCGKSFRQSSSF-----NKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQC-------GRSFNRLSHLNHHMRIHTGEKPFTCTQCWKSFNRSSHLDQHIR---IHTGE-------KPITCTQCGKSFRQSSSLYKHMR--------IHTGEKP--FTCTQCGKSFSQSSSFNLHMRIHTGVK-PFTCTQCGKSFRQASSLNKHMRTHTGEK--PFTCTQCGKSFNRSSTLNQHIRIHTGEKPITCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFIQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRT-HTGEKP--FTCTQCGKSFNRSSRLDQHIRIHTREKPFTCTECGRSFNRSSHLNHHMRIHTGEKPFTCTQCGKSFNRSSTLNQHIRIH 535          

HSP 4 Score: 97.0561 bits (240), Expect = 1.031e-19
Identity = 63/215 (29.30%), Postives = 107/215 (49.77%), Query Frame = 1
Query: 3214 KLHLETFHGVKQNDLKCSICE---KDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            K HL+T   +K+ D  C IC    K  ++  ++++H++    G     PF+C  C++ F   + L  H  +H G     C  C K  +   ++  H   H   + F CT+C  +F     +++H+R+ H   +P  + C  CG+   ++S    HM IH   + + C  C K F +S++ ++H+RIH GEKP  C  C + F + S+L  H+  H
Sbjct:   48 KTHLQTDGILKRRDKNCFICTQCGKILASKSKLKIHMIIHTGG----KPFTCTQCRKSFNRSSHLDQHIRIHTGEKPFMCTQCGKSFRQSSSFNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRI-HTGEKP--FTCTQCGRSFNRLSHLNHHMRIHTGEKPFTCTQCWKSFNRSSHLDQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIH 255          

HSP 5 Score: 91.6633 bits (226), Expect = 4.087e-18
Identity = 113/513 (22.03%), Postives = 178/513 (34.70%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCT 3525
            H +I+   +  +C  CG+ F+ S+++Y H   H G   F C +    F+   S+  H                     ++       C QC K    F QA  L  H+                +   GE      F C  CG ++++   L  H+  H     ++C  C         +++H+R  +H  E        K   C  C   +    N+  H     G    P    +  +   +  +   N    + TG K F+C  C    + A     KH+    G   E    C  C   F    RL  H+R   I + E         F+C +C    +    + H   +H    P  + C  C +          H+  H   +   TC +C   F+  ++L  H+    G K     C+ C K FS S    +H +  H G     PF+C +C + F   + L  H  +H       C  C K      +  LH M+H   + F CT
Sbjct:  223 HIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSSFNLH-------------------MRIHTGVKPFTCTQCGK---SFRQASSLNKHM----------------RTHTGEKP----FTCTQCGKSFNRSSTLNQHIRIHTGEKPITCTQCGKSFRQASSLNKHMR--IHTGE--------KPFTCTQCGKSFSQSSNFNLHMRIHTG--EKPFTCTQCGKSFIQ--SSNFNLHMRIHTGEKPFTCTQCGKSFRQAS-SLNKHMRTHTG---EKPFTCTQCGKSFNRSSRLDQHIR---IHTRE-------KPFTCTECGRSFNRSSHLNHHMRIHTGEKP--FTCTQCGKSFNRSSTLNQHIRIH-TGEKPITCSQCGKSFRQSSSLYKHMRIHTGEK--PFTCTQCGKSFSQSSNFNLH-MRIHTG---EKPFTCTLCGKSFNKSSHLNRHMRIHTAEKPFTCTQCGKSFSESSSLTLHMMRHTGKKPFTCT 656          

HSP 6 Score: 88.1965 bits (217), Expect = 5.124e-17
Identity = 48/142 (33.80%), Postives = 76/142 (53.52%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C +C + F    + N H++IH    T  +   C  C + F+      KHM+++   T  K + CT C K     + +N+H++IH+ E  I C  C K F++ S   +H+R HTGEKP+ C  CG  FS+  N+N H++ H
Sbjct:  261 FTCTQCGKSFSQSSSFNLHMRIH----TGVKPFTCTQCGKSFRQASSLNKHMRTH---TGEKPFTCTQCGKSFNRSSTLNQHIRIHTGEKPITCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIH 395          

HSP 7 Score: 87.8113 bits (216), Expect = 6.406e-17
Identity = 120/562 (21.35%), Postives = 195/562 (34.70%), Query Frame = 1
Query: 1975 ISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHP---PIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNS----QEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEP 3600
            IS   S +   H +I+   +  +C  CGR F   +++  H   H G   F C +    F        H      E+ I C    ++  + +    ++     + P  C +C   F Q+    LH+ I  GV             P        F C  CG ++ +   L  HM  H      +C  C         ++QH+R  +H  E        K + C  C   +    +      N+H  +H    P    +  +   +  +   N    + TG K F+C  C     +   ++  H+ +  G   E    C  C   F     L+ H+R     +GE         F+C +C    +    +     +H    P  + C  C            H+  H   +  FTC +C   F   + L  H+    G K   + CS C K F  S    + +R+H  E+        PF+C  C + F   +    H  +H G     C LC K          H   H   + F CT+C  +F    ++  H+ + H   +P
Sbjct:  156 ISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRLSHLNHHMRIHTGEKPFTCTQCWKSFNRSSHLDQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSSFNLHMRIHTGV------------KP--------FTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSTLNQHIR--IHTGE--------KPITCTQCGKSFRQASS-----LNKHMRIHTGEKPFTCTQCGKSFSQ--SSNFNLHMRIHTGEKPFTCTQCGKSF-IQSSNFNLHMRIHTG---EKPFTCTQCGKSFRQASSLNKHMR---THTGE-------KPFTCTQCGKSFNRSSRLDQHIRIHTREKP--FTCTECGRSFNRSSHLNHHMRIHT-GEKPFTCTQCGKSFNRSSTLNQHIRIHTGEK--PITCSQCGKSFRQSSSLYKHMRIHTGEK--------PFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTLCGKSFNKSSHLNRHMRIHTAEKPFTCTQCGKSFSESSSLTLHM-MRHTGKKP 652          

HSP 8 Score: 86.2705 bits (212), Expect = 1.991e-16
Identity = 59/194 (30.41%), Postives = 92/194 (47.42%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK-----KVFNTEKIVNSVQCGTS 5619
            RT+  +K  + C +C + F     L+ H++IH ++    +   C  C + F        HM+ +   T  K + CT C K     + +N+H++IH+ E  I C  C K F++ S   +H+R HTGEKP+ C  CG  FS+  N+N H++ H   +  F   L  K   K        ++   EK     QCG S
Sbjct:  449 RTHTGEK-PFTCTQCGKSFNRSSRLDQHIRIHTRE----KPFTCTECGRSFNRSSHLNHHMRIH---TGEKPFTCTQCGKSFNRSSTLNQHIRIHTGEKPITCSQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEK-PFTCTLCGKSFNKSSHLNRHMRIHTAEKPFTCTQCGKS 633          

HSP 9 Score: 85.8853 bits (211), Expect = 3.138e-16
Identity = 49/142 (34.51%), Postives = 70/142 (49.30%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C +C + F     LN H++IH    T  + I C  C + F+      KHM+ +   T  K + CT C K  +     N HM+IH+ E    C +C K F K S+   H+R HT EKP+ C  CG  FS+  +   H+ RH
Sbjct:  513 FTCTQCGKSFNRSSTLNQHIRIH----TGEKPITCSQCGKSFRQSSSLYKHMRIH---TGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTLCGKSFNKSSHLNRHMRIHTAEKPFTCTQCGKSFSESSSLTLHMMRH 647          

HSP 10 Score: 83.5741 bits (205), Expect = 1.361e-15
Identity = 58/193 (30.05%), Postives = 86/193 (44.56%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            RT+  +K  + C +C + F     LN H++IH    T  + I C  C + F+      KHM+ +   T  K + CT C K  +     N HM+IH+ E    C  C K F + S +  H+R HTGEKP+ C  CG  F +  + N H++ H   +       G       R     ++   EK     +CG S
Sbjct:  309 RTHTGEK-PFTCTQCGKSFNRSSTLNQHIRIH----TGEKPITCTQCGKSFRQASSLNKHMRIH---TGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFIQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSRLDQHIRIHTREKPFTCTECGRS 493          

HSP 11 Score: 79.7221 bits (195), Expect = 2.284e-14
Identity = 54/189 (28.57%), Postives = 82/189 (43.39%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTS 5619
            + C +C + F    +LN H++ H    T  +   C  C + F       +H++ +   T  K   CT C K     + +N+HM+IH+ E    C  C K F + S +  H+R HTGEKP+ C  CG  F +  N+N H++ H   +          Q GK  +         +    EK     QCG S
Sbjct:  289 FTCTQCGKSFRQASSLNKHMRTH----TGEKPFTCTQCGKSFNRSSTLNQHIRIH---TGEKPITCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFIQSSNFNLHMRIHTGEKP-----FTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKS 465          

HSP 12 Score: 77.411 bits (189), Expect = 1.332e-13
Identity = 54/189 (28.57%), Postives = 83/189 (43.92%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTS 5619
            + C +C   F     L  H++IH    T  +   C  C + F        HM+ +   T  K + CT C K     + +++H++IH+ E  I C  C K F++ S   +H+R HTGEKP+ C  CG  FS+  ++N H++ H   +          Q GK  +         +    EK     QCG S
Sbjct:  149 FTCTQCGISFNCSSYLKQHMRIH----TGEKPFTCTQCGRSFNRLSHLNHHMRIH---TGEKPFTCTQCWKSFNRSSHLDQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSSFNLHMRIHTGVKP-----FTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKS 325          

HSP 13 Score: 71.633 bits (174), Expect = 6.808e-12
Identity = 53/203 (26.11%), Postives = 88/203 (43.35%), Query Frame = 1
Query: 5047 HKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR--------DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            H +++    ++ K  + C +C ++  +   L  H+ IH    T  +   C  C + F       +H++ +   T  K + CT C K     +  N+HM+IH+ E    C  C   F   SY  +H+R HTGEKP+ C  CG  F++  + N H++ H   +          F     + Q      ++   EK +   QCG S
Sbjct:   50 HLQTDGILKRRDKNCFICTQCGKILASKSKLKIHMIIH----TGGKPFTCTQCRKSFNRSSHLDQHIRIH---TGEKPFMCTQCGKSFRQSSSFNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRLSHLNHHMRIHTGEKPFTCTQCWKSFNRSSHLDQH----IRIHTGEKPITCTQCGKS 241          
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Match: znf1018 (zinc finger protein 1018 [Source:ZFIN;Acc:ZDB-GENE-110913-173])

HSP 1 Score: 144.436 bits (363), Expect = 6.542e-35
Identity = 151/636 (23.74%), Postives = 236/636 (37.11%), Query Frame = 1
Query: 1990 SIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIR-HVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            S +   H +I+   +  +C  CG+ F  S+N+ DH +R H G   F C +    F    +   H      E+ I C    ++  + +    ++     + P  C +C   F Q+    LH+ I  G                     + F C  CG ++ +   L  HM  H      +C  C         ++QH+R  +H  E        K + C  C   +    + Y H                                  + TG K F+C  C      +  ++  H+ +  G   E    C  C   F     L  H+R   I +GE         F+C +C    H    +     +H +  P    C  C +          H+  H   +  FTC +C   F   + LK H+    G K     C+ C + F+ S  +    R+H  E+        PF+C  C + F   + L  H  +H G   + C LC K  +   +   H   H   + F CT+C  +F        H+R+ H   +P  + C  CGK   Q S    HM IH   + + C  CGK F +S++ N+H+RIH GEKP  C  C + F + S+L  H+  H
Sbjct:   73 SSYLKQHMRIHTGEKPFTCTQCGKSFNRSSNL-DHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTG--------------------EKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIR--IHTGE--------KPITCTQCGKSFRQSSSLYKHMR--------------------------------IHTGEKPFTCTQCGKSFSQSS-NFNLHMRIHTG---EKPITCTQCGKSFHQSSSLYKHMR---IHTGE-------KPFTCTQCGKSFHQASSLNKHMRIHTEEKP--ITCTQCGKSFRQTSSLNKHMRIHT-GEKPFTCTQCGISFNCSSYLKQHMRIHTGEK--PFTCTQCGRSFNRSSNLDHHMRIHTGEK--------PFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRI-HTGEKP--FTCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIH 615          

HSP 2 Score: 109.768 bits (273), Expect = 8.376e-24
Identity = 92/326 (28.22%), Postives = 136/326 (41.72%), Query Frame = 1
Query: 2872 DTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            D  C  C   F     L  H+R   I +GE         F+C +C    +    + H   +H    P  + C  C +          H+  H   +   TC  C   F+  ++L  H+    G K     C+ C K FS S    +H +  H G     PF+C  C + F   + L  H   H G     C  C K          H   H   +   CT+C  +FR   ++ +H+R+ H   +P  + C  CGK  +Q S   +HM IH   +   C  CGK F +S+   +H+RIH GEKP+ C  C + F++ S+LN H+  H
Sbjct:   61 DKNCFTCTH-FNCSSYLKQHMR---IHTGE-------KPFTCTQCGKSFNRSSNLDHHMRIHTGEKP--FTCTQCGKSFNRSSNLDQHIRIHT-GEKPITCTLCGKSFRQSSSLSKHMRIHTGEK--PFTCTQCGKSFSQSSNFNLH-MRIHTG---EKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRI-HTGEKP--FTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFHQASSLNKHMRIH 363          

HSP 3 Score: 92.0485 bits (227), Expect = 3.547e-18
Identity = 59/196 (30.10%), Postives = 91/196 (46.43%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTSDYPDLEL 5640
            + C +C + F    N N H++IH    T  +   C  C + F+      KHM+++   T  K + CT C K     + +N+H++IH+ E  I C  C K F++ S   +H+R HTGEKP+ C  CG  FS+  N+N H++ H   +      +   Q GK            ++   EK     QCG S +    L
Sbjct:  173 FTCTQCGKSFSQSSNFNLHMRIH----TGEKPFTCTQCGKSFRQASSLNKHMRTH---TGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKP-----ITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFHQASSL 356          

HSP 4 Score: 86.6557 bits (213), Expect = 1.498e-16
Identity = 48/142 (33.80%), Postives = 75/142 (52.82%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C +C + F    NL+ H++IH    T  + I C  C + F+     +KHM+++   T  K + CT C K  +     N HM+IH+ E    C  C K F++ S   +H+R HTGEKP+ C  CG  F++  + N H++ H
Sbjct:  453 FTCTQCGKSFNRSSNLDQHIRIH----TGEKPITCTLCGKSFRQSSSLSKHMRTH---TGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGKSFNRSSHLNQHIRIH 587          

HSP 5 Score: 85.8853 bits (211), Expect = 2.809e-16
Identity = 58/189 (30.69%), Postives = 86/189 (45.50%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTS 5619
            + C +C + F    +LN H++IH    T  + I C  C + F+      KHM+ +   T  K + CT C K  +     N HM+IH+ E  I C  C K F + S   +H+R HTGEKP+ C  CG  F +  + N H++ H   +      +   Q GK  +         ++   EK     QCG S
Sbjct:  229 FTCTQCGKSFNRSSHLNQHIRIH----TGEKPITCTQCGKSFRQSSSLYKHMRIH---TGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKSFHQSSSLYKHMRIHTGEKPFTCTQCGKSFHQASSLNKHMRIHTEEKP-----ITCTQCGKSFRQTSSLNKHMRIHTGEKPFTCTQCGIS 405          

HSP 6 Score: 82.0333 bits (201), Expect = 4.220e-15
Identity = 50/142 (35.21%), Postives = 73/142 (51.41%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHSEPS-IACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C +C + F    N N H++IH    T  + I C  C + F       KHM+ +   T  K + CT C K     + +N+HM+IH+E   I C  C K F++ S   +H+R HTGEKP+ C  CG  F    N + +LK+H
Sbjct:  285 FTCTQCGKSFSQSSNFNLHMRIH----TGEKPITCTQCGKSFHQSSSLYKHMRIH---TGEKPFTCTQCGKSFHQASSLNKHMRIHTEEKPITCTQCGKSFRQTSSLNKHMRIHTGEKPFTCTQCGISF----NCSSYLKQH 415          

HSP 7 Score: 81.6481 bits (200), Expect = 5.701e-15
Identity = 55/189 (29.10%), Postives = 85/189 (44.97%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTS 5619
            + C +C   F     L  H++IH    T  +   C  C + F        HM+ +   T  K + CT C K     + +++H++IH+ E  I C +C K F++ S   +H+R HTGEKP+ C  CG  FS+  N+N H++ H   +          Q GK  +         ++   EK     QCG S
Sbjct:  397 FTCTQCGISFNCSSYLKQHMRIH----TGEKPFTCTQCGRSFNRSSNLDHHMRIH---TGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKP-----FTCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGKS 573          

HSP 8 Score: 79.337 bits (194), Expect = 2.817e-14
Identity = 53/189 (28.04%), Postives = 84/189 (44.44%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIK---------KVFNTEKIVNSVQCGTS 5619
            + C +C + F    NL+ H++IH    T  +   C  C + F       +H++ +   T  K   CT+C K     + +++HM+IH+ E    C  C K F + S +  H+R HTGEKP+ C  CG  F +  + N H++ H   +          Q GK            ++   EK +   QCG S
Sbjct:   89 FTCTQCGKSFNRSSNLDHHMRIH----TGEKPFTCTQCGKSFNRSSNLDQHIRIH---TGEKPITCTLCGKSFRQSSSLSKHMRIHTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKP-----FTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKS 265          

HSP 9 Score: 72.7886 bits (177), Expect = 3.014e-12
Identity = 41/122 (33.61%), Postives = 63/122 (51.64%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKC 5445
            + C +C + F    N N H++IH    T  +   C  C + F+      KHM+ +   T  K + CT C K     + +N+H++IH+ E  I C  C K F++ S   +H+R HTGEKP+ C
Sbjct:  509 FTCTQCGKSFSQSSNFNLHMRIH----TGEKPFTCTQCGKSFRQASSLNKHMRIH---TGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITCTQCGKSFRQSSSLYKHMRIHTGEKPFTC 623          

HSP 10 Score: 62.3882 bits (150), Expect = 4.870e-9
Identity = 34/97 (35.05%), Postives = 52/97 (53.61%), Query Frame = 1
Query: 3550 KLAMRRHIRVDHLNLEPERYECQICGKI--VTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            K+  + H++ D + L+     C  C      + +  HM IH   + + C  CGK F +S+  + H+RIH GEKP+ C  C + FN+ SNL+ HI  H
Sbjct:   44 KIEEKTHLQTDSI-LKRRDKNCFTCTHFNCSSYLKQHMRIHTGEKPFTCTQCGKSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIH 139          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: synrg (synergin, gamma [Source:Xenbase;Acc:XB-GENE-993541])

HSP 1 Score: 146.362 bits (368), Expect = 9.597e-35
Identity = 166/660 (25.15%), Postives = 267/660 (40.45%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYV-KHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEY----------------------INAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H +I+   +  SC  CG+EF   ++++ H+  H G   F C +    F+D  +  SH      E+   C    +   +++   L++     + P  C +C   F +   L  H  I        C   G  F+  T   S  K   GE      F C  CG  +S    L  H   H       C  C       D  S H    +H  E        K   C  C   +  + + + HQ    G    P    E  +  + R +  ++    + TG K FSC  C  E   +GR  + +HL +    T E    C  C   F     L  HL+   I +GE                       I+ G +  FSC +C      +  +     +H    P  + C  C +  + +     H + H   +  F+C EC   F + ++L  HL+   G K     C+ C K+FS+   +  H L+ H G     PFSC  C ++F  ++ LQ+HQ++H G     C  C K      + + H+  H   + F CTEC   F  + ++ RH+++ H   +P  + C  CG+  ++ S    H  IH   + + C  CGK+F++ +  + H +IH GEK + C  C ++F++KS+L+ H+  H
Sbjct:  192 HLRIHTGEKPFSCTECGKEFSQESHLHRHQKIHTGEKPFSCTECGKEFSDRSNLHSHLKIHTGEKPFSCTECGKEFSDRSNLHLHLKIHTGEKPFHCTECGKEFSRQSHLDRHQKIHTGEKPFHCTECGKEFSDWTSHHSHLKIHTGEKP----FFCTECGKEFSDRSSLHRHQKIHTGEKPFHCTECGKEFS--DRSSLHRHQKIHTGE--------KPFSCTECGKEFSQESHLHKHQKIHTGEK--PFSCTECRKEFFDRYS--LHSHLRIHTGEKPFSCTECGKEF--SGRSNLHRHLKIH---TGEKPFSCTECGKEFSGRSNLHRHLK---IHTGEKPFHCTECGKEFSDWTSHHSHLKIHTG-EKPFSCTECGKEFSQKSSLHSHQKIHTGEKP--FSCTECGKEFSQKSSLHSHQKNHT-GEKPFSCIECGKEFFDRSSLHSHLKIHTGEK--PFSCTECGKEFSDRSNLNSH-LKIHTG---EKPFSCTECGKEFSRKSHLQSHQKIHTGEKSFSCTECGKKLSRKSSLQSHQKIHTGEKSFSCTECGKEFSDRSSLHRHLKI-HTGEKP--FSCTECGQEFSRKSNLHSHQKIHTGEKPFSCTECGKKFSRKSSLHSHQKIHTGEKSFSCTECGKKFSRKSHLHRHLQIH 812          

HSP 2 Score: 137.502 bits (345), Expect = 4.954e-32
Identity = 162/645 (25.12%), Postives = 246/645 (38.14%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKC-------------HKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLD--SKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H +I+   +  SC  CG+EF   ++++ H   H G   F C             H+HQ + T  K +         C    +   +++    ++     + P  C +C   F     L LHL I        C   G  F+ ++ LD   K   GE      F C  CG  +S      SH+  H       C  C       D  S H    +H  E        K   C  C   +  + + + HQ    G    P    E  +   +     +++   + TG K FSC  C  E          HL +    T E    C  C   F     L  HL+   I +GE         FSC +C      R  +     +H    P  + C  C +  +D      HL+ H   +  F+C EC   F  +++L  H +   G K     C+ C K+FS    +  H  + H G     PFSC  C ++F   + L +H ++H G     C  C K          H   H   + F CTEC   F  K  ++ H ++   +   + + C  CGK +++ S    H  IH   + + C  CGK F+  +  + H++IH GEKP+ C  C + F++KSNL+ H   H
Sbjct:  164 HLRIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQESHLHRHQKIHTGEKPF--------SCTECGKEFSDRSNLHSHLKIHTGEKPFSCTECGKEFSDRSNLHLHLKIHTGEKPFHCTECGKEFSRQSHLDRHQKIHTGEKP----FHCTECGKEFSDWTSHHSHLKIHTGEKPFFCTECGKEFS--DRSSLHRHQKIHTGE--------KPFHCTECGKEFSDRSSLHRHQKIHTGEK--PFSCTECGKEFSQE--SHLHKHQKIHTGEKPFSCTECRKEF-FDRYSLHSHLRIH---TGEKPFSCTECGKEFSGRSNLHRHLK---IHTGE-------KPFSCTECGKEFSGRSNLHRHLKIHTGEKP--FHCTECGKEFSDWTSHHSHLKIHT-GEKPFSCTECGKEFSQKSSLHSHQKIHTGEK--PFSCTECGKEFSQKSSLHSH-QKNHTG---EKPFSCIECGKEFFDRSSLHSHLKIHTGEKPFSCTECGKEFSDRSNLNSHLKIHTGEKPFSCTECGKEFSRKSHLQSHQKI---HTGEKSFSCTECGKKLSRKSSLQSHQKIHTGEKSFSCTECGKEFSDRSSLHRHLKIHTGEKPFSCTECGQEFSRKSNLHSHQKIH 756          

HSP 3 Score: 127.487 bits (319), Expect = 7.614e-29
Identity = 155/616 (25.16%), Postives = 228/616 (37.01%), Query Frame = 1
Query: 2074 SANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHE--------EFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTS--------ECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEE---NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            SA    H+    G   F C +    F+D  S  SHH          + +C  E       + + ++       C +C K    F Q   L  HL I  G    + T    ++    +L S        + F C  CG  +S+   L  H   H      SC  C         +  HL+  +H  E        K   C  C   +  + N + H     G    P    E  +     R   ++    + TG K F C  C  E      D+  H       T E    C  C   F     L  H +   I +GE         F C +C      R  +     +H    P  + C  C +  +       HL KH++    +  F+C EC+  F +  +L  HL    G K     C+ C K+FS    +  H L+ H G     PFSC  C ++F   + L  H ++H G     C  C K      ++  H   H   + F CTEC   F  K ++  H ++ H   +P  + C  CGK  +Q S    H   H   + + C  CGK F   +  + H++IH GEKP+ C  C + F+ +SNLN H+  H
Sbjct:   75 SAKDPSHQQLLTGEKPFTCTECGKEFSDRSSLHSHHRIQTWEKPFSYTECGKEFFDSRLHSHQKIHTGEKPFSCTECGK---EFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQESHLHRHQKIHTGEKPFSCTECGKEFSDRSNLHSHLK--IHTGE--------KPFSCTECGKEFSDRSNLHLHLKIHTGEK--PFHCTECGKEF--SRQSHLDRHQKIHTGEKPFHCTECGKEFS----DWTSHHSHLKIHTGEKPFFCTECGKEFSDRSSLHRHQK---IHTGE-------KPFHCTECGKEFSDRSSLHRHQKIHTGEKP--FSCTECGKEFSQES----HLHKHQKIHTGEKPFSCTECRKEFFDRYSLHSHLRIHTGEK--PFSCTECGKEFSGRSNLHRH-LKIHTG---EKPFSCTECGKEFSGRSNLHRHLKIHTGEKPFHCTECGKEFSDWTSHHSHLKIHTGEKPFSCTECGKEFSQKSSLHSHQKI-HTGEKP--FSCTECGKEFSQKSSLHSHQKNHTGEKPFSCIECGKEFFDRSSLHSHLKIHTGEKPFSCTECGKEFSDRSNLNSHLKIH 644          

HSP 4 Score: 93.2041 bits (230), Expect = 2.874e-18
Identity = 130/562 (23.13%), Postives = 202/562 (35.94%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK 3630
            HQKI+   +  SC  CG+EF   ++++ H+  H G   F C + +  F D  S  SH                     ++       C +C K    F     L  HL I        C   G  F+ R+ L    K   GE      F C  CG  +S      SH+  H      SC  C         +  H +  +H  E        K   C  C   +  K + + HQ N  G    P    E  +  + R +  ++    + TG K FSC  C  E      +   HL +    T E    C  C   F          R++H+QS + I+ G +S                               + C  C ++++ +   + H + H   + +F+C EC   F + ++L  HL+   G K     C+ C ++FS    +    ++H  E+        PFSC  C +KF  ++ L +HQ++H G                           + F CTEC   F  K  + RH+++ H   +P  + C  CGK
Sbjct:  388 HQKIHTGEKPFSCTECGKEFSQESHLHKHQKIHTGEKPFSCTECRKEFFDRYSLHSH-------------------LRIHTGEKPFSCTECGK---EFSGRSNLHRHLKIHTGEKPFSCTECGKEFSGRSNLHRHLKIHTGEKP----FHCTECGKEFSDWTSHHSHLKIHTGEKPFSCTECGKEFSQKSSLHSHQK--IHTGE--------KPFSCTECGKEFSQKSSLHSHQKNHTGEK--PFSCIECGKEFFDRSS--LHSHLKIHTGEKPFSCTECGKEFSDRS-NLNSHLKIH---TGEKPFSCTECGKEFS---------RKSHLQSHQKIHTGEKS-------------------------------FSCTECGKKLSRKSSLQSHQKIHT-GEKSFSCTECGKEFSDRSSLHRHLKIHTGEK--PFSCTECGQEFSRKSNLHSHQKIHTGEK--------PFSCTECGKKFSRKSSLHSHQKIHTGE--------------------------KSFSCTECGKKFSRKSHLHRHLQI-HTGEKP--FSCTECGK 825          

HSP 5 Score: 92.0485 bits (227), Expect = 6.513e-18
Identity = 61/182 (33.52%), Postives = 87/182 (47.80%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            ++C +C + F    NLNSH+KIH    T  +   C  C + F  K     H K +   T  K + CT C K ++    +  H KIH+ E S +C  C K+F  +S    HL+ HTGEKP+ C  CG EFS+K N + H K H   +     + G     K      +K+   EK  +  +CG
Sbjct:  622 FSCTECGKEFSDRSNLNSHLKIH----TGEKPFSCTECGKEFSRKSHLQSHQKIH---TGEKSFSCTECGKKLSRKSSLQSHQKIHTGEKSFSCTECGKEFSDRSSLHRHLKIHTGEKPFSCTECGQEFSRKSNLHSHQKIHTGEKPFSCTECGKKFSRKSSLHSHQKIHTGEKSFSCTECG 796          

HSP 6 Score: 80.8777 bits (198), Expect = 1.926e-14
Identity = 57/182 (31.32%), Postives = 85/182 (46.70%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            ++C +C + F    + +SH+KIH    T  +   C  C + F  K     H K +   T  K + CT C K  +    ++ H K H+ E   +C  C K+F  +S    HL+ HTGEKP+ C  CG EFS + N N HLK H   +     + G     K   +  +K+   EK  +  +CG
Sbjct:  510 FHCTECGKEFSDWTSHHSHLKIH----TGEKPFSCTECGKEFSQKSSLHSHQKIH---TGEKPFSCTECGKEFSQKSSLHSHQKNHTGEKPFSCIECGKEFFDRSSLHSHLKIHTGEKPFSCTECGKEFSDRSNLNSHLKIHTGEKPFSCTECGKEFSRKSHLQSHQKIHTGEKSFSCTECG 684          

HSP 7 Score: 77.7962 bits (190), Expect = 1.349e-13
Identity = 49/142 (34.51%), Postives = 73/142 (51.41%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            ++C +C + F    +L+ H KIH    T  +   C  C + F  +    KH K +   T  K + CT C+K       ++ H++IH+ E   +C  C K+F  +S    HL+ HTGEKP+ C  CG EFS + N + HLK H
Sbjct:  370 FHCTECGKEFSDRSSLHRHQKIH----TGEKPFSCTECGKEFSQESHLHKHQKIH---TGEKPFSCTECRKEFFDRYSLHSHLRIHTGEKPFSCTECGKEFSGRSNLHRHLKIHTGEKPFSCTECGKEFSGRSNLHRHLKIH 504          

HSP 8 Score: 77.7962 bits (190), Expect = 1.572e-13
Identity = 54/182 (29.67%), Postives = 87/182 (47.80%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            ++C +C + F    +L+ H KIH    T  +   C  C + F ++     H++ +   T  K + CT C K  +    ++ H+KIH+ E   +C  C K+F  +S    HL+ HTGEKP+ C  CG EFS   +++ HLK H   +     + G     K      +K+   EK  +  +CG
Sbjct:  398 FSCTECGKEFSQESHLHKHQKIH----TGEKPFSCTECRKEFFDRYSLHSHLRIH---TGEKPFSCTECGKEFSGRSNLHRHLKIHTGEKPFSCTECGKEFSGRSNLHRHLKIHTGEKPFHCTECGKEFSDWTSHHSHLKIHTGEKPFSCTECGKEFSQKSSLHSHQKIHTGEKPFSCTECG 572          

HSP 9 Score: 76.2554 bits (186), Expect = 4.214e-13
Identity = 54/182 (29.67%), Postives = 87/182 (47.80%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDF----GNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            ++C +C + F    +L+ H KIH    T  +   C  C + F ++     H+K +   T  K + CT C K  +    ++ H+KIH+ E    C  C K+F ++S+   H + HTGEKP+ C  CG EFS   +++ HLK H   +  F    G     +      +K+   EK  +  +CG
Sbjct:  202 FSCTECGKEFSQESHLHRHQKIH----TGEKPFSCTECGKEFSDRSNLHSHLKIH---TGEKPFSCTECGKEFSDRSNLHLHLKIHTGEKPFHCTECGKEFSRQSHLDRHQKIHTGEKPFHCTECGKEFSDWTSHHSHLKIHTGEKPFFCTECGKEFSDRSSLHRHQKIHTGEKPFHCTECG 376          

HSP 10 Score: 73.9442 bits (180), Expect = 2.285e-12
Identity = 46/126 (36.51%), Postives = 65/126 (51.59%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICG 5457
            ++C +C + F    +L+ H+KIH    T  +   C  C Q F  K     H K +   T  K + CT C K  +    ++ H KIH+ E S +C  C KKF +KS+   HL+ HTGEKP+ C  CG
Sbjct:  706 FSCTECGKEFSDRSSLHRHLKIH----TGEKPFSCTECGQEFSRKSNLHSHQKIH---TGEKPFSCTECGKKFSRKSSLHSHQKIHTGEKSFSCTECGKKFSRKSHLHRHLQIHTGEKPFSCTECG 824          

HSP 11 Score: 73.1738 bits (178), Expect = 4.547e-12
Identity = 46/142 (32.39%), Postives = 73/142 (51.41%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            ++C +C +      +L SH KIH    T  +   C  C + F ++    +H+K +   T  K + CT C +  +    ++ H KIH+ E   +C  C KKF +KS    H + HTGEK + C  CG +FS+K + + HL+ H
Sbjct:  678 FSCTECGKKLSRKSSLQSHQKIH----TGEKSFSCTECGKEFSDRSSLHRHLKIH---TGEKPFSCTECGQEFSRKSNLHSHQKIHTGEKPFSCTECGKKFSRKSSLHSHQKIHTGEKSFSCTECGKKFSRKSHLHRHLQIH 812          

HSP 12 Score: 72.0182 bits (175), Expect = 1.002e-11
Identity = 48/142 (33.80%), Postives = 74/142 (52.11%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            ++  +C + F   R L+SH KIH    T  +   C  C + F  K     H++ +   T  K + CT C K  +    ++ H++IH+ E   +C  C K+F ++S+   H + HTGEKP+ C  CG EFS + N + HLK H
Sbjct:  119 FSYTECGKEFFDSR-LHSHQKIH----TGEKPFSCTECGKEFSQKSSLHSHLRIH---TGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQESHLHRHQKIHTGEKPFSCTECGKEFSDRSNLHSHLKIH 252          

HSP 13 Score: 69.707 bits (169), Expect = 4.541e-11
Identity = 47/142 (33.10%), Postives = 70/142 (49.30%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFI---NEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            ++C +C + F    NL+ H+KIH    T  +   C  C + F  +    +H K +   T  K + CT C K  +     + H+KIH+ E    C  C K+F  +S    H + HTGEKP+ C  CG EFS + + + H K H
Sbjct:  258 FSCTECGKEFSDRSNLHLHLKIH----TGEKPFHCTECGKEFSRQSHLDRHQKIH---TGEKPFHCTECGKEFSDWTSHHSHLKIHTGEKPFFCTECGKEFSDRSSLHRHQKIHTGEKPFHCTECGKEFSDRSSLHRHQKIH 392          

HSP 14 Score: 65.855 bits (159), Expect = 6.580e-10
Identity = 52/169 (30.77%), Postives = 81/169 (47.93%), Query Frame = 1
Query: 5158 HNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNL-TETKKYQCTICKKVV--AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGT--SDYPDL 5634
            H + LT  +   C  C + F ++      + S+H + T  K +  T C K    + ++ H KIH+ E   +C  C K+F +KS    HLR HTGEKP+ C  CG EFS+K + + HL+ H   +     + G     +      +K+   EK  +  +CG   SD  +L
Sbjct:   81 HQQLLTGEKPFTCTECGKEFSDRSS----LHSHHRIQTWEKPFSYTECGKEFFDSRLHSHQKIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQESHLHRHQKIHTGEKPFSCTECGKEFSDRSNL 245          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: ENSXETT00000036778.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:757546:796076:-1 gene:ENSXETG00000015770.1 transcript:ENSXETT00000036778.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.517 bits (371), Expect = 1.099e-34
Identity = 179/687 (26.06%), Postives = 250/687 (36.39%), Query Frame = 1
Query: 1948 DKIFDLPLQISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDI-LCSHMNNHLSCNVCKTRLGSIDEVSQHLRDHLHKNE---NVSGPG---------------KRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSY---MATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGL---TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQE----IRVHILEEHEGCVEL--------------------YPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
             K F+ P ++++        H++I+   R  SC  CG+ FK    +  H   H G   F C + +  FT       H                     L+       C QC KC+ +  ++D+ R HL      S     P              C  CG C  + S L+  L SH     SC+ C     S  +++ HLR H  ++       G G                 K   C  C   Y      Y H+ +  G    P    E  +   K        L+Y   + TG K FSC  C       G+ Y  H  +K      T E    C  C   F    +L+ H   +H++ G Y      S F C K   F     +  H  S H    P  Y CP C +   DR   R HL  H   +  FTC +C+  F + + L  HL++  G K     CS C K F ++ +    +R+H  E    C E                      PF+C  C + F     L +H+++H G     C  C K          H+  H   + F CTEC   FR +  ++ H R+ H   +P  + C  CGK     T +  H  IH   + + C  CGK F        H + H GEKPY C  C +RFN  S L VH   H   R
Sbjct:  298 GKRFNCPSKLTI--------HERIHTGERPYSCSECGKGFKERTTLNAHLRSHTGEKPFTCSQCEKCFTHRSDLNRH-------------------LALHKGEKPFSCSQCGKCFTH--RSDLNR-HLK-----SHKGEKPFS------------CSQCGKCFTHRSDLNRHLKSHRERPFSCSQCLKNFTSSSQLTAHLRVHSGESPYSCTECGKGFKHPSYLVAHQRIHTGEKPFSCSECGKCYRDHAGLYSHKKSHAGK--KPFSCTECGKCFSK-----AASLTYHKKIHTGEKPFSCTEC-------GKCYRDHAALKFHTRIHTGEKPFACNECGKCFLYRYQLTAH-SHSHMEEGPY------SCFECGK--RFKRRSQLTVHRRS-HTGERP--YSCPKCGKDFKDRSTLRAHLRIH-TGEKPFTCSQCEKCFTHRSDLNRHLKSHKGEK--TFSCSQCGKYFISTSDLTVHLRIHTGERPYSCSECGKCFKDPSYLTTHQRIHTGEKPFTCTECGKCFSGRAGLNSHKKIHTGKKSFTCTECGKCFSEGARLRYHKKIHTGEKPFSCTECGNCFRDREGLKSHTRI-HTGEKP--FSCSECGKCFSDRTSLKSHKRIHTGEKPFACNECGKCFMYRYQLTAHSQTHTGEKPYSCSHCGKRFNCPSKLTVHQRSHTGER 905          

HSP 2 Score: 138.658 bits (348), Expect = 5.230e-32
Identity = 156/633 (24.64%), Postives = 239/633 (37.76%), Query Frame = 1
Query: 1996 WRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIK--TDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            + + HQ+I+   +  SC  CG+ ++  A +Y H+  H G   F C +    F+   S   H +                   ++       C +C KCY                D  +    T + +   P        F C  CG  +     L +H ++H+     SC  C  R     +++ H R H          G+R         DF              H  +H   K  T    E  +  R+  +N       G K FSC  C  +  ++  D   HL +  G   E    C  C   F+ P  L+ H R   I +GE         F+C +C      R  +     +H       + C  C +  ++    R H + H   +  F+C EC   F++   LK H     G K     CS C K FS+   +    R+H  E+        PF+C  C + F++  +L AH + H G     C  C K         +H+  H   R + C+EC   F+    +R H+R+ H   +P  + C  C K  T  S    H+ +HK  + + C  CGK FT  +  N H++ HKGEK + C  C + F+  S LNVH+  H   R
Sbjct:  473 YLVAHQRIHTGEKPFSCSECGKCYRDHAGLYSHKKSHAGKKPFSCTECGKCFSKAASLTYHKK-------------------IHTGEKPFSCTECGKCYR---------------DHAALKFHTRIHTGEKP--------FACNECGKCFLYRYQLTAHSHSHMEEGPYSCFECGKRFKRRSQLTVHRRSHT---------GERPYSCPKCGKDFKDRST------LRAHLRIHTGEKPFTCSQCEKCFTHRSD-LNRHLKSHKGEKTFSCSQC-GKYFISTSDLTVHLRIHTG---ERPYSCSECGKCFKDPSYLTTHQR---IHTGE-------KPFTCTECGKCFSGRAGLNSHKKIHTGKKS--FTCTECGKCFSEGARLRYHKKIHT-GEKPFSCTECGNCFRDREGLKSHTRIHTGEK--PFSCSECGKCFSDRTSLKSHKRIHTGEK--------PFACNECGKCFMYRYQLTAHSQTHTGEKPYSCSHCGKRFNCPSKLTVHQRSHTGERPYSCSECGKGFKDSWNLRAHLRI-HTGEKP--FTCSQCEKCFTHRSALKRHLALHKREKTFSCSRCGKCFTHRSDLNRHLKSHKGEKTFSCSQCGKCFSCTSALNVHLRSHSGER 1017          

HSP 3 Score: 128.257 bits (321), Expect = 8.665e-29
Identity = 171/681 (25.11%), Postives = 248/681 (36.42%), Query Frame = 1
Query: 2005 YHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFID-----CXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVS----------FNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHL-HKNENVSGPGK-----------------RKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCN-----------------AEVKVAGRDYVKHLDVKHGLTVELDT-------LCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            YH+KI+   +  SC  CG+ ++  A +  H   H G   F C++    F       +H    ++     C    +    ++Q  ++  +   + P  C KC   F     LR HL I  G            F  R+ L+   K   GE      F C  CG  +     L  H+  H      SC+ C         ++ H R H   K    +  GK                 +K   C  C   +       YH+    G    P    E       R  + +   + + TG K FSC  C                   E   A  +  K    ++ LT    T        C  C   F  P +L+ H R +   +GE         +SC +C   F     + AH   +H    P  + C  C +    R   + HL  H+  + TF+C  C   F + + L  HL++  G K     CS C K FS +  + VH L  H G     P+SC  C + F + + L  HQ  H G     C  C K   +  +   H+  H   + F CTEC   FR+ + ++ H R+ H   +P  + C  CGK     T +  H  IH   + + C  CGK F  S     H R H GEKP+ C  C + F   S L  H   H
Sbjct:  532 YHKKIHTGEKPFSCTECGKCYRDHAALKFHTRIHTGEKPFACNECGKCFLYRYQLTAHSHSHMEEGPYSCFECGKRFKRRSQLTVHRRSHTGERPYSCPKCGKDFKDRSTLRAHLRIHTGEKPFTCSQCEKCFTHRSDLNRHLKSHKGEKT----FSCSQCGKYFISTSDLTVHLRIHTGERPYSCSECGKCFKDPSYLTTHQRIHTGEKPFTCTECGKCFSGRAGLNSHKKIHTGKKSFTCTECGKCFSEGARLRYHKKIHTG--EKPFSCTECGNCFRDR--EGLKSHTRIHTGEKPFSCSECGKCFSDRTSLKSHKRIHTGEKPFACNECGKCFMYRYQLTAHSQTHTGEKPYSCSHCGKRFNCPSKLTVHQRSH---TGE-------RPYSCSECGKGFKDSWNLRAH-LRIHTGEKP--FTCSQCEKCFTHRSALKRHLALHKREK-TFSCSRCGKCFTHRSDLNRHLKSHKGEK--TFSCSQCGKCFSCTSALNVH-LRSHSG---ERPYSCSECGKCFKYYSNLTVHQRTHTGEKPFSCPECGKCFTNGASLTYHKKCHTGEKPFTCTECGKCFRNSMGLKFHTRI-HTGEKP--FTCTECGKCFRNSTDLKFHTRIHTGEKPFTCTECGKCFRNSTDLKFHTRSHTGEKPFTCTECGKCFRNSSGLKFHTRIH 1181          

HSP 4 Score: 122.479 bits (306), Expect = 4.773e-27
Identity = 164/662 (24.77%), Postives = 237/662 (35.80%), Query Frame = 1
Query: 1942 IADKIFDLPLQISLFDSIWRL-YHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGV--------------SFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
               K F        F    RL YH+KI+   +  SC  CG  F+    +  H   H G   F C +    F+D  S KSH      E+   C    +  + + Q   +      + P  C  C   F     L +H     G               S+N R  L  +   GE      F C  C   ++    L  H+  H      SC+ C        ++++HL+   HK E        K   C  C   +        H  +  G    P    E  +         +++ ++  TG K FSC  C  +    G     H     G   E    C  C   F     L  H R   I +GE         F+C +C         +   T +H    P  + C  C +   +    + H   H   +  FTC EC   F+N + LK H     G K     C  C K F +   +++H    H G  ++ PFSC  C + F     L+ H  +H G     C  C K  +   + ++H   H   + F CTEC   FR+   ++ H R+ H   +P  + C  CGK     T +  H   H   + + C  CGK F  S     H RIH GEKP+ C+ C + F  +  L  H   H
Sbjct:  762 TGKKSFTCTECGKCFSEGARLRYHKKIHTGEKPFSCTECGNCFRDREGLKSHTRIHTGEKPFSCSECGKCFSDRTSLKSHKRIHTGEKPFACNECGKCFMYRYQLTAHSQTHTGEKPYSCSHCGKRFNCPSKLTVHQRSHTGERPYSCSECGKGFKDSWNLRAHL--RIHTGEKP----FTCSQCEKCFTHRSALKRHLALHKREKTFSCSRCGKCFTHRSDLNRHLKS--HKGE--------KTFSCSQCGKCFSCTSALNVHLRSHSGER--PYSCSECGKCFKYYSNLTVHQRTH--TGEKPFSCPEC-GKCFTNGASLTYHKKCHTG---EKPFTCTECGKCFRNSMGLKFHTR---IHTGE-------KPFTCTECGKCFRNSTDLKFHTRIHTGEKP--FTCTECGKCFRNSTDLKFHTRSH-TGEKPFTCTECGKCFRNSSGLKFHTRIHTGEK--PFTCIECGKCFRDCTSLKIHT-RIHTG-EKVKPFSCTECGKCFCNSTGLKFHTRIHTGEKPFTCTECGKCFRDHTSLKIHTRIHTGEKPFTCTECGKCFRNSSGLKFHTRI-HTGEKP--FTCTECGKCYRDRTGLKFHTRSHTGEKPFTCTECGKCFRNSTSLKIHTRIHTGEKPFACNECGKYFMYRYQLTAHSQLH 1379          

HSP 5 Score: 121.324 bits (303), Expect = 1.112e-26
Identity = 164/652 (25.15%), Postives = 235/652 (36.04%), Query Frame = 1
Query: 1945 ADKIFDLPLQISLFDSIWRL-YHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSEC--------FICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKI---VTQISMHMLIHKNAR---YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
             +K F        F S   L  H +I+   R  SC  CG+ FK  + +  H+  H G   F C +    F+      SH +                   ++       C +C KC   F +   LR H  I  G    + T   + +   E L S          F C  CG  +S    L SH   H      +CN C        +++ H + H             K   C  C   +        HQ +  G    P    E  +    + +  +     + TG K F+C  C  E     R  +K     H    E    C  C   F     L+ HL+ +    GE         FSC +C   F     +  H  S H+   P  Y C  C +         +H   H   +  F+C EC   F N A+L  H +   G K     C+ C K F NS  ++ H    H G     PF+C  C + F    +L+ H  +H G     C  C K  ++    + H   H   + F CTEC   FR+   ++ H R+ H   +P  + C  CGK     T + +H  IH   +   + C  CGK F  S     H RIH GEKP+ C  C + F   ++L +H   H
Sbjct:  679 GEKTFSCSQCGKYFISTSDLTVHLRIHTGERPYSCSECGKCFKDPSYLTTHQRIHTGEKPFTCTECGKCFSGRAGLNSHKK-------------------IHTGKKSFTCTECGKC---FSEGARLRYHKKIHTGEKPFSCTECGNCFRDREGLKSHTRIHTGEKPFSCSECGKCFSDRTSLKSHKRIHTGEKPFACNECGKCFMYRYQLTAHSQTHT----------GEKPYSCSHCGKRFNCPSKLTVHQRSHTGER--PYSCSECGKGF--KDSWNLRAHLRIHTGEKPFTCSQC--EKCFTHRSALKRHLALH--KREKTFSCSRCGKCFTHRSDLNRHLKSH---KGE-------KTFSCSQCGKCFSCTSALNVHLRS-HSGERP--YSCSECGKCFKYYSNLTVHQRTHT-GEKPFSCPECGKCFTNGASLTYHKKCHTGEK--PFTCTECGKCFRNSMGLKFHT-RIHTG---EKPFTCTECGKCFRNSTDLKFHTRIHTGEKPFTCTECGKCFRNSTDLKFHTRSHTGEKPFTCTECGKCFRNSSGLKFHTRI-HTGEKP--FTCIECGKCFRDCTSLKIHTRIHTGEKVKPFSCTECGKCFCNSTGLKFHTRIHTGEKPFTCTECGKCFRDHTSLKIHTRIH 1267          

HSP 6 Score: 114.005 bits (284), Expect = 1.946e-24
Identity = 133/530 (25.09%), Postives = 195/530 (36.79%), Query Frame = 1
Query: 2392 GEALTSECFICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMA------TGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGL---TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRV-------------------------DHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHE 3834
            GE L    F C  CG  +     L  H   H      SC+ C        + ++H R  +H+ E        K  IC  CN  + +      HQ +   V   P    E          KR N  S +       TG + +SC  C       G+ + +   +   L   T E    C  C   F     L+ HL    +  GE         FSC +C      R  +      H    P  + C  C +    R     HL+ H E    F+C +C   F + + L  HL    G  ++   C+ C K F +   +    R+H  E+        PFSC  C + +     L +H++ H G     C  C K      +   H+  H   + F CTEC   +R   A++ H R+                          H ++E   Y C  CGK     +Q+++H   H   R Y C  CGK F   +    H+RIH GEKP+ C  C++ F  +S+LN H+  H+
Sbjct:  204 GEKL----FSCSECGKRFRHRVPLIEHYRTHTGEKPYSCSDCGKSFSRSSDFNRHCR--IHRLE--------KSCICSKCNKQFTSHSELIVHQSSH--VGEGPYSCSECG--------KRFNCPSKLTIHERIHTGERPYSCSEC-------GKGFKERTTLNAHLRSHTGEKPFTCSQCEKCFTHRSDLNRHLA---LHKGE-------KPFSCSQCGKCFTHRSDLNRHLKSHKGEKP--FSCSQCGKCFTHRSDLNRHLKSHRERP--FSCSQCLKNFTSSSQLTAHLRVHSG--ESPYSCTECGKGFKHPSYLVAHQRIHTGEK--------PFSCSECGKCYRDHAGLYSHKKSHAGKKPFSCTECGKCFSKAASLTYHKKIHTGEKPFSCTECGKCYRDHAALKFHTRIHTGEKPFACNECGKCFLYRYQLTAHSHSHMEEGPYSCFECGKRFKRRSQLTVHRRSHTGERPYSCPKCGKDFKDRSTLRAHLRIHTGEKPFTCSQCEKCFTHRSDLNRHLKSHK 678          

HSP 7 Score: 105.916 bits (263), Expect = 5.454e-22
Identity = 80/253 (31.62%), Postives = 115/253 (45.45%), Query Frame = 1
Query: 3115 RRLWR----IHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVH--GGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            R LW     +H   H   +L F+C EC   F++   L  H  T  G K     CS C K FS S +     R+H LE+   C+      C  C ++F   +EL  HQ  H   G   C  C K         +H   H   R + C+EC   F+ +  +  H+R  H   +P  + C  C K  T    ++ H+ +HK  + + C  CGK FT  +  N H++ HKGEKP+ C  C + F  +S+LN H+  H
Sbjct:  188 RFLWETDYIVHKRSHTGEKL-FSCSECGKRFRHRVPLIEHYRTHTGEK--PYSCSDCGKSFSRSSDFNRHCRIHRLEK--SCI------CSKCNKQFTSHSELIVHQSSHVGEGPYSCSECGKRFNCPSKLTIHERIHTGERPYSCSECGKGFKERTTLNAHLR-SHTGEKP--FTCSQCEKCFTHRSDLNRHLALHKGEKPFSCSQCGKCFTHRSDLNRHLKSHKGEKPFSCSQCGKCFTHRSDLNRHLKSH 426          

HSP 8 Score: 83.9593 bits (206), Expect = 2.343e-15
Identity = 73/233 (31.33%), Postives = 101/233 (43.35%), Query Frame = 1
Query: 3154 NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHE 3834
            N  T  C E     K +A   +H +T  GVK     CS+CEK F    +  VH    H G      FSC  C ++F     L  H   H G     C  C K       +  H   H   +   C++C   F S   +  H +  H+   P  Y C  CGK     +++++H  IH   R Y C  CGK F +    N H+R H GEKP+ C  C++ F  +S+LN H+  H+
Sbjct:  148 NTETDNCSELHKPCKTKADFLMHQKTHTGVK--PFVCSVCEKRFLWETDYIVH-KRSHTG---EKLFSCSECGKRFRHRVPLIEHYRTHTGEKPYSCSDCGKSFSRSSDFNRHCRIHRLEKSCICSKCNKQFTSHSELIVH-QSSHVGEGP--YSCSECGKRFNCPSKLTIHERIHTGERPYSCSECGKGFKERTTLNAHLRSHTGEKPFTCSQCEKCFTHRSDLNRHLALHK 371          

HSP 9 Score: 81.2629 bits (199), Expect = 1.760e-14
Identity = 56/182 (30.77%), Postives = 84/182 (46.15%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD----DFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            Y+C KC + F     L +H++IH    T  +   C  C + F ++    +H+KS+      K + C+ C K     ++   H++IH+ E   +C  C K FK  SY   H R HTGEKP+ C  CG  FS +   N H K H   +     + G       R +  KK+   EK  +  +CG
Sbjct:  627 YSCPKCGKDFKDRSTLRAHLRIH----TGEKPFTCSQCEKCFTHRSDLNRHLKSHKG---EKTFSCSQCGKYFISTSDLTVHLRIHTGERPYSCSECGKCFKDPSYLTTHQRIHTGEKPFTCTECGKCFSGRAGLNSHKKIHTGKKSFTCTECGKCFSEGARLRYHKKIHTGEKPFSCTECG 801          

HSP 10 Score: 72.7886 bits (177), Expect = 6.089e-12
Identity = 127/558 (22.76%), Postives = 191/558 (34.23%), Query Frame = 1
Query: 1948 DKIFDLPLQISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSD----CPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFC------NAEVKVAGRDYV-----------KHLDVKHGL-------TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVK--------------------------QNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG 3426
             K F+ P ++++        HQ+ +   R  SC  CG+ FK S N+  H   H G   F C + +  FT   + K H      E+   C    +    ++    ++ +   +    C QC KC   F     L +HL      S +   P              C  CG C   YS L +   H   H      SC  C     +   ++ H + H             K   C  C   +   +   +H     G    P    E  +    R +  +   + + TG K F+C  C      + ++K   R +            K      GL       T E    C  C   F     L  H R   I +GE +       FSC +C   F +  G+  H T +H    P  + C  C +   D    +IH   H   +  FTC EC   F+N + LK H     G K                          +    C+ C K F NS  +++H    H G     PF+C  C + F++  +L AH ++H G
Sbjct:  885 GKRFNCPSKLTV--------HQRSHTGERPYSCSECGKGFKDSWNLRAHLRIHTGEKPFTCSQCEKCFTHRSALKRHLALHKREKTFSCSRCGKCFTHRSDLNRHLKSHKGEKTFSCSQCGKC---FSCTSALNVHLR-----SHSGERPYS------------CSECGKCFKYYSNLTV---HQRTHTGEKPFSCPECGKCFTNGASLTYHKKCHT----------GEKPFTCTECGKCFRNSMGLKFHTRIHTG--EKPFTCTECGKCF--RNSTDLKFHTRIHTGEKPFTCTECGKCFRNSTDLKFHTRSHTGEKPFTCTECGKCFRNSSGLKFHTRIHTGEKPFTCIECGKCFRDCTSLKIHTR---IHTGEKVKP-----FSCTECGKCFCNSTGLKFH-TRIHTGEKP--FTCTECGKCFRDHTSLKIHTRIHT-GEKPFTCTECGKCFRNSSGLKFHTRIHTGEKPFTCTECGKCYRDRTGLKFHTRSHTGEKPFTCTECGKCFRNSTSLKIHT-RIHTG---EKPFACNECGKYFMYRYQLTAHSQLHTG 1381          

HSP 11 Score: 71.2478 bits (173), Expect = 1.807e-11
Identity = 50/152 (32.89%), Postives = 71/152 (46.71%), Query Frame = 1
Query: 3406 HQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNARYQ-CEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            HQ+ H G+    C +C+K       Y +H+  H   ++F C+EC   FR ++ +  H R  H   +P  Y C  CGK  ++ S    H  IH+  +   C  C K+FT  +    H   H GE PY C  C +RFN  S L +H   H   R
Sbjct:  170 HQKTHTGVKPFVCSVCEKRFLWETDYIVHKRSHTGEKLFSCSECGKRFRHRVPLIEHYRT-HTGEKP--YSCSDCGKSFSRSSDFNRHCRIHRLEKSCICSKCNKQFTSHSELIVHQSSHVGEGPYSCSECGKRFNCPSKLTIHERIHTGER 318          

HSP 12 Score: 70.8626 bits (172), Expect = 2.387e-11
Identity = 56/201 (27.86%), Postives = 86/201 (42.79%), Query Frame = 1
Query: 5041 ILHKESNNRTNKKQKLE--YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
              H+   NR  K  K E  ++C +C + F +  +L  H++IH    T      C  C + F++      H + +   T  K + CT C K     A +N H KIH+ + S  C  C K F + +    H + HTGEKP+ C  CGN F  +     H + H   +     + G     +   K  K++   EK     +CG
Sbjct:  664 FTHRSDLNRHLKSHKGEKTFSCSQCGKYFISTSDLTVHLRIH----TGERPYSCSECGKCFKDPSYLTTHQRIH---TGEKPFTCTECGKCFSGRAGLNSHKKIHTGKKSFTCTECGKCFSEGARLRYHKKIHTGEKPFSCTECGNCFRDREGLKSHTRIHTGEKPFSCSECGKCFSDRTSLKSHKRIHTGEKPFACNECG 857          

HSP 13 Score: 69.3218 bits (168), Expect = 6.736e-11
Identity = 54/206 (26.21%), Postives = 77/206 (37.38%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES------------YRDDFGNYLQIKQRG--KPI------------------KKVFNTEKIVNSVQCG 5613
            + C +C + F    +LN H+ +H  +    +   C  C + F ++    +H+KS+         QC  C    + +N H+K H E   +C  C K F   S    HLR H+GE PY C  CG  F        H + H              YRD  G Y   K     KP                   KK+   EK  +  +CG
Sbjct:  348 FTCSQCEKCFTHRSDLNRHLALHKGE----KPFSCSQCGKCFTHRSDLNRHLKSHKGEKPFSCSQCGKCFTHRSDLNRHLKSHRERPFSCSQCLKNFTSSSQLTAHLRVHSGESPYSCTECGKGFKHPSYLVAHQRIHTGEKPFSCSECGKCYRDHAGLYSHKKSHAGKKPFSCTECGKCFSKAASLTYHKKIHTGEKPFSCTECG 549          

HSP 14 Score: 68.5514 bits (166), Expect = 1.247e-10
Identity = 42/142 (29.58%), Postives = 62/142 (43.66%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            ++C +C   F     L SH +IH    T  +   C  C + F ++     H + +   T  K + C  C K   +   +  H + H+ E   +C  C K+F   S    H R HTGE+PY C  CG  F   +N   HL+ H
Sbjct:  795 FSCTECGNCFRDREGLKSHTRIH----TGEKPFSCSECGKCFSDRTSLKSHKRIH---TGEKPFACNECGKCFMYRYQLTAHSQTHTGEKPYSCSHCGKRFNCPSKLTVHQRSHTGERPYSCSECGKGFKDSWNLRAHLRIH 929          

HSP 15 Score: 67.0106 bits (162), Expect = 4.235e-10
Identity = 48/179 (26.82%), Postives = 76/179 (42.46%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            + C +C + F     L  H+ +H ++ T +    C  C + F ++    +H+KS+         QC  C    + +N H++ HS E   +C  C K FK  S    H R HTGEKP+ C  CG  F+   +   H K H   +     + G   +     K   ++   EK     +CG
Sbjct:  935 FTCSQCEKCFTHRSALKRHLALHKREKTFS----CSRCGKCFTHRSDLNRHLKSHKGEKTFSCSQCGKCFSCTSALNVHLRSHSGERPYSCSECGKCFKYYSNLTVHQRTHTGEKPFSCPECGKCFTNGASLTYHKKCHTGEKPFTCTECGKCFRNSMGLKFHTRIHTGEKPFTCTECG 1109          

HSP 16 Score: 65.855 bits (159), Expect = 8.384e-10
Identity = 43/142 (30.28%), Postives = 65/142 (45.77%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIH-SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y+C +C + F    NL +H++IH    T  +   C  C + F ++    +H+  +      K + C+ C K       +N H+K H  E + +C  C K F   S    HLR H+GE+PY C  CG  F    N   H + H
Sbjct:  907 YSCSECGKGFKDSWNLRAHLRIH----TGEKPFTCSQCEKCFTHRSALKRHLALH---KREKTFSCSRCGKCFTHRSDLNRHLKSHKGEKTFSCSQCGKCFSCTSALNVHLRSHSGERPYSCSECGKCFKYYSNLTVHQRTH 1041          

HSP 17 Score: 65.4698 bits (158), Expect = 1.246e-9
Identity = 51/195 (26.15%), Postives = 78/195 (40.00%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIH-SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE--------------SYRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            K  ++C +C + F    +L  H KIH    T  +   C  C + +++      H + +   T  K + C  C K   +   +  H   H  E   +C  C K+FK++S    H R HTGE+PY C  CG +F  +     HL+ H               ++R D   +L          K    EK  +  QCG
Sbjct:  512 KKPFSCTECGKCFSKAASLTYHKKIH----TGEKPFSCTECGKCYRDHAALKFHTRIH---TGEKPFACNECGKCFLYRYQLTAHSHSHMEEGPYSCFECGKRFKRRSQLTVHRRSHTGERPYSCPKCGKDFKDRSTLRAHLRIHTGEKPFTCSQCEKCFTHRSDLNRHL----------KSHKGEKTFSCSQCG 689          

HSP 18 Score: 63.929 bits (154), Expect = 3.698e-9
Identity = 50/196 (25.51%), Postives = 86/196 (43.88%), Query Frame = 1
Query: 4942 LDQEWSIEESDMEHSMWNISRDIVKNGITENSIILHKESNNRTNKKQ----KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + +E+S E  +      N   + +    T   I+    SN+  +       K EY+C   N+    +  L   ++  +      E   C    +  + K  F  H K++   T  K + C++C+K   +  +   H + H+ E   +C  C K+F+ +   +EH R HTGEKPY C  CG  FS+  ++N H + H
Sbjct:   66 IKEEYSCEGENQSDCCINPPTEQIHETDTPTPIMGCSPSNSSADDYTSVVIKEEYSCKGENQSDCCINPLTEQIQGTDTPTPNTETDNCSELHKPCKTKADFLMHQKTH---TGVKPFVCSVCEKRFLWETDYIVHKRSHTGEKLFSCSECGKRFRHRVPLIEHYRTHTGEKPYSCSDCGKSFSRSSDFNRHCRIH 258          

HSP 19 Score: 61.6178 bits (148), Expect = 1.537e-8
Identity = 49/182 (26.92%), Postives = 72/182 (39.56%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            Y+C +C + F    NL  H + H    T  +   C  C + F N      H K +   T  K + CT C K       +  H +IH+ E    C  C K F+  +    H R HTGEKP+ C  CG  F    +   H + H   +     + G   +     K   ++   EK    ++CG
Sbjct: 1019 YSCSECGKCFKYYSNLTVHQRTH----TGEKPFSCPECGKCFTNGASLTYHKKCH---TGEKPFTCTECGKCFRNSMGLKFHTRIHTGEKPFTCTECGKCFRNSTDLKFHTRIHTGEKPFTCTECGKCFRNSTDLKFHTRSHTGEKPFTCTECGKCFRNSSGLKFHTRIHTGEKPFTCIECG 1193          

HSP 20 Score: 60.8474 bits (146), Expect = 2.942e-8
Identity = 47/170 (27.65%), Postives = 68/170 (40.00%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIKKVFN 5580
            K  + C +C + F     L  H KIH    T  +   C  C   F+++     H + +   T  K + C+ C K  +    +  H +IH+ E   AC  C K F  +     H + HTGEKPY C  CG  F+       H + H   R          + GK  K  +N
Sbjct:  764 KKSFTCTECGKCFSEGARLRYHKKIH----TGEKPFSCTECGNCFRDREGLKSHTRIH---TGEKPFSCSECGKCFSDRTSLKSHKRIHTGEKPFACNECGKCFMYRYQLTAHSQTHTGEKPYSCSHCGKRFNCPSKLTVHQRSHTGERP-----YSCSECGKGFKDSWN 921          

HSP 21 Score: 59.6918 bits (143), Expect = 6.126e-8
Identity = 41/146 (28.08%), Postives = 65/146 (44.52%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C  C + F    N  S + +H +  T      C  C + F++      H++ +   T  K + C+ C+K     + +  H+ +H  E + +C  C K F  +S    HL+ H GEK + C  CG  FS     N HL+ H   R
Sbjct:  879 YSCSHCGKRF----NCPSKLTVHQRSHTGERPYSCSECGKGFKDSWNLRAHLRIH---TGEKPFTCSQCEKCFTHRSALKRHLALHKREKTFSCSRCGKCFTHRSDLNRHLKSHKGEKTFSCSQCGKCFSCTSALNVHLRSHSGER 1017          

HSP 22 Score: 58.9214 bits (141), Expect = 1.233e-7
Identity = 48/177 (27.12%), Postives = 73/177 (41.24%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIH-----------NKDLTVNEKI-------------PCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            RT+  +K  Y+C  C + F    + N H +IH           NK  T + ++              C  C + F        H + +   T  + Y C+ C K       +N H++ H+ E    C  C+K F  +S    HL  H GEKP+ C  CG  F+ + + N HLK H+ 
Sbjct:  228 RTHTGEK-PYSCSDCGKSFSRSSDFNRHCRIHRLEKSCICSKCNKQFTSHSELIVHQSSHVGEGPYSCSECGKRFNCPSKLTIHERIH---TGERPYSCSECGKGFKERTTLNAHLRSHTGEKPFTCSQCEKCFTHRSDLNRHLALHKGEKPFSCSQCGKCFTHRSDLNRHLKSHKG 400          

HSP 23 Score: 58.5362 bits (140), Expect = 1.376e-7
Identity = 56/202 (27.72%), Postives = 83/202 (41.09%), Query Frame = 1
Query: 5014 KNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIH-SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE--------------SYRDDFGNYLQIKQRGKPI 5565
            K  + E   I+HK    R++  +KL ++C +C + F     L  H + H    T  +   C  C + F     F +H +  H L   K   C+ C K     +E   H   H  E   +C  C K+F   S    H R HTGE+PY C  CG  F ++   N HL+ H               ++R D   +L + +  KP 
Sbjct:  187 KRFLWETDYIVHK----RSHTGEKL-FSCSECGKRFRHRVPLIEHYRTH----TGEKPYSCSDCGKSFSRSSDFNRHCR-IHRLE--KSCICSKCNKQFTSHSELIVHQSSHVGEGPYSCSECGKRFNCPSKLTIHERIHTGERPYSCSECGKGFKERTTLNAHLRSHTGEKPFTCSQCEKCFTHRSDLNRHLALHKGEKPF 376          

HSP 24 Score: 58.5362 bits (140), Expect = 1.510e-7
Identity = 44/161 (27.33%), Postives = 71/161 (44.10%), Query Frame = 1
Query: 5041 ILHKESNNRTNKKQKLE--YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
              H+   NR  K  K E  ++C +C + F    +LN H+K H +         C  C + F +      H++ +   +    Y CT C K     +++  H +IH+ E   +C  C K ++  +    H + H G+KP+ C  CG  FSK  +   H K H
Sbjct:  385 FTHRSDLNRHLKSHKGEKPFSCSQCGKCFTHRSDLNRHLKSHRE-----RPFSCSQCLKNFTSSSQLTAHLRVHSGESP---YSCTECGKGFKHPSYLVAHQRIHTGEKPFSCSECGKCYRDHAGLYSHKKSHAGKKPFSCTECGKCFSKAASLTYHKKIH 537          

HSP 25 Score: 57.7658 bits (138), Expect = 2.483e-7
Identity = 41/142 (28.87%), Postives = 60/142 (42.25%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C +C + F    +L  H +IH    T  +   C  C + F+N      H + +   T  K + CT C K       +  H + H+ E    C  C K F+  +    H R HTGEKP+ C  CG  F  +Y    H + H
Sbjct: 1245 FTCTECGKCFRDHTSLKIHTRIH----TGEKPFTCTECGKCFRNSSGLKFHTRIH---TGEKPFTCTECGKCYRDRTGLKFHTRSHTGEKPFTCTECGKCFRNSTSLKIHTRIHTGEKPFACNECGKYFMYRYQLTAHSQLH 1379          

HSP 26 Score: 55.8398 bits (133), Expect = 1.067e-6
Identity = 45/162 (27.78%), Postives = 66/162 (40.74%), Query Frame = 1
Query: 5032 NSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            NS  L   + + T +K    + C +C + F     L  H +IH    T  +   C  C + F++      H +  H   + K + CT C K       +  H +IH+ E    C  C K F+  +    H R HTGEKP+ C  CG  F        H + H
Sbjct: 1142 NSTDLKFHTRSHTGEKP---FTCTECGKCFRNSSGLKFHTRIH----TGEKPFTCIECGKCFRDCTSLKIHTR-IHTGEKVKPFSCTECGKCFCNSTGLKFHTRIHTGEKPFTCTECGKCFRDHTSLKIHTRIHTGEKPFTCTECGKCFRNSSGLKFHTRIH 1295          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: synrg (synergin, gamma [Source:Xenbase;Acc:XB-GENE-993541])

HSP 1 Score: 145.976 bits (367), Expect = 1.224e-34
Identity = 166/660 (25.15%), Postives = 267/660 (40.45%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYV-KHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEY----------------------INAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H +I+   +  SC  CG+EF   ++++ H+  H G   F C +    F+D  +  SH      E+   C    +   +++   L++     + P  C +C   F +   L  H  I        C   G  F+  T   S  K   GE      F C  CG  +S    L  H   H       C  C       D  S H    +H  E        K   C  C   +  + + + HQ    G    P    E  +  + R +  ++    + TG K FSC  C  E   +GR  + +HL +    T E    C  C   F     L  HL+   I +GE                       I+ G +  FSC +C      +  +     +H    P  + C  C +  + +     H + H   +  F+C EC   F + ++L  HL+   G K     C+ C K+FS+   +  H L+ H G     PFSC  C ++F  ++ LQ+HQ++H G     C  C K      + + H+  H   + F CTEC   F  + ++ RH+++ H   +P  + C  CG+  ++ S    H  IH   + + C  CGK+F++ +  + H +IH GEK + C  C ++F++KS+L+ H+  H
Sbjct:  221 HLRIHTGEKPFSCTECGKEFSQESHLHRHQKIHTGEKPFSCTECGKEFSDRSNLHSHLKIHTGEKPFSCTECGKEFSDRSNLHLHLKIHTGEKPFHCTECGKEFSRQSHLDRHQKIHTGEKPFHCTECGKEFSDWTSHHSHLKIHTGEKP----FFCTECGKEFSDRSSLHRHQKIHTGEKPFHCTECGKEFS--DRSSLHRHQKIHTGE--------KPFSCTECGKEFSQESHLHKHQKIHTGEK--PFSCTECRKEFFDRYS--LHSHLRIHTGEKPFSCTECGKEF--SGRSNLHRHLKIH---TGEKPFSCTECGKEFSGRSNLHRHLK---IHTGEKPFHCTECGKEFSDWTSHHSHLKIHTG-EKPFSCTECGKEFSQKSSLHSHQKIHTGEKP--FSCTECGKEFSQKSSLHSHQKNHT-GEKPFSCIECGKEFFDRSSLHSHLKIHTGEK--PFSCTECGKEFSDRSNLNSH-LKIHTG---EKPFSCTECGKEFSRKSHLQSHQKIHTGEKSFSCTECGKKLSRKSSLQSHQKIHTGEKSFSCTECGKEFSDRSSLHRHLKI-HTGEKP--FSCTECGQEFSRKSNLHSHQKIHTGEKPFSCTECGKKFSRKSSLHSHQKIHTGEKSFSCTECGKKFSRKSHLHRHLQIH 841          

HSP 2 Score: 137.502 bits (345), Expect = 6.130e-32
Identity = 162/645 (25.12%), Postives = 246/645 (38.14%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKC-------------HKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLD--SKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H +I+   +  SC  CG+EF   ++++ H   H G   F C             H+HQ + T  K +         C    +   +++    ++     + P  C +C   F     L LHL I        C   G  F+ ++ LD   K   GE      F C  CG  +S      SH+  H       C  C       D  S H    +H  E        K   C  C   +  + + + HQ    G    P    E  +   +     +++   + TG K FSC  C  E          HL +    T E    C  C   F     L  HL+   I +GE         FSC +C      R  +     +H    P  + C  C +  +D      HL+ H   +  F+C EC   F  +++L  H +   G K     C+ C K+FS    +  H  + H G     PFSC  C ++F   + L +H ++H G     C  C K          H   H   + F CTEC   F  K  ++ H ++   +   + + C  CGK +++ S    H  IH   + + C  CGK F+  +  + H++IH GEKP+ C  C + F++KSNL+ H   H
Sbjct:  193 HLRIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQESHLHRHQKIHTGEKPF--------SCTECGKEFSDRSNLHSHLKIHTGEKPFSCTECGKEFSDRSNLHLHLKIHTGEKPFHCTECGKEFSRQSHLDRHQKIHTGEKP----FHCTECGKEFSDWTSHHSHLKIHTGEKPFFCTECGKEFS--DRSSLHRHQKIHTGE--------KPFHCTECGKEFSDRSSLHRHQKIHTGEK--PFSCTECGKEFSQE--SHLHKHQKIHTGEKPFSCTECRKEF-FDRYSLHSHLRIH---TGEKPFSCTECGKEFSGRSNLHRHLK---IHTGE-------KPFSCTECGKEFSGRSNLHRHLKIHTGEKP--FHCTECGKEFSDWTSHHSHLKIHT-GEKPFSCTECGKEFSQKSSLHSHQKIHTGEK--PFSCTECGKEFSQKSSLHSH-QKNHTG---EKPFSCIECGKEFFDRSSLHSHLKIHTGEKPFSCTECGKEFSDRSNLNSHLKIHTGEKPFSCTECGKEFSRKSHLQSHQKI---HTGEKSFSCTECGKKLSRKSSLQSHQKIHTGEKSFSCTECGKEFSDRSSLHRHLKIHTGEKPFSCTECGQEFSRKSNLHSHQKIH 785          

HSP 3 Score: 134.035 bits (336), Expect = 8.000e-31
Identity = 159/631 (25.20%), Postives = 229/631 (36.29%), Query Frame = 1
Query: 1981 LFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEE---NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
             FD      H KI+   +  SC  CG+EF   + ++ H+  H G   F C +    F+   S  SH                     ++       C +C K    F Q   L  HL I  G       P               F C  CG  +S+   L  H   H      SC  C         +  HL+  +H  E        K   C  C   +  + N + H     G    P    E  +     R   ++    + TG K F C  C  E      D+  H       T E    C  C   F     L  H +   I +GE         F C +C      R  +     +H    P  + C  C +  +       HL KH++    +  F+C EC+  F +  +L  HL    G K     C+ C K+FS    +  H L+ H G     PFSC  C ++F   + L  H ++H G     C  C K      ++  H   H   + F CTEC   F  K ++  H ++ H   +P  + C  CGK  +Q S    H   H   + + C  CGK F   +  + H++IH GEKP+ C  C + F+ +SNLN H+  H
Sbjct:  128 FFDRSNLNSHLKIHTGEKPFSCTECGKEFAYKSRLHSHQKIHTGEKPFSCTECGKEFSQKSSLHSH-------------------LRIHTGEKPFSCTECGK---EFSQKSSLHSHLRIHTG-----EKP---------------FSCTECGKEFSQESHLHRHQKIHTGEKPFSCTECGKEFSDRSNLHSHLK--IHTGE--------KPFSCTECGKEFSDRSNLHLHLKIHTGEK--PFHCTECGKEF--SRQSHLDRHQKIHTGEKPFHCTECGKEFS----DWTSHHSHLKIHTGEKPFFCTECGKEFSDRSSLHRHQK---IHTGE-------KPFHCTECGKEFSDRSSLHRHQKIHTGEKP--FSCTECGKEFSQES----HLHKHQKIHTGEKPFSCTECRKEFFDRYSLHSHLRIHTGEK--PFSCTECGKEFSGRSNLHRH-LKIHTG---EKPFSCTECGKEFSGRSNLHRHLKIHTGEKPFHCTECGKEFSDWTSHHSHLKIHTGEKPFSCTECGKEFSQKSSLHSHQKI-HTGEKP--FSCTECGKEFSQKSSLHSHQKNHTGEKPFSCIECGKEFFDRSSLHSHLKIHTGEKPFSCTECGKEFSDRSNLNSHLKIH 673          

HSP 4 Score: 106.686 bits (265), Expect = 1.881e-22
Identity = 72/230 (31.30%), Postives = 115/230 (50.00%), Query Frame = 1
Query: 3166 FTCDECQTYFKNEAALKLH--LETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            FTC EC   F + ++L  H  ++T+    +     + C K+F +   +  H L+ H G     PFSC  C ++F +++ L +HQ++H G     C  C K      +   H   H   + F CTEC   F  K ++  H+R+ H   +P  + C  CGK  +Q S    H  IH   + + C  CGK F+  +  + H++IH GEKP+ C  C + F+ +SNL++H+  H
Sbjct:   91 FTCTECGKEFSDRSSLHSHHRIQTW----EKPFSYTECGKEFFDRSNLNSH-LKIHTG---EKPFSCTECGKEFAYKSRLHSHQKIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQKSSLHSHLRI-HTGEKP--FSCTECGKEFSQESHLHRHQKIHTGEKPFSCTECGKEFSDRSNLHSHLKIHTGEKPFSCTECGKEFSDRSNLHLHLKIH 309          

HSP 5 Score: 92.8189 bits (229), Expect = 3.641e-18
Identity = 130/562 (23.13%), Postives = 202/562 (35.94%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK 3630
            HQKI+   +  SC  CG+EF   ++++ H+  H G   F C + +  F D  S  SH                     ++       C +C K    F     L  HL I        C   G  F+ R+ L    K   GE      F C  CG  +S      SH+  H      SC  C         +  H +  +H  E        K   C  C   +  K + + HQ N  G    P    E  +  + R +  ++    + TG K FSC  C  E      +   HL +    T E    C  C   F          R++H+QS + I+ G +S                               + C  C ++++ +   + H + H   + +F+C EC   F + ++L  HL+   G K     C+ C ++FS    +    ++H  E+        PFSC  C +KF  ++ L +HQ++H G                           + F CTEC   F  K  + RH+++ H   +P  + C  CGK
Sbjct:  417 HQKIHTGEKPFSCTECGKEFSQESHLHKHQKIHTGEKPFSCTECRKEFFDRYSLHSH-------------------LRIHTGEKPFSCTECGK---EFSGRSNLHRHLKIHTGEKPFSCTECGKEFSGRSNLHRHLKIHTGEKP----FHCTECGKEFSDWTSHHSHLKIHTGEKPFSCTECGKEFSQKSSLHSHQK--IHTGE--------KPFSCTECGKEFSQKSSLHSHQKNHTGEK--PFSCIECGKEFFDRSS--LHSHLKIHTGEKPFSCTECGKEFSDRS-NLNSHLKIH---TGEKPFSCTECGKEFS---------RKSHLQSHQKIHTGEKS-------------------------------FSCTECGKKLSRKSSLQSHQKIHT-GEKSFSCTECGKEFSDRSSLHRHLKIHTGEK--PFSCTECGQEFSRKSNLHSHQKIHTGEK--------PFSCTECGKKFSRKSSLHSHQKIHTGE--------------------------KSFSCTECGKKFSRKSHLHRHLQI-HTGEKP--FSCTECGK 854          

HSP 6 Score: 91.2781 bits (225), Expect = 1.219e-17
Identity = 61/182 (33.52%), Postives = 87/182 (47.80%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD----DFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            ++C +C + F    NLNSH+KIH    T  +   C  C + F  K     H K +   T  K + CT C K ++    +  H KIH+ E S +C  C K+F  +S    HL+ HTGEKP+ C  CG EFS+K N + H K H   +     + G     K      +K+   EK  +  +CG
Sbjct:  651 FSCTECGKEFSDRSNLNSHLKIH----TGEKPFSCTECGKEFSRKSHLQSHQKIH---TGEKSFSCTECGKKLSRKSSLQSHQKIHTGEKSFSCTECGKEFSDRSSLHRHLKIHTGEKPFSCTECGQEFSRKSNLHSHQKIHTGEKPFSCTECGKKFSRKSSLHSHQKIHTGEKSFSCTECG 825          

HSP 7 Score: 80.4925 bits (197), Expect = 2.058e-14
Identity = 48/142 (33.80%), Postives = 74/142 (52.11%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            ++C +C + F     L+SH KIH    T  +   C  C + F  K     H++ +   T  K + CT C K  +    ++ H++IH+ E   +C  C K+F ++S+   H + HTGEKP+ C  CG EFS + N + HLK H
Sbjct:  147 FSCTECGKEFAYKSRLHSHQKIH----TGEKPFSCTECGKEFSQKSSLHSHLRIH---TGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQESHLHRHQKIHTGEKPFSCTECGKEFSDRSNLHSHLKIH 281          

HSP 8 Score: 80.4925 bits (197), Expect = 2.260e-14
Identity = 62/203 (30.54%), Postives = 94/203 (46.31%), Query Frame = 1
Query: 5050 KESNNRTNKKQKLE-------YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD----DFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            KE + R+N  + L+       ++C +C + F    + +SH+KIH    T  +   C  C + F  K     H K +   T  K + CT C K  +    ++ H K H+ E   +C  C K+F  +S    HL+ HTGEKP+ C  CG EFS + N N HLK H   +     + G     K   +  +K+   EK  +  +CG
Sbjct:  518 KEFSGRSNLHRHLKIHTGEKPFHCTECGKEFSDWTSHHSHLKIH----TGEKPFSCTECGKEFSQKSSLHSHQKIH---TGEKPFSCTECGKEFSQKSSLHSHQKNHTGEKPFSCIECGKEFFDRSSLHSHLKIHTGEKPFSCTECGKEFSDRSNLNSHLKIHTGEKPFSCTECGKEFSRKSHLQSHQKIHTGEKSFSCTECG 713          

HSP 9 Score: 79.337 bits (194), Expect = 4.896e-14
Identity = 53/158 (33.54%), Postives = 79/158 (50.00%), Query Frame = 1
Query: 5044 LHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            LH+     T +K    ++C +C + F    +L+ H KIH    T  +   C  C + F  +    KH K +   T  K + CT C+K       ++ H++IH+ E   +C  C K+F  +S    HL+ HTGEKP+ C  CG EFS + N + HLK H
Sbjct:  386 LHRHQKIHTGEKP---FHCTECGKEFSDRSSLHRHQKIH----TGEKPFSCTECGKEFSQESHLHKHQKIH---TGEKPFSCTECRKEFFDRYSLHSHLRIHTGEKPFSCTECGKEFSGRSNLHRHLKIHTGEKPFSCTECGKEFSGRSNLHRHLKIH 533          

HSP 10 Score: 78.9518 bits (193), Expect = 6.591e-14
Identity = 56/184 (30.43%), Postives = 88/184 (47.83%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHN--KDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD----DFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            + C +C + F    +L+SH +I    K  +  E      C + F ++     H+K +   T  K + CT C K  A+   ++ H KIH+ E   +C  C K+F +KS    HLR HTGEKP+ C  CG EFS+K + + HL+ H   +     + G     +      +K+   EK  +  +CG
Sbjct:   91 FTCTECGKEFSDRSSLHSHHRIQTWEKPFSYTE------CGKEFFDRSNLNSHLKIH---TGEKPFSCTECGKEFAYKSRLHSHQKIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQESHLHRHQKIHTGEKPFSCTECG 265          

HSP 11 Score: 78.9518 bits (193), Expect = 6.818e-14
Identity = 58/198 (29.29%), Postives = 93/198 (46.97%), Query Frame = 1
Query: 5044 LHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD----DFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            LH+     T +K    ++C +C + F    +L+ H KIH    T  +   C  C + F ++     H++ +   T  K + CT C K  +    ++ H+KIH+ E   +C  C K+F  +S    HL+ HTGEKP+ C  CG EFS   +++ HLK H   +     + G     K      +K+   EK  +  +CG
Sbjct:  414 LHRHQKIHTGEKP---FSCTECGKEFSQESHLHKHQKIH----TGEKPFSCTECRKEFFDRYSLHSHLRIH---TGEKPFSCTECGKEFSGRSNLHRHLKIHTGEKPFSCTECGKEFSGRSNLHRHLKIHTGEKPFHCTECGKEFSDWTSHHSHLKIHTGEKPFSCTECGKEFSQKSSLHSHQKIHTGEKPFSCTECG 601          

HSP 12 Score: 77.411 bits (189), Expect = 2.277e-13
Identity = 54/182 (29.67%), Postives = 87/182 (47.80%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDF----GNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            ++C +C + F    +L+ H KIH    T  +   C  C + F ++     H+K +   T  K + CT C K  +    ++ H+KIH+ E    C  C K+F ++S+   H + HTGEKP+ C  CG EFS   +++ HLK H   +  F    G     +      +K+   EK  +  +CG
Sbjct:  231 FSCTECGKEFSQESHLHRHQKIH----TGEKPFSCTECGKEFSDRSNLHSHLKIH---TGEKPFSCTECGKEFSDRSNLHLHLKIHTGEKPFHCTECGKEFSRQSHLDRHQKIHTGEKPFHCTECGKEFSDWTSHHSHLKIHTGEKPFFCTECGKEFSDRSSLHRHQKIHTGEKPFHCTECG 405          

HSP 13 Score: 74.3294 bits (181), Expect = 1.619e-12
Identity = 46/126 (36.51%), Postives = 65/126 (51.59%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICG 5457
            ++C +C + F    +L+ H+KIH    T  +   C  C Q F  K     H K +   T  K + CT C K  +    ++ H KIH+ E S +C  C KKF +KS+   HL+ HTGEKP+ C  CG
Sbjct:  735 FSCTECGKEFSDRSSLHRHLKIH----TGEKPFSCTECGQEFSRKSNLHSHQKIH---TGEKPFSCTECGKKFSRKSSLHSHQKIHTGEKSFSCTECGKKFSRKSHLHRHLQIHTGEKPFSCTECG 853          

HSP 14 Score: 72.7886 bits (177), Expect = 5.006e-12
Identity = 46/142 (32.39%), Postives = 73/142 (51.41%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            ++C +C +      +L SH KIH    T  +   C  C + F ++    +H+K +   T  K + CT C +  +    ++ H KIH+ E   +C  C KKF +KS    H + HTGEK + C  CG +FS+K + + HL+ H
Sbjct:  707 FSCTECGKKLSRKSSLQSHQKIH----TGEKSFSCTECGKEFSDRSSLHRHLKIH---TGEKPFSCTECGQEFSRKSNLHSHQKIHTGEKPFSCTECGKKFSRKSSLHSHQKIHTGEKSFSCTECGKKFSRKSHLHRHLQIH 841          

HSP 15 Score: 70.8626 bits (172), Expect = 1.980e-11
Identity = 52/163 (31.90%), Postives = 79/163 (48.47%), Query Frame = 1
Query: 5050 KESNNRTNKKQKLE-------YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            KE ++R+N    L+       ++C +C + F    NL+ H+KIH    T  +   C  C + F  +    +H K +   T  K + CT C K  +     + H+KIH+ E    C  C K+F  +S    H + HTGEKP+ C  CG EFS + + + H K H
Sbjct:  266 KEFSDRSNLHSHLKIHTGEKPFSCTECGKEFSDRSNLHLHLKIH----TGEKPFHCTECGKEFSRQSHLDRHQKIH---TGEKPFHCTECGKEFSDWTSHHSHLKIHTGEKPFFCTECGKEFSDRSSLHRHQKIHTGEKPFHCTECGKEFSDRSSLHRHQKIH 421          

HSP 16 Score: 67.0106 bits (162), Expect = 3.119e-10
Identity = 44/165 (26.67%), Postives = 77/165 (46.67%), Query Frame = 1
Query: 3349 PFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            PF+C  C ++F   + L +H  +                 + +E         + F  TEC   F  +  +  H+++ H   +P  + C  CGK     +++  H  IH   + + C  CGK F++ +  + H+RIH GEKP+ C  C + F++KS+L+ H+  H
Sbjct:   90 PFTCTECGKEFSDRSSLHSHHRI-----------------QTWE---------KPFSYTECGKEFFDRSNLNSHLKI-HTGEKP--FSCTECGKEFAYKSRLHSHQKIHTGEKPFSCTECGKEFSQKSSLHSHLRIHTGEKPFSCTECGKEFSQKSSLHSHLRIH 225          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: ENSXETT00000036920.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:678334:738063:-1 gene:ENSXETG00000015582.1 transcript:ENSXETT00000036920.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 1.110e-33
Identity = 161/649 (24.81%), Postives = 249/649 (38.37%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVF---TDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSD------CPQCDKCYDYFPQADI-LRLHLD----ICDGV--SFNARTPL---------DSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKR--MNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDT---LCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVH--GGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H +++   R  SC  CG+ FK  AN+  H   H G   F C +    F   +D+  + S H+           +       LN+   +        C +C KC+ +     +  R+H       C G   SF  R+ L         +     GE L    F C  CG ++ +L     H+  H       C  C        +++ HLR H             K+  C  C   +      +  + N+H  VH   K     E   KR T+R  + E SY  TG K F+C  C       G+ + +H  +     + +      C  C   F   ++L+ H   +H+ +G       +  +SC +C     ++G ++     H    P  Y C  C +R         H+ +H   +  +TC EC   F N   L  H     G K     CS C K FS  Q++ +H         E  PF+C  C + F   ++L  H+  H  G    C  C K+   +    +H  +H   R F CTEC  +F     +  H R  H   +P  Y C  CGK     T ++ H ++H   + + C  CG+ F++      H R+H GEKP+ C  C + F ++  L  H   H
Sbjct:  537 HNRVHTGERPYSCSECGKHFKEHANLKVHWRIHTGEKPFTCSQCGKGFVRRSDLDRHLSLHKAEKPYSCSQCGKHFACVSDLNVHHRVHMDQRPYCCSECGKCFKHHSNLIVHQRIHTGEKPFSCSGCGKSFTDRSRLTVHHRIHRGEKPVHTGEKL----FTCTECGKSFPRLARYNRHLRTHTGEKPFPCTECGKSFTCRRQLNTHLRCHT----------GEKLFTCTECGKSF-----IHVSELNKHFRVHTGEKPFACTE-CGKRFTRRYQLTEHSYSHTGEKPFTCTEC-------GKSFTRHYQLTAHYLLHIGEKPFACAECGKGFSRRDQLNAH---SHLHTG-------KKPYSCSECGKSFTYQGDLSSHLRTHTGEKP--YSCSECGKRFTRCSERNAHIRRHT-GEKPYTCAECGKSFGNRTGLNHHKIIHTGEK--PFSCSECGKGFSRRQDLTIHFRIH----TEEKPFTCTECGKSFTSSSQLYEHRRGHIGGKSFTCTECGKIFTRISHLNIHLRRHTGERPFTCTECGKSFTCIAQLNLH-RRHHTGEKP--YTCTECGKCFCTRTGLNHHKIVHSGEKPFTCTECGRCFSRRCKLKAHSRLHTGEKPFACAECGKCFARQDQLTAHSRLH 1136          

HSP 2 Score: 130.568 bits (327), Expect = 1.376e-29
Identity = 134/511 (26.22%), Postives = 198/511 (38.75%), Query Frame = 1
Query: 2416 FICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKN--------ENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLR-------------ENHIQSGEYINAGI-----QSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHE 3834
            F C  CG  Y++   L  H   H      SC+ C        +  +H R H  +         EN +G G      C  C   +        H+ +  G    P    E  +   +R +  +   +   TG K F+C  C      +  D+ +HL    G   E    C  C   F     L+ HLR               H  S   +N  +     +  +SC +C   F H   +  H   +H    P  + C  C +   DR    +H   H   +  + C EC   F N A L+LH    H   +    CS+C K F+     R H+ E +       P+SC +C   F + + L +H  +H G     C  C K C S     +HR  H     F C EC+  F +   +  H R  H    P  + C  CGK     +Q+++H  +H   R Y C  CGK F + A    H RIH GEKP+ C  C + F ++S+L+ H++ H+
Sbjct:  111 FSCSECGKRYARRTQLNMHFRTHTGEKPFSCSDCGKCFSCSSDFKRHCRIHRREKSCTCSQCIENHTGDGP---FSCCKCGKHFKRHSQLTVHRRSHTGER--PYSCSECGKDFKERSS--LIAHARFHTGEKPFTCSQCEKSFTHSS-DFNRHLRFHKG---EKPFSCSQCEKCFTNRSDLNRHLRYHKGEKPFACSQCGKHFISISDLNVHLRVHTGERPYSCSECGKCFKHPSHLTTHQ-RIHTGEKP--FTCSECGKSFRDRSYLTVHHRTHT-GEKPYLCSECGKCFINRAGLRLHKRRSH-TGEKPFPCSVCGKRFAR----RSHLNEHNRTHTGEKPYSCSVCGRCFSYRSHLNSHSRIHIGEEPFSCTDCGKRCTSDSDLLVHRRSHSGEGSFSCIECEKHFTTHSDLIVH-RRSHTGEGP--FACSECGKRFKRHSQLTVHNRVHTGERPYSCSECGKHFKEHANLKVHWRIHTGEKPFTCSQCGKGFVRRSDLDRHLSLHK 598          

HSP 3 Score: 129.413 bits (324), Expect = 2.929e-29
Identity = 180/712 (25.28%), Postives = 256/712 (35.96%), Query Frame = 1
Query: 1945 ADKIFDLPLQISLFDSIWRL-YHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLH------------LDICDGVSFNARTPLD--SKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSY---MATGMKKFSCKFCN------AEVKV---------------AGRDYVKHLDVKHGLTV---ELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHE------ENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVEL--------------------YPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVT---QISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
             +K F        F SI  L  H +++   R  SC  CG+ FK  +++  H+  H G   F C +    F D      HH                     +       C +C KC   F     LRLH              +C G  F  R+ L+  ++   GE      + C +CG  +S    L SH   H+     SC  C  R  S  ++  H R H       SG G      C  C   + T  +   H+ +  G    P    E       +R KR ++L+    + TG + +SC  C       A +KV                G+ +V+  D+   L++   E    C  C   F     L+ H R  H+    Y  +       C KC  F H   ++ H   +H    P  + C  C +   DR    +H   H         +  FTC EC   F   A    HL T  G K     C+ C K F+  +++    R H  E+   C E                      PF+C  C ++F    +L  H   H G     C  C K          H + H   + F C EC   F  +  +  H    HL+   + Y C  CGK  T    +S H+  H   + Y C  CGKRFT+ +  N H+R H GEKPY C  C + F  ++ LN H   H
Sbjct:  290 GEKPFACSQCGKHFISISDLNVHLRVHTGERPYSCSECGKCFKHPSHLTTHQRIHTGEKPFTCSECGKSFRDRSYLTVHHR-------------------THTGEKPYLCSECGKC---FINRAGLRLHKRRSHTGEKPFPCSVC-GKRFARRSHLNEHNRTHTGEKP----YSCSVCGRCFSYRSHLNSHSRIHIGEEPFSCTDCGKRCTSDSDLLVHRRSH-------SGEGS---FSCIECEKHFTTHSDLIVHRRSHTGE--GPFACSECG-----KRFKRHSQLTVHNRVHTGERPYSCSECGKHFKEHANLKVHWRIHTGEKPFTCSQCGKGFVRRSDLDRHLSLHKAEKPYSCSQCGKHFACVSDLNVHHRV-HMDQRPYCCS------ECGKC--FKHHSNLIVHQ-RIHTGEKP--FSCSGCGKSFTDRSRLTVHHRIHRGEKPVHTGEKLFTCTECGKSFPRLARYNRHLRTHTGEK--PFPCTECGKSFTCRRQLNTHLRCHTGEKLFTCTECGKSFIHVSELNKHFRVHTGEKPFACTECGKRFTRRYQLTEHSYSHTGEKPFTCTECGKSFTRHYQLTAHYLLHIGEKPFACAECGKGFSRRDQLNAH---SHLHTGKKPYSCSECGKSFTYQGDLSSHLRTHTGEKPYSCSECGKRFTRCSERNAHIRRHTGEKPYTCAECGKSFGNRTGLNHHKIIH 940          

HSP 4 Score: 126.716 bits (317), Expect = 2.227e-28
Identity = 123/422 (29.15%), Postives = 171/422 (40.52%), Query Frame = 1
Query: 2593 KILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMM--QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNAR------YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            K  +C +C   +  + +   HQ +  G    P    E  +  Y RRT+ +N      TG K FSC  C      +  D+ +H  +      E    C  C               ENH   G          FSC KC   F     +  H  S H    P  Y C  C +   +R     H   H   +  FTC +C+  F + +    HL    G K     CS CEK F+N  ++  H L  H+G     PF+C  C + F+  ++L  H  VH G     C  C K  K       H+  H   + F C+EC  +FR +  +  H R  H   +P  Y C  CGK     +  + +HK         + C  CGKRF + ++ NEH R H GEKPY C +C R F+ +S+LN H   H
Sbjct:   81 KPFVCSVCEKCFMWQSDLILHQRSHTGE--KPFSCSECGK-RYARRTQ-LNMHFRTHTGEKPFSCSDCGKCFSCSS-DFKRHCRIH---RREKSCTCSQCI--------------ENHTGDGP---------FSCCKCGKHFKRHSQLTVHRRS-HTGERP--YSCSECGKDFKERSSLIAHARFHT-GEKPFTCSQCEKSFTHSSDFNRHLRFHKGEK--PFSCSQCEKCFTNRSDLNRH-LRYHKG---EKPFACSQCGKHFISISDLNVHLRVHTGERPYSCSECGKCFKHPSHLTTHQRIHTGEKPFTCSECGKSFRDRSYLTVHHRT-HTGEKP--YLCSECGKCFINRAG-LRLHKRRSHTGEKPFPCSVCGKRFARRSHLNEHNRTHTGEKPYSCSVCGRCFSYRSHLNSHSRIH 457          

HSP 5 Score: 120.553 bits (301), Expect = 1.603e-26
Identity = 155/631 (24.56%), Postives = 227/631 (35.97%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTS---VH--ADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVT---QISMHMLIHKNAR--------YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H++ +   R  SC  CG++FK  +++  H   H G   F C + +  FT    +  H                      +       C QC+KC   F     L  HL                +Y  GE      F C  CG ++  +  L  H+  H      SC+ C         ++ H R  +H  E        K   C  C   +  +     H     G    P    E  +    R   R+++     TG K F C  C    + A R ++   +  H  T E    C +C   F     L+ H R   I  GE         FSC  C       G    S S   VH  + S    + C  C +         +H   H   +  F C EC   FK  + L +H     G  +    CS C K F     ++VH    H G     PF+C  C + F+  ++L  H  +H       C  C K    +    +H   H   R + C+EC   F+    +  H R+ H   +P  + C  CGK  T   ++++H  IH+  +        + C  CGK F + A YN H+R H GEKP+ C  C + F  +  LN H+  H
Sbjct:  200 HRRSHTGERPYSCSECGKDFKERSSLIAHARFHTGEKPFTCSQCEKSFTHSSDFNRH-------------------LRFHKGEKPFSCSQCEKC---FTNRSDLNRHL----------------RYHKGEKP----FACSQCGKHFISISDLNVHLRVHTGERPYSCSECGKCFKHPSHLTTHQR--IHTGE--------KPFTCSECGKSFRDRSYLTVHHRTHTGE--KPYLCSECGKCFINRAGLRLHKRR-SHTGEKPFPCSVCGK--RFARRSHLNEHNRTH--TGEKPYSCSVCGRCFSYRSHLNSHSR---IHIGE-------EPFSCTDC-------GKRCTSDSDLLVHRRSHSGEGSFSCIECEKHFTTHSDLIVHRRSH-TGEGPFACSECGKRFKRHSQLTVHNRVHTG--ERPYSCSECGKHFKEHANLKVH-WRIHTG---EKPFTCSQCGKGFVRRSDLDRHLSLHKAEKPYSCSQCGKHFACVSDLNVHHRVHMDQRPYCCSECGKCFKHHSNLIVHQRI-HTGEKP--FSCSGCGKSFTDRSRLTVHHRIHRGEKPVHTGEKLFTCTECGKSFPRLARYNRHLRTHTGEKPFPCTECGKSFTCRRQLNTHLRCH 744          

HSP 6 Score: 118.242 bits (295), Expect = 9.194e-26
Identity = 149/624 (23.88%), Postives = 234/624 (37.50%), Query Frame = 1
Query: 2041 SCVFCGREFKASANVYDHEIRHVGLIRF---KCHKHQMVFTDMKSYKSHH--EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMA-----TGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            SC  CG+   + +++  H   H G   F   +C KH    +D+  ++  H  E    C    +     +Q  ++      + P  C +C  +F +   L++H  I                  GE      F C  CG  + +   L  H++ H      SC+ C      + +++ H R H+           ++   C  C   +    N   HQ    G    P       +    R    ++   +       TG K F+C  C        R Y +HL      T E    C  C   F    +L+ HLR     +GE        +F+C +C   F H   +  H   VH    P  + C  C +R   R     H   H   +  FTC EC   F     L  H    H + +    C+ C K FS   ++  H    H G     P+SC  C + F ++ +L +H   H G     C  C K          H  +H   + + C EC  +F ++  +  H ++ H   +P  + C  CGK  ++   +++H  IH   + + C  CGK FT S+   EH R H G K + C  C + F + S+LN+H+  H   R
Sbjct:  464 SCTDCGKRCTSDSDLLVHRRSHSGEGSFSCIECEKHFTTHSDLIVHRRSHTGEGPFACSECGKRFKRHSQLTVHNRVHTGERPYSCSECGKHFKEHANLKVHWRI----------------HTGEKP----FTCSQCGKGFVRRSDLDRHLSLHKAEKPYSCSQCGKHFACVSDLNVHHRVHM----------DQRPYCCSECGKCFKHHSNLIVHQRIHTGE--KPFSCSGCGKSFTDRSRLTVHHRIHRGEKPVHTGEKLFTCTECGKSFPRLAR-YNRHLRTH---TGEKPFPCTECGKSFTCRRQLNTHLR---CHTGE-------KLFTCTECGKSFIHVSELNKH-FRVHTGEKP--FACTECGKRFTRRYQLTEHSYSHT-GEKPFTCTECGKSFTRHYQLTAHY-LLH-IGEKPFACAECGKGFSRRDQLNAHS-HLHTG---KKPYSCSECGKSFTYQGDLSSHLRTHTGEKPYSCSECGKRFTRCSERNAHIRRHTGEKPYTCAECGKSFGNRTGLNHH-KIIHTGEKP--FSCSECGKGFSRRQDLTIHFRIHTEEKPFTCTECGKSFTSSSQLYEHRRGHIGGKSFTCTECGKIFTRISHLNIHLRRHTGER 1028          

HSP 7 Score: 97.4413 bits (241), Expect = 2.058e-19
Identity = 75/248 (30.24%), Postives = 108/248 (43.55%), Query Frame = 1
Query: 3154 NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRI---------------FQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHE 3834
            N+ T+ C EC   F+ +  L  H +T  GVK     CS+CEK F    ++ +H    H G     PFSC  C +++    +L  H   H G     C  C K       ++ H   H R +                F C +C   F+    +  H R  H    P  Y C  CGK   + S    H   H   + + C  C K FT S+ +N H+R HKGEKP+ C  C++ F  +S+LN H+ +H+
Sbjct:   51 NKETYNCSECHKLFRTKGGLLKHEKTHTGVK--PFVCSVCEKCFMWQSDLILH-QRSHTG---EKPFSCSECGKRYARRTQLNMHFRTHTGEKPFSCSDCGKCFSCSSDFKRHCRIHRREKSCTCSQCIENHTGDGPFSCCKCGKHFKRHSQLTVH-RRSHTGERP--YSCSECGKDFKERSSLIAHARFHTGEKPFTCSQCEKSFTHSSDFNRHLRFHKGEKPFSCSQCEKCFTNRSDLNRHLRYHK 289          

HSP 8 Score: 89.3521 bits (220), Expect = 6.118e-17
Identity = 137/585 (23.42%), Postives = 208/585 (35.56%), Query Frame = 1
Query: 2002 LYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVH---PPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVT---QISMHMLIHKNAR 3678
            + HQ+I+   +  SC  CG+ F   + +  H   H G      H  + +FT                                         C +C   FP+      HL          C   G SF  R  L++  +   GE L    F C  CG ++  +  L  H   H      +C  C  R     ++++H   H             K   C  C    G     +Y Q   H ++H    P    E  +   +R   ++N  S++ TG K +SC  C       G D   HL      T E    C  C   F      + H+R +   +GE         ++C +C   FG+  G+  H   +H    P  + C  C +  + R+   IH   H E +  FTC EC   F + + L  H     G K     C+ C K F+    + +H L  H G     PF+C  C + F    +L  H+  H G     C  C K   +      H++ H   + F CTEC   F  +  ++ H R+ H   +P  + C  CGK      Q++ H  +H   +
Sbjct:  647 IVHQRIHTGEKPFSCSGCGKSFTDRSRLTVHHRIHRGEKPV--HTGEKLFT-----------------------------------------CTECGKSFPRLARYNRHLRTHTGEKPFPCTECGKSFTCRRQLNTHLRCHTGEKL----FTCTECGKSFIHVSELNKHFRVHTGEKPFACTECGKRFTRRYQLTEHSYSHT----------GEKPFTCTEC----GKSFTRHY-QLTAHYLLHIGEKPFACAECGKGFSRR--DQLNAHSHLHTGKKPYSCSECGKSFTYQG-DLSSHLRTH---TGEKPYSCSECGKRFTRCSERNAHIRRH---TGE-------KPYTCAECGKSFGNRTGLNHHKI-IHTGEKP--FSCSECGKGFSRRQDLTIHFRIHTEEK-PFTCTECGKSFTSSSQLYEHRRGHIGGK--SFTCTECGKIFTRISHLNIH-LRRHTG---ERPFTCTECGKSFTCIAQLNLHRRHHTGEKPYTCTECGKCFCTRTGLNHHKIVHSGEKPFTCTECGRCFSRRCKLKAHSRL-HTGEKP--FACAECGKCFARQDQLTAHSRLHTGEK 1140          

HSP 9 Score: 76.6406 bits (187), Expect = 3.674e-13
Identity = 47/145 (32.41%), Postives = 74/145 (51.03%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE-HMKIH------SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y+C +C + F    +L +H +IH    T  +   C  C + F+++     H +++   T  K Y C+ C K   FIN   +++H       E    C +C K+F ++S+  EH R HTGEKPY C +CG  FS + + N H + H
Sbjct:  322 YSCSECGKCFKHPSHLTTHQRIH----TGEKPFTCSECGKSFRDRSYLTVHHRTH---TGEKPYLCSECGKC--FINRAGLRLHKRRSHTGEKPFPCSVCGKRFARRSHLNEHNRTHTGEKPYSCSVCGRCFSYRSHLNSHSRIH 457          

HSP 10 Score: 69.707 bits (169), Expect = 5.512e-11
Identity = 57/245 (23.27%), Postives = 98/245 (40.00%), Query Frame = 1
Query: 4927 EEFSDLDQEWSIEESDMEHSMWNISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIH--------SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR-----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            +E ++L   W I   +   +     +  V+    +  + LHK             Y+C +C + F  + +LN H ++H           C  C + F++      H + +   T  K + C+ C K     + +  H +IH         E    C  C K F + + Y  HLR HTGEKP+ C  CG  F+ +   N HL+ H   +     +   +++ + +  K   +V   EK     +CG
Sbjct:  557 KEHANLKVHWRIHTGEKPFTCSQCGKGFVRRSDLDRHLSLHKAEK---------PYSCSQCGKHFACVSDLNVHHRVHMDQ----RPYCCSECGKCFKHHSNLIVHQRIH---TGEKPFSCSGCGKSFTDRSRLTVHHRIHRGEKPVHTGEKLFTCTECGKSFPRLARYNRHLRTHTGEKPFPCTECGKSFTCRRQLNTHLRCHTGEKLFTCTECGKSFIHVSELNKHF-RVHTGEKPFACTECG 784          

HSP 11 Score: 69.3218 bits (168), Expect = 6.472e-11
Identity = 49/184 (26.63%), Postives = 78/184 (42.39%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIH-SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            ++C KC + F      +S + +H +  T      C  C + F+ +     H + +   T  K + C+ C+K        N H++ H  E   +C  C+K F  +S    HLRYH GEKP+ C  CG  F    + N HL+ H   R     + G   +        +++   EK     +CG S
Sbjct:  182 FSCCKCGKHF----KRHSQLTVHRRSHTGERPYSCSECGKDFKERSSLIAHARFH---TGEKPFTCSQCEKSFTHSSDFNRHLRFHKGEKPFSCSQCEKCFTNRSDLNRHLRYHKGEKPFACSQCGKHFISISDLNVHLRVHTGERPYSCSECGKCFKHPSHLTTHQRIHTGEKPFTCSECGKS 358          

HSP 12 Score: 65.855 bits (159), Expect = 8.729e-10
Identity = 52/203 (25.62%), Postives = 86/203 (42.36%), Query Frame = 1
Query: 4936 SDLDQEWSIEESDMEHSMWNISRDIVKNGITENSIILHKESNNRTNKKQKLE--YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDF 5526
            S+  +++    S + H+ ++           E S   H    NR  +  K E  ++C +C + F    +LN H++ H  +    +   C  C + F +      H++ +   T  + Y C+ C K     + +  H +IH+ E    C  C K F+ +SY   H R HTGEKPY C  CG  F  +     H +R  +    F
Sbjct:  213 SECGKDFKERSSLIAHARFHTGEKPFTCSQCEKSFT-HSSDFNRHLRFHKGEKPFSCSQCEKCFTNRSDLNRHLRYHKGE----KPFACSQCGKHFISISDLNVHLRVH---TGERPYSCSECGKCFKHPSHLTTHQRIHTGEKPFTCSECGKSFRDRSYLTVHHRTHTGEKPYLCSECGKCFINRAGLRLHKRRSHTGEKPF 407          

HSP 13 Score: 65.4698 bits (158), Expect = 9.340e-10
Identity = 53/182 (29.12%), Postives = 75/182 (41.21%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIH-SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            Y C +C + FG    LN H  IH    T  +   C  C + F  +     H + +   TE K + CT C K     + + EH + H    S  C  C K F + S+   HLR HTGE+P+ C  CG  F+     N H + H   +     + G     +      K V + EK     +CG
Sbjct:  918 YTCAECGKSFGNRTGLNHHKIIH----TGEKPFSCSECGKGFSRRQDLTIHFRIH---TEEKPFTCTECGKSFTSSSQLYEHRRGHIGGKSFTCTECGKIFTRISHLNIHLRRHTGERPFTCTECGKSFTCIAQLNLHRRHHTGEKPYTCTECGKCFCTRTGLNHHKIVHSGEKPFTCTECG 1092          

HSP 14 Score: 63.929 bits (154), Expect = 2.896e-9
Identity = 140/616 (22.73%), Postives = 207/616 (33.60%), Query Frame = 1
Query: 1852 TGENTYVSASLFENIPYCKRQEQIDDFLN-EIADKIFDLPLQISLFDSIWRL-YHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADI-LRLHLD----ICD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVH---PPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINA----------GI---------QSIFSCDKCTFFGHFRGVVAHSTSVHADSNP-----C---------LYE------------CPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIR----VHILEEHEGCVEL--------------------YPFSCFMCQEKFLFENELQAHQEVHGGMMQ 3435
            TGE  +  +   +      R+  +D  L+   A+K +        F  +  L  H +++ D R   C  CG+ FK  +N+  H+  H G   F C      FTD      HH             + + +K ++    L  C +C K +    + +  LR H       C   G SF  R  L++  +   GE L    F C  CG ++  +  L  H   H      +C  C  R     ++++H   H             K   C  C    G     +Y Q   H ++H    P    E  +   +R   ++N  S++ TG K +SC  C       G D   HL      T E    C  C   F      + H+R  H     Y  A          G+         +  FSC +C      R  +     +H +  P     C         LYE            C  C +         IHL +H   +  FTC EC   F   A L LH    H   +    C+ C K F     +     VH  E+   C E                      PF+C  C + F  +++L AH  +H G  Q
Sbjct:  570 TGEKPFTCSQCGKGFV---RRSDLDRHLSLHKAEKPYSCSQCGKHFACVSDLNVHHRVHMDQRPYCCSECGKCFKHHSNLIVHQRIHTGEKPFSCSGCGKSFTDRSRLTVHHR------------IHRGEKPVHTGEKLFTCTECGKSFPRLARYNRHLRTHTGEKPFPCTECGKSFTCRRQLNTHLRCHTGEKL----FTCTECGKSFIHVSELNKHFRVHTGEKPFACTECGKRFTRRYQLTEHSYSHT----------GEKPFTCTEC----GKSFTRHY-QLTAHYLLHIGEKPFACAECGKGFSRR--DQLNAHSHLHTGKKPYSCSECGKSFTYQG-DLSSHLRTH---TGEKPYSCSECGKRFTRCSERNAHIRR-HTGEKPYTCAECGKSFGNRTGLNHHKIIHTGEKPFSCSECGKGFSRRQDLTIHFRIHTEEKPFTCTECGKSFTSSSQLYEHRRGHIGGKSFTCTECGKIFTRISHLNIHLRRHT-GERPFTCTECGKSFTCIAQLNLHRR--HHTGEKPYTCTECGKCFCTRTGLNHHKIVHSGEKPFTCTECGRCFSRRCKLKAHSRLHTGEKPFACAECGKCFARQDQLTAHSRLHTGEKQ 1141          

HSP 15 Score: 63.929 bits (154), Expect = 3.125e-9
Identity = 48/175 (27.43%), Postives = 82/175 (46.86%), Query Frame = 1
Query: 5023 ITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHN--KDLTVNEKIPCKHCSQIFQNKILFAKHMKS------YHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            + ++ +ILH+ S+  T +K    ++C +C + +     LN H + H   K  + ++   C  CS  F+      +  KS        N T    + C  C K     + +  H + H+ E   +C  C K FK++S  + H R+HTGEKP+ C  C   F+   ++N HL+ H+ 
Sbjct:   93 MWQSDLILHQRSH--TGEK---PFSCSECGKRYARRTQLNMHFRTHTGEKPFSCSDCGKCFSCSSDFKRHCRIHRREKSCTCSQCIENHTGDGPFSCCKCGKHFKRHSQLTVHRRSHTGERPYSCSECGKDFKERSSLIAHARFHTGEKPFTCSQCEKSFTHSSDFNRHLRFHKG 262          

HSP 16 Score: 63.929 bits (154), Expect = 3.152e-9
Identity = 55/223 (24.66%), Postives = 84/223 (37.67%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF-------------------------------INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR--------DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            R +  +KL + C +C + F  +  LN H ++H    T  +   C  C + F  +    +H  S+   T  K + CT C K                                   +N H  +H+ +   +C  C K F  +     HLR HTGEKPY C  CG  F++    N H++RH   +          FGN   +       K +   EK  +  +CG
Sbjct:  742 RCHTGEKL-FTCTECGKSFIHVSELNKHFRVH----TGEKPFACTECGKRFTRRYQLTEHSYSH---TGEKPFTCTECGKSFTRHYQLTAHYLLHIGEKPFACAECGKGFSRRDQLNAHSHLHTGKKPYSCSECGKSFTYQGDLSSHLRTHTGEKPYSCSECGKRFTRCSERNAHIRRHTGEKPYTCAECGKSFGNRTGLNHH----KIIHTGEKPFSCSECG 952          

HSP 17 Score: 63.5438 bits (153), Expect = 4.095e-9
Identity = 48/157 (30.57%), Postives = 71/157 (45.22%), Query Frame = 1
Query: 5047 HKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            H   +NRT+  +K  Y+C  C   F    +LNSH +IH  +    E   C  C +   +      H +S+   +    + C  C+K     ++   H + H+ E   AC  C K+FK+ S    H R HTGE+PY C  CG  F +  N   H + H
Sbjct:  421 HLNEHNRTHTGEK-PYSCSVCGRCFSYRSHLNSHSRIHIGE----EPFSCTDCGKRCTSDSDLLVHRRSH---SGEGSFSCIECEKHFTTHSDLIVHRRSHTGEGPFACSECGKRFKRHSQLTVHNRVHTGERPYSCSECGKHFKEHANLKVHWRIH 569          

HSP 18 Score: 62.3882 bits (150), Expect = 1.002e-8
Identity = 49/158 (31.01%), Postives = 72/158 (45.57%), Query Frame = 1
Query: 5056 SNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHSEPS-IACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            S+ RT+  +K  Y+C +C + F      N+H++ H    T  +   C  C + F N+     H K  H  T  K + C+ C K  +   +   H +IH+E     C  C K F   S   EH R H G K + C  CG  F++  + N HL+RH   R
Sbjct:  879 SHLRTHTGEK-PYSCSECGKRFTRCSERNAHIRRH----TGEKPYTCAECGKSFGNRTGL-NHHKIIH--TGEKPFSCSECGKGFSRRQDLTIHFRIHTEEKPFTCTECGKSFTSSSQLYEHRRGHIGGKSFTCTECGKIFTRISHLNIHLRRHTGER 1028          

HSP 19 Score: 60.8474 bits (146), Expect = 2.856e-8
Identity = 41/142 (28.87%), Postives = 62/142 (43.66%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C +C ++F  + +LN H++ H    T      C  C + F        H + +   T  K Y CT C K       +N H  +HS E    C  C + F ++     H R HTGEKP+ C  CG  F+++     H + H
Sbjct: 1002 FTCTECGKIFTRISHLNIHLRRH----TGERPFTCTECGKSFTCIAQLNLHRRHH---TGEKPYTCTECGKCFCTRTGLNHHKIVHSGEKPFTCTECGRCFSRRCKLKAHSRLHTGEKPFACAECGKCFARQDQLTAHSRLH 1136          

HSP 20 Score: 60.4622 bits (145), Expect = 3.498e-8
Identity = 58/229 (25.33%), Postives = 97/229 (42.36%), Query Frame = 1
Query: 4861 RRSARKSDLNSNETTSLKRKIDEEFSDLDQEWSIEESDMEHSMWNISR------DIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            +R AR+S LN +  T    K     S   + +S       HS  +I        D  K   +++ +++H+ S++      +  ++C++C + F T    +S + +H +  T      C  C + F+       H + +   T  + Y C+ C K     A +  H +IH+ E    C  C K F ++S    HL  H  EKPY C  CG  F+   + N H + H   R
Sbjct:  414 KRFARRSHLNEHNRTHTGEK-PYSCSVCGRCFSYRSHLNSHSRIHIGEEPFSCTDCGKRCTSDSDLLVHRRSHS-----GEGSFSCIECEKHFTT----HSDLIVHRRSHTGEGPFACSECGKRFKRHSQLTVHNRVH---TGERPYSCSECGKHFKEHANLKVHWRIHTGEKPFTCSQCGKGFVRRSDLDRHLSLHKAEKPYSCSQCGKHFACVSDLNVHHRVHMDQR 629          

HSP 21 Score: 58.151 bits (139), Expect = 1.654e-7
Identity = 52/221 (23.53%), Postives = 85/221 (38.46%), Query Frame = 1
Query: 5059 NNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIH-----------------------------SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            ++RT+  +K  Y C +C + F     L  H +   +  T  +  PC  C + F  +    +H +++   T  K Y C++C +  ++   +N H +IH                              E S +C  C+K F   S  + H R HTGE P+ C  CG  F +      H + H   R     + G + +     K   ++   EK     QCG
Sbjct:  368 HHRTHTGEK-PYLCSECGKCFINRAGLRLHKR---RSHTGEKPFPCSVCGKRFARRSHLNEHNRTH---TGEKPYSCSVCGRCFSYRSHLNSHSRIHIGEEPFSCTDCGKRCTSDSDLLVHRRSHSGEGSFSCIECEKHFTTHSDLIVHRRSHTGEGPFACSECGKRFKRHSQLTVHNRVHTGERPYSCSECGKHFKEHANLKVHWRIHTGEKPFTCSQCG 581          
BLAST of Zinc finger protein vs. Ensembl Xenopus
Match: ENSXETT00000036869.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:730703:796040:-1 gene:ENSXETG00000015770.1 transcript:ENSXETT00000036869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.813 bits (351), Expect = 2.164e-32
Identity = 155/612 (25.33%), Postives = 230/612 (37.58%), Query Frame = 1
Query: 2041 SCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYE----CQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            SC  CG+ FK  + +  H   H G   + C K    F D  + ++H                     ++       C QC+KC+ +  ++D+ R HL                K   GE      F C  CG  +     L  H+  H      SC+ C         ++ H R  +H  E        K   C  C   +  +     H  +  G    P    E  +         +++ ++  TG K FSC  C  +    G     H     G   E    C  C   F     L  H R   I +GE         F+C +C         +   T +H    P  + C  C +   +    + H   H   +  FTC EC   F+N + LK H     G K     C  C K F +   +++H    H G  ++ PFSC  C + F     L+ H  +H G     C  C K  +   + ++H   H   + F CTEC   FR+   ++ H R+ H   +P  +E    C +CGK  +    ++ H  IH   + + C  CGK F + A+  EH R H GEKPY C  C +RF+ +S+LNVH   H
Sbjct:  442 SCFECGKRFKRRSQLTVHRRSHTGERPYSCPKCGKDFKDRSTLRAH-------------------LRIHTGEKPFTCSQCEKCFTH--RSDLNR-HL----------------KSHKGEKT----FSCSQCGKYFISTSDLTVHLRIHTGERPYSCSECGKCFKDPSYLTTHQR--IHTGE--------KPFTCTECGKCFSGRAALNVHLRSHSGER--PYSCSECGKCFKYYSNLTVHQRTH--TGEKPFSCPEC-GKCFTNGASLTYHKKCHTG---EKPFTCTECGKCFRNSMGLKFHTR---IHTGE-------KPFTCTECGKCFRNSTDLKFHTRIHTGEKP--FTCTECGKCFRNSTDLKFHTRSHT-GEKPFTCTECGKCFRNSSGLKFHTRIHTGEK--PFTCIECGKCFRDCTSLKIHT-RIHTG-EKVKPFSCTECGKCFCNSTGLKFHTRIHTGEKPFTCTECGKCFRDHTSLKIHTRIHTGEKPFTCTECGKCFRNSSGLKFHTRI-HTGEKPFTWEKPFPCSVCGKRFSHRSHLNSHYKIHTGEKSFLCSVCGKCFARRAHLTEHHRTHTGEKPYSCSECGKRFSYRSHLNVHFKIH 975          

HSP 2 Score: 126.716 bits (317), Expect = 2.421e-28
Identity = 170/691 (24.60%), Postives = 265/691 (38.35%), Query Frame = 1
Query: 1906 KRQEQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHL-HKNENVSGPGKR-----------------KILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVK-HLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            K    +  F+  + +K F       L+++ + ++ +   G+ +  SC  CG+ F+    + +H   H G   + C      F+    +  H      E+   C   ++     ++ +++ S+ + + P  C +C   F     L +H  I        C   G  F  RT L++  +   GE      F C  C   ++    L  H+ +H      SC+ C  R      + +H R H   K  + S  GKR                 K+ IC  C   + +      HQ +   +   P    E  +   +R    ++  S+  TG + +SC  C  + K   R  ++ HL +  G   E    C  C   F     L+ HL+ +    GE         FSC +C  +F     +  H   +H    P  Y C  C +   D      H   H   +  FTC EC   F   AAL +HL +  G  +    CS C K F     + VH    H G     PFSC  C + F     L  H++ H G     C  C K  ++    + H   H   + F CTEC   FR+   ++ H R+ H   +P  + C  CGK     T +  H   H   + + C  CGK F  S+    H RIH GEKP+ C  C + F   ++L +H   H
Sbjct:  153 KTHTGVKPFVCSVCEKRF-------LWETDYIVHKRSHTGE-KLFSCSECGKRFRHRVPLIEHYRTHTGEKPYSCSDCGKSFSRSSDFNRHCRIHRLEKSCICSKCNKQFTSHSELIVHQSSHVGEGPYSCSECGKRFNCPSKLTIHERIHTGERPYSCSECGKGFKERTTLNAHLRSHTGEKP----FTCSQCEKCFTHRSDLNRHLRSHTGEKPFSCSECGKRFTRHVHLIEHYRTHTGEKPYSCSDCGKRFSHGSDFNRHCRIHRLEKLCICSQCKKQFTSHSELIVHQSSH--MEEGPYSCFECGKRFKRRSQLTVHRRSH--TGERPYSCPKCGKDFK--DRSTLRAHLRIHTG---EKPFTCSQCEKCFTHRSDLNRHLKSH---KGE-------KTFSCSQCGKYFISTSDLTVH-LRIHTGERP--YSCSECGKCFKDPSYLTTHQRIH-TGEKPFTCTECGKCFSGRAALNVHLRSHSG--ERPYSCSECGKCFKYYSNLTVH-QRTHTG---EKPFSCPECGKCFTNGASLTYHKKCHTGEKPFTCTECGKCFRNSMGLKFHTRIHTGEKPFTCTECGKCFRNSTDLKFHTRI-HTGEKP--FTCTECGKCFRNSTDLKFHTRSHTGEKPFTCTECGKCFRNSSGLKFHTRIHTGEKPFTCIECGKCFRDCTSLKIHTRIH 799          

HSP 3 Score: 118.627 bits (296), Expect = 6.127e-26
Identity = 156/639 (24.41%), Postives = 235/639 (36.78%), Query Frame = 1
Query: 2032 RDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVK-VAGRDYVKHLDVKHG---LTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKH--EENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSN----SQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            R  SC  CG+ FK  +N+  H+  H G   F C +    FT+  S   H      E+   C    +          +      + P  C +C   F  +  L+ H  I        C       R   D K+        + F C  CG  +     L  H   H      +C  C         +  H R  +H  E V      K   C  C   +       +H     G    P    E  +      + +++  + + TG K F+C  C    +  +G  +  H  +  G    T E    C +C   F     L+ H +   I +GE         F C  C      R  +      H    P  Y C  C +R + R    +H + H  E++ L F C +C   F   A L  H  T  G K     CS C K FS+    ++  R+H  ++        PF C  C + F F ++L AHQ +H G     C  C K  +  +   +H   H   + F C+EC+ +F  +  +  H+R  H   +P  + C  CGK  +    + +H   H   + + C  CGK FT       H+RIH GEKP+ C  C + F +   L VH   H++ +
Sbjct:  607 RPYSCSECGKCFKYYSNLTVHQRTHTGEKPFSCPECGKCFTNGASLTYHKKCHTGEKPFTCTECGKCFRNSMGLKFHTRIHTGEKPFTCTECGKCFRNSTDLKFHTRIHTGEKPFTCTECGKCFRNSTDLKFHTRSHTGEKPFTCTECGKCFRNSSGLKFHTRIHTGEKPFTCIECGKCFRDCTSLKIHTR--IHTGEKV------KPFSCTECGKCFCNSTGLKFHTRIHTG--EKPFTCTECGKCFRDHTSLKIH--TRIHTGEKPFTCTECGKCFRNSSGLKF--HTRIHTGEKPFTWEKPFPCSVCGKRFSHRSHLNSHYK---IHTGE-------KSFLCSVCGKCFARRAHLTEHHRTHTGEKP--YSCSECGKRFSYRSHLNVHFKIHTGEKSFLCFACGKC---FARRAHLTEHHRTHTGEK--PYSCSECGKCFSSRSLFTKHYRIHRGDK--------PFICSPCGKHFTFHSDLIAHQRIHTGEKPFSCTECGKSFQKRQQLIVHLRTHTGEKPFSCSECEKSFIDRPRLTVHLRT-HTGEKP--FSCSDCGKRFSNHAGLRIHKKFHTGEKPFSCSECGKCFTHRTDLTVHLRIHTGEKPFTCTECGKCFARHFQLTVHSRSHKREK 1203          

HSP 4 Score: 115.931 bits (289), Expect = 4.799e-25
Identity = 117/478 (24.48%), Postives = 182/478 (38.08%), Query Frame = 1
Query: 2593 KILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDE---SAEPLYKRRTKRMNELSY--MATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVK--------------------------QNDLKCSICEKDFSNSQEI----RVHILEEHEGC--------------------VELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKI---VTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            K  +C +C   +          W    +VH    T E   S     KR   R+  + +    TG K +SC  C      +  D+ +H  +     +E   +C  C   F +   L  H + +H+  G Y  +     F+C           +  H   +H    P  Y C  C +   +R     HL  H   +  FTC +C+  F + + L  HL +  G K                          +    CS C K FS+  +     R+H LE+   C                    +E  P+SCF C ++F   ++L  H+  H G     C  C K  K       H   H   + F C++C+  F  +  + RH++    +   + + C  CGK     + +++H+ IH   R Y C  CGK F   +Y   H RIH GEKP+ C  C + F+ ++ LNVH+  H   R
Sbjct:  159 KPFVCSVCEKRF---------LWETDYIVHKRSHTGEKLFSCSECGKRFRHRVPLIEHYRTHTGEKPYSCSDCGKSFSRSS-DFNRHCRIHR---LEKSCICSKCNKQFTSHSELIVH-QSSHVGEGPYSCSECGKRFNCPS--------KLTIHE-RIHTGERP--YSCSECGKGFKERTTLNAHLRSHT-GEKPFTCSQCEKCFTHRSDLNRHLRSHTGEKPFSCSECGKRFTRHVHLIEHYRTHTGEKPYSCSDCGKRFSHGSDFNRHCRIHRLEKLCICSQCKKQFTSHSELIVHQSSHMEEGPYSCFECGKRFKRRSQLTVHRRSHTGERPYSCPKCGKDFKDRSTLRAHLRIHTGEKPFTCSQCEKCFTHRSDLNRHLKS---HKGEKTFSCSQCGKYFISTSDLTVHLRIHTGERPYSCSECGKCFKDPSYLTTHQRIHTGEKPFTCTECGKCFSGRAALNVHLRSHSGER 607          

HSP 5 Score: 83.5741 bits (205), Expect = 3.090e-15
Identity = 73/232 (31.47%), Postives = 100/232 (43.10%), Query Frame = 1
Query: 3154 NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            N  T  C E     K +A   +H +T  GVK     CS+CEK F    +  VH    H G      FSC  C ++F     L  H   H G     C  C K       +  H   H   +   C++C   F S   +  H +  H+   P  Y C  CGK     +++++H  IH   R Y C  CGK F +    N H+R H GEKP+ C  C++ F  +S+LN H+  H
Sbjct:  129 NTETDNCSELHKPCKTKADFLMHQKTHTGVK--PFVCSVCEKRFLWETDYIVH-KRSHTG---EKLFSCSECGKRFRHRVPLIEHYRTHTGEKPYSCSDCGKSFSRSSDFNRHCRIHRLEKSCICSKCNKQFTSHSELIVH-QSSHVGEGP--YSCSECGKRFNCPSKLTIHERIHTGERPYSCSECGKGFKERTTLNAHLRSHTGEKPFTCSQCEKCFTHRSDLNRHLRSH 351          

HSP 6 Score: 80.1073 bits (196), Expect = 3.493e-14
Identity = 57/192 (29.69%), Postives = 87/192 (45.31%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTSDYPDLELI 5643
            + C  C + F    +LNSH KIH    T  +   C  C + F  +    +H +++   T  K Y C+ C K  ++   +N H KIH+ E S  C  C K F ++++  EH R HTGEKPY C  CG  FS +  +  H + H   +       G +          +++   EK  +  +CG S     +LI
Sbjct:  897 FPCSVCGKRFSHRSHLNSHYKIH----TGEKSFLCSVCGKCFARRAHLTEHHRTH---TGEKPYSCSECGKRFSYRSHLNVHFKIHTGEKSFLCFACGKCFARRAHLTEHHRTHTGEKPYSCSECGKCFSSRSLFTKHYRIHRGDKPFICSPCGKHFTFHSDLIAHQRIHTGEKPFSCTECGKSFQKRQQLI 1081          

HSP 7 Score: 79.7221 bits (195), Expect = 5.108e-14
Identity = 48/145 (33.10%), Postives = 71/145 (48.97%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHN---LTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C +C + F    +L  H +IH    T  +   C  C + F+N      H + +      T  K + C++C K  +    +N H KIH+ E S  C +C K F ++++  EH R HTGEKPY C  CG  FS + + N H K H
Sbjct:  835 FTCTECGKCFRDHTSLKIHTRIH----TGEKPFTCTECGKCFRNSSGLKFHTRIHTGEKPFTWEKPFPCSVCGKRFSHRSHLNSHYKIHTGEKSFLCSVCGKCFARRAHLTEHHRTHTGEKPYSCSECGKRFSYRSHLNVHFKIH 975          

HSP 8 Score: 78.5666 bits (192), Expect = 1.111e-13
Identity = 45/142 (31.69%), Postives = 70/142 (49.30%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y+C +C + F     L  H +IH    T      C  C + F+ +     H++S+   T  K + C+ C+K       +N H++ H+ E   +C  C K+F +  + +EH R HTGEKPY C  CG  FS   ++N H + H
Sbjct:  273 YSCSECGKRFNCPSKLTIHERIH----TGERPYSCSECGKGFKERTTLNAHLRSH---TGEKPFTCSQCEKCFTHRSDLNRHLRSHTGEKPFSCSECGKRFTRHVHLIEHYRTHTGEKPYSCSDCGKRFSHGSDFNRHCRIH 407          

HSP 9 Score: 77.7962 bits (190), Expect = 1.681e-13
Identity = 49/146 (33.56%), Postives = 72/146 (49.32%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C KC + F     L +H++IH    T  +   C  C + F ++    +H+KS+      K + C+ C K     ++   H++IH+ E   +C  C K FK  SY   H R HTGEKP+ C  CG  FS +   N HL+ H   R
Sbjct:  469 YSCPKCGKDFKDRSTLRAHLRIH----TGEKPFTCSQCEKCFTHRSDLNRHLKSHKG---EKTFSCSQCGKYFISTSDLTVHLRIHTGERPYSCSECGKCFKDPSYLTTHQRIHTGEKPFTCTECGKCFSGRAALNVHLRSHSGER 607          

HSP 10 Score: 70.4774 bits (171), Expect = 2.879e-11
Identity = 62/222 (27.93%), Postives = 95/222 (42.79%), Query Frame = 1
Query: 5047 HKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIH------------------------NKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNT-EKIVNSVQCG 5613
            H   ++RT+  +K  Y+C +C + F    +LN H KIH                        ++  T  +   C  C + F ++ LF KH + +      K + C+ C K   F ++   H +IH+ E   +C  C K F+K+   + HLR HTGEKP+ C  C   F  +     HL+ H   +     D G        G  I K F+T EK  +  +CG
Sbjct:  939 HLTEHHRTHTGEK-PYSCSECGKRFSYRSHLNVHFKIHTGEKSFLCFACGKCFARRAHLTEHHRTHTGEKPYSCSECGKCFSSRSLFTKHYRIHRG---DKPFICSPCGKHFTFHSDLIAHQRIHTGEKPFSCTECGKSFQKRQQLIVHLRTHTGEKPFSCSECEKSFIDRPRLTVHLRTHTGEKPFSCSDCGKRFS-NHAGLRIHKKFHTGEKPFSCSECG 1155          

HSP 11 Score: 67.3958 bits (163), Expect = 3.011e-10
Identity = 57/201 (28.36%), Postives = 85/201 (42.29%), Query Frame = 1
Query: 5041 ILHKESNNRTNKKQKLE--YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
              H+   NR  K  K E  ++C +C + F +  +L  H++IH    T      C  C + F++      H + +   T  K + CT C K     A +N H++ HS E   +C  C K FK  S    H R HTGEKP+ C  CG  F+   +   H K H   +     + G   +     K   ++   EK     +CG
Sbjct:  506 FTHRSDLNRHLKSHKGEKTFSCSQCGKYFISTSDLTVHLRIH----TGERPYSCSECGKCFKDPSYLTTHQRIH---TGEKPFTCTECGKCFSGRAALNVHLRSHSGERPYSCSECGKCFKYYSNLTVHQRTHTGEKPFSCPECGKCFTNGASLTYHKKCHTGEKPFTCTECGKCFRNSMGLKFHTRIHTGEKPFTCTECG 699          

HSP 12 Score: 64.3142 bits (155), Expect = 2.592e-9
Identity = 51/196 (26.02%), Postives = 87/196 (44.39%), Query Frame = 1
Query: 4942 LDQEWSIEESDMEHSMWNISRDIVKNGITENSIILHKESNNR----TNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + +E+S E  +      N   + +    T   I+    SN+     T+   K EY+C   N+    +  L   ++  +      E   C    +  + K  F  H K++   T  K + C++C+K   +  +   H + H+ E   +C  C K+F+ +   +EH R HTGEKPY C  CG  FS+  ++N H + H
Sbjct:   47 IKEEYSCEGENQSDCCINPPTEQIHETDTPTPIMGCSPSNSSADDYTSVVIKEEYSCKGENQSDCCINPLTEQIQGTDTPTPNTETDNCSELHKPCKTKADFLMHQKTH---TGVKPFVCSVCEKRFLWETDYIVHKRSHTGEKLFSCSECGKRFRHRVPLIEHYRTHTGEKPYSCSDCGKSFSRSSDFNRHCRIH 239          

HSP 13 Score: 62.003 bits (149), Expect = 1.267e-8
Identity = 49/182 (26.92%), Postives = 72/182 (39.56%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            Y+C +C + F    NL  H + H    T  +   C  C + F N      H K +   T  K + CT C K       +  H +IH+ E    C  C K F+  +    H R HTGEKP+ C  CG  F    +   H + H   +     + G   +     K   ++   EK    ++CG
Sbjct:  609 YSCSECGKCFKYYSNLTVHQRTH----TGEKPFSCPECGKCFTNGASLTYHKKCH---TGEKPFTCTECGKCFRNSMGLKFHTRIHTGEKPFTCTECGKCFRNSTDLKFHTRIHTGEKPFTCTECGKCFRNSTDLKFHTRSHTGEKPFTCTECGKCFRNSSGLKFHTRIHTGEKPFTCIECG 783          

HSP 14 Score: 61.6178 bits (148), Expect = 1.565e-8
Identity = 53/220 (24.09%), Postives = 81/220 (36.82%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIH-----------------------------SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE--------------SYRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            + C +C + F    +LN H++ H    T  +   C  C + F   +   +H +++   T  K Y C+ C K  +     N H +IH                              E   +C  C K+FK++S    H R HTGE+PY C  CG +F  +     HL+ H               ++R D   +L          K    EK  +  QCG
Sbjct:  329 FTCSQCEKCFTHRSDLNRHLRSH----TGEKPFSCSECGKRFTRHVHLIEHYRTH---TGEKPYSCSDCGKRFSHGSDFNRHCRIHRLEKLCICSQCKKQFTSHSELIVHQSSHMEEGPYSCFECGKRFKRRSQLTVHRRSHTGERPYSCPKCGKDFKDRSTLRAHLRIHTGEKPFTCSQCEKCFTHRSDLNRHL----------KSHKGEKTFSCSQCG 531          

HSP 15 Score: 61.6178 bits (148), Expect = 1.618e-8
Identity = 40/143 (27.97%), Postives = 68/143 (47.55%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            ++C +C + F   + L  H++ H    T  +   C  C + F ++     H++++   T  K + C+ C K     A +  H K H+ E   +C  C K F  ++    HLR HTGEKP+ C  CG  F++ +    H + H+
Sbjct: 1065 FSCTECGKSFQKRQQLIVHLRTH----TGEKPFSCSECEKSFIDRPRLTVHLRTH---TGEKPFSCSDCGKRFSNHAGLRIHKKFHTGEKPFSCSECGKCFTHRTDLTVHLRIHTGEKPFTCTECGKCFARHFQLTVHSRSHK 1200          

HSP 16 Score: 60.4622 bits (145), Expect = 3.152e-8
Identity = 47/153 (30.72%), Postives = 69/153 (45.10%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            RT+  +K  Y+C  C + F    + N H +IH     + +   C  C + F +      H  S+    E   Y C  C K     + +  H + H+ E   +C  C K FK +S    HLR HTGEKP+ C  C   F+ + + N HLK H+ 
Sbjct:  377 RTHTGEK-PYSCSDCGKRFSHGSDFNRHCRIHR----LEKLCICSQCKKQFTSHSELIVHQSSH---MEEGPYSCFECGKRFKRRSQLTVHRRSHTGERPYSCPKCGKDFKDRSTLRAHLRIHTGEKPFTCSQCEKCFTHRSDLNRHLKSHKG 521          

HSP 17 Score: 56.225 bits (134), Expect = 7.852e-7
Identity = 45/162 (27.78%), Postives = 66/162 (40.74%), Query Frame = 1
Query: 5032 NSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            NS  L   + + T +K    + C +C + F     L  H +IH    T  +   C  C + F++      H +  H   + K + CT C K       +  H +IH+ E    C  C K F+  +    H R HTGEKP+ C  CG  F        H + H
Sbjct:  732 NSTDLKFHTRSHTGEKP---FTCTECGKCFRNSSGLKFHTRIH----TGEKPFTCIECGKCFRDCTSLKIHTR-IHTGEKVKPFSCTECGKCFCNSTGLKFHTRIHTGEKPFTCTECGKCFRDHTSLKIHTRIHTGEKPFTCTECGKCFRNSSGLKFHTRIH 885          

HSP 18 Score: 55.8398 bits (133), Expect = 1.020e-6
Identity = 36/125 (28.80%), Postives = 56/125 (44.80%), Query Frame = 1
Query: 5155 IHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            +H +  T  +   C  C + F++++   +H +++   T  K Y C+ C K  +     N H +IH  E S  C  C+K+F   S  + H   H GE PY C  CG  F+       H + H   R
Sbjct:  178 VHKRSHTGEKLFSCSECGKRFRHRVPLIEHYRTH---TGEKPYSCSDCGKSFSRSSDFNRHCRIHRLEKSCICSKCNKQFTSHSELIVHQSSHVGEGPYSCSECGKRFNCPSKLTIHERIHTGER 299          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Zfp26 (zinc finger protein 26 [Source:MGI Symbol;Acc:MGI:99173])

HSP 1 Score: 151.369 bits (381), Expect = 3.229e-36
Identity = 143/563 (25.40%), Postives = 213/563 (37.83%), Query Frame = 1
Query: 2275 QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSY-------MATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRV---------DH----------------LNLEPERYECQICGKIVT---QISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            QCD+C + F  +  L  HL    G                     + F C ICG  +++   L  H+  H       C VC         ++ HLR H          G+R    C  C   + +     + Q  EH      IKT    +P   +   R    S        + TG+K + C +C  +   A     KH+ + +G   E    C+ C   F T   L +H+R   I +GE         F C +C     H   +V H    H    P  +EC  C +        RIH+  H   +  + C EC   F   + L  H+ T  G  +   +C  C K F +  ++ VHI           PF C +C + F   + L+ H  +H G+   +C  C K   +     +H   H   + + C EC   F +   +  HIR          DH                ++   + ++C +CGK  T    + +HM  H   + +QC  CGK F  S+Y   H+RIH GEKPY C  C + F + S LN H+  H
Sbjct:  429 QCDQCGNAFASSSYLTTHLRTHTG--------------------EKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHT---------GERP-YPCTECEKAFTS-----FAQLTEH------IKTHTGEKPFRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYC-GKAFTARSGLTKHVLIHNG---EKPYECKECGKAFSTSSGLVEHIR---IHTGE-------KPFECYQCGKALAHSSSLVGH-LRTHTGEKP--FECNQCDKTFTRSSYLRIHMRTHT-GEKPYECKECGKTFPERSCLTKHIRTHTG--ERPYECKECGKGFISFAQLTVHIKTH----SSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCGKAFASSSYLNVHLKIHTGEKPFQCTVCGKTFTCSSYLPVHMRTHTGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLRKH 926          

HSP 2 Score: 130.183 bits (326), Expect = 1.087e-29
Identity = 101/360 (28.06%), Postives = 150/360 (41.67%), Query Frame = 1
Query: 2860 TVELDTLCRICADIFETPERLSDHLRE-------------NHIQSGEYINAGIQS-----IFSCDKCT--------FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            T E    C+ C   F  P RL++H+R              N   S  Y+   +++      F C+ C           GH R         H    P  YEC  C +  + R    IHL KH   +  + C EC+  F + A L  H++T  G K    +C +C + F NS  ++ H    H G   + P+ C  C + F   + L  H  +H G    +C  C K   +      H   H   + F+C +C        ++  H+R  H   +P  +EC  C K  T+ S   +HM  H   + Y+C+ CGK F + +   +H+R H GE+PYEC  C + F   + L VHI  H   R
Sbjct:  395 TREKSYECKECGKTFIQPSRLTEHMRSHTGEKPYQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIR--------THTGEKP--YECKVCGKAFSGRSWLTIHLRKHT-GERPYPCTECEKAFTSFAQLTEHIKTHTGEK--PFRCKVCARTFRNSSCLKTH-FRIHTG---IKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRT-HTGEKP--FECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSER 734          

HSP 3 Score: 92.8189 bits (229), Expect = 3.468e-18
Identity = 50/146 (34.25%), Postives = 76/146 (52.05%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C +C + F    +L  H++ H ++ +      CK C + F       +HM+S+   T  K YQC  C    A   ++  H++ H+ E    C IC K F + SY + H+R HTGEKPY+CK+CG  FS +     HL++H   R
Sbjct:  372 YDCKECGKAFTERSSLIVHLRQHTREKSYE----CKECGKTFIQPSRLTEHMRSH---TGEKPYQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGER 510          

HSP 4 Score: 92.0485 bits (227), Expect = 6.228e-18
Identity = 63/228 (27.63%), Postives = 98/228 (42.98%), Query Frame = 1
Query: 3247 QNDLKCSICEKDFSNSQEIRVHILEEHE---------GCVELYPFS--------------CFMCQEKFLFENELQAHQEVHG--GMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            +  ++CS C + F N  E++ H     E         G    +P S              C  C++ F     L  H + H       C  C K      +  +H  +H R + ++C EC  TF     +  H+R  H   +P  Y+C  CG        ++ H+  H   + ++C  CGK FT+S+Y   H+R H GEKPYEC +C + F+ +S L +H+  H   R
Sbjct:  286 EKSVECSDCGETFVNQLELQTHSSSHREKNIHKSEECGQASTHPISHGGHVIPTEKKYYECKKCEKFFTHPVYLNIHMQSHTVEKPYDCKECGKAFTERSSLIVHLRQHTREKSYECKECGKTFIQPSRLTEHMR-SHTGEKP--YQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGER 510          

HSP 5 Score: 89.7373 bits (221), Expect = 3.203e-17
Identity = 52/152 (34.21%), Postives = 77/152 (50.66%), Query Frame = 1
Query: 5062 NRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            N T +K    Y C +C + F T   L +H++ H  +    +   C HC + F +      H+K +   T  K +QCT+C K     +++  HM+ H+ E    C IC K F   SY   H+R HTGEKPY C+ CG  F++    N HL++H
Sbjct:  785 NHTGEKS---YACQECGKAFSTSSGLIAHIRSHKGE----KPFECDHCGKAFASSSYLNVHLKIH---TGEKPFQCTVCGKTFTCSSYLPVHMRTHTGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLRKH 926          

HSP 6 Score: 85.1149 bits (209), Expect = 8.393e-16
Identity = 133/618 (21.52%), Postives = 201/618 (32.52%), Query Frame = 1
Query: 1990 SIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGV----------SFNARTPLDSKY--DPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRR--TKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDT-------LCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGE 3756
            S + L H + +   +   C  CG+ F   + +  H  +H G   + C + +  FT       H                       I     + P +C  C   F  +  L+ H  I  G+          +F AR+ L        GE      + C  CG  +S    L  H+  H       C  C   L     +  HLR H             K   C+ C+  + T+ +Y       H     P +  E  +   +R   TK +       TG + + CK C       G+ ++        LTV + T        C++C   F     L  H R                                      +H    P  Y+C +C +    R    IHL  H   + ++ C EC   F   + L  H+ +  G K    +C  C K F++S  + VH L+ H G     PF C +C + F   + L  H   H G    QC +C K         +H   H   + + C  C   F     + +H+R  H   +P                          Y+ + CG+ FT SA  NEH   H GE
Sbjct:  468 SSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEH-----------------------IKTHTGEKPFRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKP----YECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHT----------GEKPFECNQCDKTF-TRSSYLRIHMRTH-TGEKPYECKECGKTFPERSCLTKHIR----THTGERPYECKEC-------GKGFISFAQ----LTVHIKTHSSERPFQCKVCTKSFRNSSSLETHFR--------------------------------------IHTGVKP--YKCSYCGKAFTARSGLTIHLRNH-TGEKSYACQECGKAFSTSSGLIAHIRSHKGEK--PFECDHCGKAFASSSYLNVH-LKIHTG---EKPFQCTVCGKTFTCSSYLPVHMRTHTGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLR-KHTGEKP--------------------------YEYKECGENFTTSADANEHETPHWGE 957          

HSP 7 Score: 84.3445 bits (207), Expect = 1.444e-15
Identity = 58/199 (29.15%), Postives = 83/199 (41.71%), Query Frame = 1
Query: 3334 CVELYPFSCFMCQEKFLFENELQAHQE---------------------VHGGMM--------QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            C       C  C E F+ + ELQ H                        HGG +        +C  C+K         +H   H   + + C EC   F  + ++  H+R    +   + YEC+ CGK   Q   ++ HM  H   + YQC+ CG  F  S+Y   H+R H GEKP+EC+IC + F + S L  HI  H
Sbjct:  283 CTPEKSVECSDCGETFVNQLELQTHSSSHREKNIHKSEECGQASTHPISHGGHVIPTEKKYYECKKCEKFFTHPVYLNIHMQSHTVEKPYDCKECGKAFTERSSLIVHLR---QHTREKSYECKECGKTFIQPSRLTEHMRSHTGEKPYQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTH 478          

HSP 8 Score: 82.0333 bits (201), Expect = 6.700e-15
Identity = 48/146 (32.88%), Postives = 70/146 (47.95%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y C  C + F     L  HV IHN +    +   CK C + F       +H++ +   T  K ++C  C K +A  +    H++ H+ E    C  CDK F + SY   H+R HTGEKPY+CK CG  F ++     H++ H   R
Sbjct:  568 YKCNYCGKAFTARSGLTKHVLIHNGE----KPYECKECGKAFSTSSGLVEHIRIH---TGEKPFECYQCGKALAHSSSLVGHLRTHTGEKPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGER 706          

HSP 9 Score: 80.8777 bits (198), Expect = 1.287e-14
Identity = 55/164 (33.54%), Postives = 82/164 (50.00%), Query Frame = 1
Query: 5026 TENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            T + +I H     R++K +K  + C  C + F +   LN H+KIH    T  +   C  C + F        HM+++   T  K +QC IC K     +++  HM+IH+ E    C+ C K F + S   +HLR HTGEKPY+ K CG  F+   + N+H   H
Sbjct:  803 TSSGLIAHI----RSHKGEK-PFECDHCGKAFASSSYLNVHLKIH----TGEKPFQCTVCGKTFTCSSYLPVHMRTH---TGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLRKHTGEKPYEYKECGENFTTSADANEHETPH 954          

HSP 10 Score: 78.9518 bits (193), Expect = 5.080e-14
Identity = 48/151 (31.79%), Postives = 76/151 (50.33%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            RT+  +K  + C +C++ F      +S+++IH +  T  +   CK C + F  +    KH++++   T  + Y+C  C K     A +  H+K HS E    C++C K F+  S    H R HTG KPYKC  CG  F+ +     HL+ H
Sbjct:  644 RTHTGEK-PFECNQCDKTF----TRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTH---TGERPYECKECGKGFISFAQLTVHIKTHSSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNH 786          

HSP 11 Score: 77.7962 bits (190), Expect = 1.393e-13
Identity = 49/174 (28.16%), Postives = 82/174 (47.13%), Query Frame = 1
Query: 5008 IVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
              ++G+T++ +I + E            Y C +C + F T   L  H++IH    T  +   C  C +   +      H++++   T  K ++C  C K     +++  HM+ H+ E    C+ C K F ++S   +H+R HTGE+PY+CK CG  F        H+K H S R
Sbjct:  578 TARSGLTKHVLIHNGEK----------PYECKECGKAFSTSSGLVEHIRIH----TGEKPFECYQCGKALAHSSSLVGHLRTH---TGEKPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSER 734          

HSP 12 Score: 75.0998 bits (183), Expect = 7.911e-13
Identity = 45/162 (27.78%), Postives = 75/162 (46.30%), Query Frame = 1
Query: 5032 NSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            +S+I+H   + R        Y C +C + F     L  H++ H    T  +   C  C   F +      H++++   T  K ++C IC K     +++  H++ H+ E    C++C K F  +S+   HLR HTGE+PY C  C   F+      +H+K H
Sbjct:  385 SSLIVHLRQHTREKS-----YECKECGKTFIQPSRLTEHMRSH----TGEKPYQCDQCGNAFASSSYLTTHLRTH---TGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIKTH 534          

HSP 13 Score: 72.0182 bits (175), Expect = 8.335e-12
Identity = 46/151 (30.46%), Postives = 70/151 (46.36%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            RT+  +K  + C  C + F     L  H++ H    T  +   CK C + F  +     H++ +   T  + Y CT C+K     A + EH+K H+ E    C++C + F+  S    H R HTG KPYKC  CG  F+ +     H+  H
Sbjct:  448 RTHTGEK-PFECNICGKAFTRSSYLLGHIRTH----TGEKPYECKVCGKAFSGRSWLTIHLRKH---TGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIH 590          

HSP 14 Score: 67.3958 bits (163), Expect = 1.728e-10
Identity = 45/153 (29.41%), Postives = 69/153 (45.10%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            RT+  +K  Y C +C + F     L  H++ H    T      CK C + F +      H+K++   +  + +QC +C K     + +  H +IH+      C  C K F  +S    HLR HTGEK Y C+ CG  FS       H++ H+ 
Sbjct:  672 RTHTGEK-PYECKECGKTFPERSCLTKHIRTH----TGERPYECKECGKGFISFAQLTVHIKTH---SSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSHKG 816          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: BC024063 (cDNA sequence BC024063 [Source:MGI Symbol;Acc:MGI:2670978])

HSP 1 Score: 137.887 bits (346), Expect = 2.282e-32
Identity = 151/631 (23.93%), Postives = 240/631 (38.03%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMM--QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEK 3837
            HQ+ +   +   C  CG+ F +  N+  H+  H G   + CH+    F    + + H      E+  +C               +      + P +C++C   F     LR HL                K+  GE      F+C  CG  ++   IL  H   H       C+ C         +  H R H             K   C+ C   + +  N   H+  +H     P   ++  +      + +++E S+  TG K + C  C        R Y++  +  H  T E    C+ C   F     L  H R +   +GE        +F C  C+     R  +     VH    P  YEC HC E  A R   + H EKH   +  + C++C   F   + L++H     G K     C  C K F   +++    R+H  E+        P+ C  C + F+  + L+ H+  H G    +C+ C K   S    ++H+  H   + ++C  C   F S   ++ H R  H   +P   EC  CGK     + + +H  +H   + Y C  CGK FT +   + H  IH GEKPYEC+   + F  +S L +H   H +
Sbjct:  180 HQRTHTGEKPYGCSECGKAFASKGNLQTHQRTHTGEKPYCCHECGKAFATHNNLQIHEIIHTGEKPYECNECGRAFAYSRALEAHEKTHTGEKPYECNQCSKAFASHASLRNHL----------------KHHTGEKF----FVCTQCGKAFTSQSILHRHERTHTGEKPYECSQCGKAFALQSYLQIHKRTHT----------GEKPYECNHCGKAFTSHANLQNHE--KHHTGEKPYGCNQCGKAFVCSSSLQIHERSH--TGNKPYECNQCGK--AFTSRSYIQIHERIH--TGEKPYGCKQCGKAFAYSSSLQIHERSH---TGE-------KLFECTHCSKAFASRSYLRIHKRVHTGEKP--YECNHCGEAFASRGSLQNH-EKHHTGEKPYGCNQCGKVFARRSNLQIHERIHTGEK--PYGCKQCGKAFVLKRDLQIHERIHTGEK--------PYGCKQCGKAFVCSSSLKIHERSHTGEKPCECNQCGKAFASRSYLQIHKRVHTGEKPYECNLCGKAFVSHSYLQVHKRT-HTGQKPN--ECNQCGKAFVSHSYLQIHKRLHTGEKPYGCNQCGKAFTYNRDLHRHEIIHTGEKPYECNQRDKAFASQSYLQIHNRVHTR 746          

HSP 2 Score: 124.02 bits (310), Expect = 4.998e-28
Identity = 142/637 (22.29%), Postives = 243/637 (38.15%), Query Frame = 1
Query: 2044 CVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCPQ-CDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDV----KHGLTVELDTLCRICADIFETPERLSDHLRE-------------------NHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVH 3819
            C +CG+ F + +++  HE  H G   + C++    F+     + H      E+   C    +    +     +      + P  C +C   F   + L++H  I  G         +  Y+           C  CG  ++    L +H   H       CN C     S   +  HL+ H             K  +C  C   + ++   + H+    G    P +  +  +    +   ++++ ++  TG K + C  C       G+ +  H ++    KH  T E    C  C   F     L  H R                    ++IQ  E I+ G +  + C +C   F +   +  H  S   +    L+EC HC +  A R   RIH   H   +  + C+ C   F +  +L+ H +  H   +    C+ C K F+    +    R+H  E+        P+ C  C + F+ + +LQ H+ +H G     C  C K      + ++H   H   +  +C +C   F S+  ++ H RV H   +P  YEC +CGK     + + +H   H   +  +C  CGK F   +Y   H R+H GEKPY C+ C + F    +L+ H
Sbjct:  136 CNYCGKAFPSRSSLQVHERTHTGEKPYGCNECGKAFSTRSHLQIHQRTHTGEKPYGCSECGKAFASKGNLQTHQRTHTGEKPYCCHECGKAFATHNNLQIHEIIHTG---------EKPYE-----------CNECGRAFAYSRALEAHEKTHTGEKPYECNQCSKAFASHASLRNHLKHHT----------GEKFFVCTQCGKAFTSQSILHRHERTHTGE--KPYECSQCGKAFALQSYLQIHKRTH--TGEKPYECNHC-------GKAFTSHANLQNHEKH-HTGEKPYGCNQCGKAFVCSSSLQIHERSHTGNKPYECNQCGKAFTSRSYIQIHERIHTG-EKPYGCKQCGKAFAYSSSLQIHERSHTGEK---LFECTHCSKAFASRSYLRIHKRVH-TGEKPYECNHCGEAFASRGSLQNHEK--HHTGEKPYGCNQCGKVFARRSNLQIHERIHTGEK--------PYGCKQCGKAFVLKRDLQIHERIHTGEKPYGCKQCGKAFVCSSSLKIHERSHTGEKPCECNQCGKAFASRSYLQIHKRV-HTGEKP--YECNLCGKAFVSHSYLQVHKRTHTGQKPNECNQCGKAFVSHSYLQIHKRLHTGEKPYGCNQCGKAFTYNRDLHRH 712          

HSP 3 Score: 109.768 bits (273), Expect = 1.565e-23
Identity = 105/386 (27.20%), Postives = 161/386 (41.71%), Query Frame = 1
Query: 2692 KTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHK-NARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            K ++ ++P+    + R +E S+  +  K + C +C        R  ++  +  H  T E    C  C   F T   L  H R     +GE         + C +C      +G +      H    P  Y C  C +  A     +IH   H   +  + C+EC   F    AL+ H +T  G K    +C+ C K F++   +R H L+ H G  E + F C  C + F  ++ L  H+  H G    +C  C K        ++H+  H   + ++C  C   F S   ++ H +  H   +P  Y C  CGK     + + +H   H  N  Y+C  CGK FT  +Y   H RIH GEKPY C  C + F   S+L +H   H
Sbjct:  107 KRNQCSKPIANSNSLRQHERSH--SRRKLYECNYCGK--AFPSRSSLQVHERTH--TGEKPYGCNECGKAFSTRSHLQIHQR---THTGE-------KPYGCSECGKAFASKGNLQTHQRTHTGEKP--YCCHECGKAFATHNNLQIHEIIHT-GEKPYECNECGRAFAYSRALEAHEKTHTGEK--PYECNQCSKAFASHASLRNH-LKHHTG--EKF-FVCTQCGKAFTSQSILHRHERTHTGEKPYECSQCGKAFALQSYLQIHKRTHTGEKPYECNHCGKAFTSHANLQNHEK-HHTGEKP--YGCNQCGKAFVCSSSLQIHERSHTGNKPYECNQCGKAFTSRSYIQIHERIHTGEKPYGCKQCGKAFAYSSSLQIHERSH 464          

HSP 4 Score: 72.7886 bits (177), Expect = 3.555e-12
Identity = 48/142 (33.80%), Postives = 65/142 (45.77%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C   F   R L +H K H    T  +   C  CS+ F +      H+K +   T  K + CT C K     + ++ H + H+ E    C  C K F  +SY   H R HTGEKPY+C  CG  F+   N  +H K H
Sbjct:  246 YECNECGRAFAYSRALEAHEKTH----TGEKPYECNQCSKAFASHASLRNHLKHH---TGEKFFVCTQCGKAFTSQSILHRHERTHTGEKPYECSQCGKAFALQSYLQIHKRTHTGEKPYECNHCGKAFTSHANLQNHEKHH 380          

HSP 5 Score: 69.707 bits (169), Expect = 2.984e-11
Identity = 51/185 (27.57%), Postives = 81/185 (43.78%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C +C + F      +S ++IH +  T N+   C  C + F ++     H + +   T  K Y C  C K  A+ +  ++IH      E    C  C K F  +SY   H R HTGEKPY+C  CG  F+ + +  +H K H   +    +  G     +   +  +++   EK     QCG +
Sbjct:  386 YGCNQCGKAF----VCSSSLQIHERSHTGNKPYECNQCGKAFTSRSYIQIHERIH---TGEKPYGCKQCGKAFAYSSS-LQIHERSHTGEKLFECTHCSKAFASRSYLRIHKRVHTGEKPYECNHCGEAFASRGSLQNHEKHHTGEKPYGCNQCGKVFARRSNLQIHERIHTGEKPYGCKQCGKA 562          

HSP 6 Score: 68.5514 bits (166), Expect = 7.167e-11
Identity = 61/192 (31.77%), Postives = 80/192 (41.67%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFI-NEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGN----------YLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C +C +VF    NL  H +IH    T  +   CK C + F  K     H + +   T  K Y C  C K  AF+ +  +KIH      E    C  C K F  +SY   H R HTGEKPY+C +CG  F        H + H   + +  N          YLQI +R      +   EK     QCG +
Sbjct:  526 YGCNQCGKVFARRSNLQIHERIH----TGEKPYGCKQCGKAFVLKRDLQIHERIH---TGEKPYGCKQCGK--AFVCSSSLKIHERSHTGEKPCECNQCGKAFASRSYLQIHKRVHTGEKPYECNLCGKAFVSHSYLQVHKRTHTGQKPNECNQCGKAFVSHSYLQIHKR------LHTGEKPYGCNQCGKA 702          

HSP 7 Score: 67.781 bits (164), Expect = 1.225e-10
Identity = 46/143 (32.17%), Postives = 66/143 (46.15%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            Y C +C + F      +S +KIH +  T  +   C  C + F ++     H + +   T  K Y+C +C K     +++  H + H+ +    C  C K F   SY   H R HTGEKPY C  CG  F+    YN  L RHE
Sbjct:  582 YGCKQCGKAF----VCSSSLKIHERSHTGEKPCECNQCGKAFASRSYLQIHKRVH---TGEKPYECNLCGKAFVSHSYLQVHKRTHTGQKPNECNQCGKAFVSHSYLQIHKRLHTGEKPYGCNQCGKAFT----YNRDLHRHE 713          

HSP 8 Score: 65.855 bits (159), Expect = 5.111e-10
Identity = 54/203 (26.60%), Postives = 91/203 (44.83%), Query Frame = 1
Query: 5053 ESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGN----------YLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            E++ +T+  +K  Y C +C++ F +  +L +H+K H    T  +   C  C + F ++ +  +H +++   T  K Y+C+ C K  A   ++  H + H+ E    C  C K F   +    H ++HTGEKPY C  CG  F    +   H + H   +    N          Y+QI +R      +   EK     QCG +
Sbjct:  262 EAHEKTHTGEK-PYECNQCSKAFASHASLRNHLKHH----TGEKFFVCTQCGKAFTSQSILHRHERTH---TGEKPYECSQCGKAFALQSYLQIHKRTHTGEKPYECNHCGKAFTSHANLQNHEKHHTGEKPYGCNQCGKAFVCSSSLQIHERSHTGNKPYECNQCGKAFTSRSYIQIHER------IHTGEKPYGCKQCGKA 450          

HSP 9 Score: 57.3806 bits (137), Expect = 1.957e-7
Identity = 48/162 (29.63%), Postives = 70/162 (43.21%), Query Frame = 1
Query: 5032 NSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            NS+  H+ S++R    +KL Y C  C + F +  +L  H + H    T  +   C  C + F  +     H +++   T  K Y C+ C K  A    +  H + H+ E    C  C K F   +    H   HTGEKPY+C  CG  F+       H K H
Sbjct:  119 NSLRQHERSHSR----RKL-YECNYCGKAFPSRSSLQVHERTH----TGEKPYGCNECGKAFSTRSHLQIHQRTH---TGEKPYGCSECGKAFASKGNLQTHQRTHTGEKPYCCHECGKAFATHNNLQIHEIIHTGEKPYECNECGRAFAYSRALEAHEKTH 268          

HSP 10 Score: 55.8398 bits (133), Expect = 6.480e-7
Identity = 35/105 (33.33%), Postives = 49/105 (46.67%), Query Frame = 1
Query: 5203 CSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            CS+   N     +H +S+   +  K Y+C  C K     + +  H + H+ E    C  C K F  +S+   H R HTGEKPY C  CG  F+ K N   H + H
Sbjct:  111 CSKPIANSNSLRQHERSH---SRRKLYECNYCGKAFPSRSSLQVHERTHTGEKPYGCNECGKAFSTRSHLQIHQRTHTGEKPYGCSECGKAFASKGNLQTHQRTH 212          

HSP 11 Score: 54.299 bits (129), Expect = 1.826e-6
Identity = 39/133 (29.32%), Postives = 57/133 (42.86%), Query Frame = 1
Query: 5110 NEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDH 5493
            N+    + N NS ++ H +  +  +   C +C + F ++     H +++   T  K Y C  C K  +    H++IH      E    C  C K F  K     H R HTGEKPY C  CG  F+   N   H
Sbjct:  109 NQCSKPIANSNS-LRQHERSHSRRKLYECNYCGKAFPSRSSLQVHERTH---TGEKPYGCNECGKAFS-TRSHLQIHQRTHTGEKPYGCSECGKAFASKGNLQTHQRTHTGEKPYCCHECGKAFATHNNLQIH 236          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Zfp930 (zinc finger protein 930 [Source:MGI Symbol;Acc:MGI:2675306])

HSP 1 Score: 129.798 bits (325), Expect = 4.371e-31
Identity = 104/363 (28.65%), Postives = 157/363 (43.25%), Query Frame = 1
Query: 2764 TGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMM--QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            TG K + C  C      A  DY      +   T E    C  C   F     L +H R     +GE         + C +C   F H+  +  H  S H    P  YEC  C +  A +   + H   H   +  + C+EC   F   ++L+ H  T  G K    +C+ C K FS    +R H    H G     P+ C  C + F   + LQ H+  H G +  +C+ C K      + ++H+  H   + ++C +C   F    ++R+H R  H   +P  YEC  CGK  ++   +  H   H   + Y+C  CGK FT+  +  +H R H GEKPYEC+ C + F++ S+L +H   H
Sbjct:   96 TGEKPYKCNQCGK----AFVDYCTLQKHERTHTGEKAYECNECGKGFTQQAYLQNHKR---THTGE-------KPYECYECGKGFAHYSTLRKHG-STHTGEKP--YECNECGKAFAQQSHLQNHKRTHT-GEKPYECNECGKAFSQHSSLQNHKRTHTGEK--PYECNECGKAFSQYSNLRKHK-RTHTG---EKPYECNECGKAFSQHSSLQQHKRTHTGEIPYECNECGKAFSQHSSLQMHKRTHTGEKPYECKQCGKAFSQHSSLRKHKRT-HTGQKP--YECSQCGKAFSRHSSLQQHKRTHTGEKPYECNECGKAFTQQGHLQKHKRTHTGEKPYECNQCGKAFSEPSSLQMHKRTH 431          

HSP 2 Score: 71.2478 bits (173), Expect = 6.066e-12
Identity = 45/154 (29.22%), Postives = 72/154 (46.75%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGN 5532
            ++ Y C +C + F    +L  H + H    T  +   CK C + F       KH +++   T  K Y+C+ C K  +    + +H + H+ E    C  C K F ++ +  +H R HTGEKPY+C  CG  FS+  +   H + H   + D  N
Sbjct:  294 EIPYECNECGKAFSQHSSLQMHKRTH----TGEKPYECKQCGKAFSQHSSLRKHKRTH---TGQKPYECSQCGKAFSRHSSLQQHKRTHTGEKPYECNECGKAFTQQGHLQKHKRTHTGEKPYECNQCGKAFSEPSSLQMHKRTHNGEKLDVCN 440          

HSP 3 Score: 65.4698 bits (158), Expect = 3.725e-10
Identity = 50/188 (26.60%), Postives = 78/188 (41.49%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR--------DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C +C + F     L  H + H    T  +   C  C + F  +     H +++   T  K Y+C  C K  A    + +H   H+ E    C  C K F ++S+   H R HTGEKPY+C  CG  FS+  +  +H + H   +          F  Y  +++     K+    EK     +CG +
Sbjct:  101 YKCNQCGKAFVDYCTLQKHERTH----TGEKAYECNECGKGFTQQAYLQNHKRTH---TGEKPYECYECGKGFAHYSTLRKHGSTHTGEKPYECNECGKAFAQQSHLQNHKRTHTGEKPYECNECGKAFSQHSSLQNHKRTHTGEKPYECNECGKAFSQYSNLRKH----KRTHTGEKPYECNECGKA 277          

HSP 4 Score: 65.4698 bits (158), Expect = 3.925e-10
Identity = 47/166 (28.31%), Postives = 74/166 (44.58%), Query Frame = 1
Query: 5020 GITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            G T+ + +   +++ RT+  +K  Y C +C + F     L  H   H    T  +   C  C + F  +     H +++   T  K Y+C  C K  +    +  H + H+ E    C  C K F + S   +H R HTGEKPY+C  CG  FS+  +   H + H
Sbjct:  137 GFTQQAYL---QNHKRTHTGEKP-YECYECGKGFAHYSTLRKHGSTH----TGEKPYECNECGKAFAQQSHLQNHKRTH---TGEKPYECNECGKAFSQHSSLQNHKRTHTGEKPYECNECGKAFSQYSNLRKHKRTHTGEKPYECNECGKAFSQHSSLQQHKRTH 291          

HSP 5 Score: 63.1586 bits (152), Expect = 2.220e-9
Identity = 54/206 (26.21%), Postives = 83/206 (40.29%), Query Frame = 1
Query: 5041 ILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPI---------KKVFNTEKIVNSVQCGTS 5619
             L K  +  T +K    Y C +C + F    +L +H + H    T  +   C  C + F        H +++   T  K Y+C  C K  +    + +H + H+ E    C  C K F + S   +H R HTGE PY+C  CG  FS+  +   H + H   +       + KQ GK           K+    +K     QCG +
Sbjct:  171 TLRKHGSTHTGEK---PYECNECGKAFAQQSHLQNHKRTH----TGEKPYECNECGKAFSQHSSLQNHKRTH---TGEKPYECNECGKAFSQYSNLRKHKRTHTGEKPYECNECGKAFSQHSSLQQHKRTHTGEIPYECNECGKAFSQHSSLQMHKRTHTGEKP-----YECKQCGKAFSQHSSLRKHKRTHTGQKPYECSQCGKA 361          

HSP 6 Score: 62.003 bits (149), Expect = 4.771e-9
Identity = 40/133 (30.08%), Postives = 60/133 (45.11%), Query Frame = 1
Query: 3445 CQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            C K        + H   H   + ++C +C   F     +++H R    +   + YEC  CGK  TQ   +  H   H   + Y+C  CGK F   +   +H   H GEKPYEC+ C + F ++S+L  H   H
Sbjct:   78 CGKASTRHIGLQRHERIHTGEKPYKCNQCGKAFVDYCTLQKHERT---HTGEKAYECNECGKGFTQQAYLQNHKRTHTGEKPYECYECGKGFAHYSTLRKHGSTHTGEKPYECNECGKAFAQQSHLQNHKRTH 207          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Zfp930 (zinc finger protein 930 [Source:MGI Symbol;Acc:MGI:2675306])

HSP 1 Score: 129.798 bits (325), Expect = 4.739e-31
Identity = 105/369 (28.46%), Postives = 159/369 (43.09%), Query Frame = 1
Query: 2764 TGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMM--QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDD 3849
            TG K + C  C      A  DY      +   T E    C  C   F     L +H R     +GE         + C +C   F H+  +  H  S H    P  YEC  C +  A +   + H   H   +  + C+EC   F   ++L+ H  T  G K    +C+ C K FS    +R H    H G     P+ C  C + F   + LQ H+  H G +  +C+ C K      + ++H+  H   + ++C +C   F    ++R+H R  H   +P  YEC  CGK  ++   +  H   H   + Y+C  CGK FT+  +  +H R H GEKPYEC+ C + F++ S+L +H   H   + D
Sbjct:   97 TGEKPYKCNQCGK----AFVDYCTLQKHERTHTGEKAYECNECGKGFTQQAYLQNHKR---THTGE-------KPYECYECGKGFAHYSTLRKHG-STHTGEKP--YECNECGKAFAQQSHLQNHKRTHT-GEKPYECNECGKAFSQHSSLQNHKRTHTGEK--PYECNECGKAFSQYSNLRKHK-RTHTG---EKPYECNECGKAFSQHSSLQQHKRTHTGEIPYECNECGKAFSQHSSLQMHKRTHTGEKPYECKQCGKAFSQHSSLRKHKRT-HTGQKP--YECSQCGKAFSRHSSLQQHKRTHTGEKPYECNECGKAFTQQGHLQKHKRTHTGEKPYECNQCGKAFSEPSSLQMHKRTHNGEKLD 438          

HSP 2 Score: 71.2478 bits (173), Expect = 5.883e-12
Identity = 45/154 (29.22%), Postives = 72/154 (46.75%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGN 5532
            ++ Y C +C + F    +L  H + H    T  +   CK C + F       KH +++   T  K Y+C+ C K  +    + +H + H+ E    C  C K F ++ +  +H R HTGEKPY+C  CG  FS+  +   H + H   + D  N
Sbjct:  295 EIPYECNECGKAFSQHSSLQMHKRTH----TGEKPYECKQCGKAFSQHSSLRKHKRTH---TGQKPYECSQCGKAFSRHSSLQQHKRTHTGEKPYECNECGKAFTQQGHLQKHKRTHTGEKPYECNQCGKAFSEPSSLQMHKRTHNGEKLDVCN 441          

HSP 3 Score: 65.4698 bits (158), Expect = 3.547e-10
Identity = 50/188 (26.60%), Postives = 78/188 (41.49%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR--------DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C +C + F     L  H + H    T  +   C  C + F  +     H +++   T  K Y+C  C K  A    + +H   H+ E    C  C K F ++S+   H R HTGEKPY+C  CG  FS+  +  +H + H   +          F  Y  +++     K+    EK     +CG +
Sbjct:  102 YKCNQCGKAFVDYCTLQKHERTH----TGEKAYECNECGKGFTQQAYLQNHKRTH---TGEKPYECYECGKGFAHYSTLRKHGSTHTGEKPYECNECGKAFAQQSHLQNHKRTHTGEKPYECNECGKAFSQHSSLQNHKRTHTGEKPYECNECGKAFSQYSNLRKH----KRTHTGEKPYECNECGKA 278          

HSP 4 Score: 65.4698 bits (158), Expect = 3.938e-10
Identity = 47/166 (28.31%), Postives = 74/166 (44.58%), Query Frame = 1
Query: 5020 GITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            G T+ + +   +++ RT+  +K  Y C +C + F     L  H   H    T  +   C  C + F  +     H +++   T  K Y+C  C K  +    +  H + H+ E    C  C K F + S   +H R HTGEKPY+C  CG  FS+  +   H + H
Sbjct:  138 GFTQQAYL---QNHKRTHTGEKP-YECYECGKGFAHYSTLRKHGSTH----TGEKPYECNECGKAFAQQSHLQNHKRTH---TGEKPYECNECGKAFSQHSSLQNHKRTHTGEKPYECNECGKAFSQYSNLRKHKRTHTGEKPYECNECGKAFSQHSSLQQHKRTH 292          

HSP 5 Score: 63.1586 bits (152), Expect = 2.151e-9
Identity = 54/206 (26.21%), Postives = 83/206 (40.29%), Query Frame = 1
Query: 5041 ILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPI---------KKVFNTEKIVNSVQCGTS 5619
             L K  +  T +K    Y C +C + F    +L +H + H    T  +   C  C + F        H +++   T  K Y+C  C K  +    + +H + H+ E    C  C K F + S   +H R HTGE PY+C  CG  FS+  +   H + H   +       + KQ GK           K+    +K     QCG +
Sbjct:  172 TLRKHGSTHTGEK---PYECNECGKAFAQQSHLQNHKRTH----TGEKPYECNECGKAFSQHSSLQNHKRTH---TGEKPYECNECGKAFSQYSNLRKHKRTHTGEKPYECNECGKAFSQHSSLQQHKRTHTGEIPYECNECGKAFSQHSSLQMHKRTHTGEKP-----YECKQCGKAFSQHSSLRKHKRTHTGQKPYECSQCGKA 362          

HSP 6 Score: 62.003 bits (149), Expect = 5.130e-9
Identity = 40/133 (30.08%), Postives = 60/133 (45.11%), Query Frame = 1
Query: 3445 CQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            C K        + H   H   + ++C +C   F     +++H R    +   + YEC  CGK  TQ   +  H   H   + Y+C  CGK F   +   +H   H GEKPYEC+ C + F ++S+L  H   H
Sbjct:   79 CGKASTRHIGLQRHERIHTGEKPYKCNQCGKAFVDYCTLQKHERT---HTGEKAYECNECGKGFTQQAYLQNHKRTHTGEKPYECYECGKGFAHYSTLRKHGSTHTGEKPYECNECGKAFAQQSHLQNHKRTH 208          
BLAST of Zinc finger protein vs. Ensembl Mouse
Match: Gm14419 (predicted gene 14419 [Source:MGI Symbol;Acc:MGI:3702410])

HSP 1 Score: 129.798 bits (325), Expect = 2.799e-30
Identity = 136/533 (25.52%), Postives = 204/533 (38.27%), Query Frame = 1
Query: 2278 CDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            C++C   F   ++L++H     G         +  YD           C  CG  +++   L  H   H       CN C    G   E   HL+  +HK  +       K   C+ C   +        H+    G    P +  +  +      T +M++ ++  TG K + CK C     V      +H   K   T E    C+ C   F     L  H R     +GE         + C +C       GV+      H    P  YEC  C +  A     RIH   H   +  + C++C   F     L+ H  T  G K    +C  C K F+ S  +R+H    H G     P+ C  C + F   ++LQ H+  H G    +C  C K          H   H   + ++C +C   F     ++ H R  H   +P  YEC  CGK   +++ + MH   H   + Y+C+ CGK F +S++   H R H GEKPYEC  C + F + S+L +H   H   R
Sbjct:  105 CNQCGKDFRTWNVLQIHKRTHTG---------EKPYD-----------CKQCGKVFARSCHLQIHNQTHAGEKQYECNQC----GKAFERRSHLQ--IHKRTHTG----EKPYECNQCGKAFARSGVLQKHKRTHTGE--KPYECKQCGKAFAVISTLQMHKRTH--TGAKPYECKQCGKAFAVI-YTLQRH---KQTHTGEKPYKCKQCGKTFARSSHLRIHKR---THTGE-------KPYECKQCGKAFARSGVLQEHKRTHTGEKP--YECKQCGKAFAQSSHLRIHKRTHT-GEKPYECNQCGKAFARSGDLQQHKRTHTGEK--PYECKQCGKAFAQSSHLRIH-KRTHTG---EKPYECNQCGKAFARSDDLQKHKRTHTGEKPYECKQCGKAFAHSSHLHKHERTHTGDKPYECNQCGKAFAESSTLQIHNRT-HTGDKP--YECNQCGKAFAVISTLQMHNRTHTGEKPYKCKQCGKAFAQSSHLRIHKRTHTGEKPYECKQCGKAFAQSSHLRIHKQTHTGER 577          

HSP 2 Score: 115.931 bits (289), Expect = 8.222e-26
Identity = 92/323 (28.48%), Postives = 138/323 (42.72%), Query Frame = 1
Query: 2896 DIFETPERLSDHLRE-NHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLW---RIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNAR-----YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            D F+T      H R  +  Q  ++I  G    +        G  R  + H+   H D N C            D R W   +IH   H   +  + C +C   F     L++H +T  G KQ   +C+ C K F     +++H    H G     P+ C  C + F     LQ H+  H G    +C  C K    +   ++H+  H   + ++C +C   F     ++RH +  H   +P  Y+C+ CGK   + S H+ IHK        Y+C+ CGK F +S    EH R H GEKPYEC  C + F + S+L +H   H
Sbjct:   54 DHFQTSRSHGRHERSCSPEQPSDFIQCGKAFAYE------SGRQRHQIKHNGEKHHDCNQC----------GKDFRTWNVLQIHKRTHT-GEKPYDCKQCGKVFARSCHLQIHNQTHAGEKQ--YECNQCGKAFERRSHLQIH-KRTHTG---EKPYECNQCGKAFARSGVLQKHKRTHTGEKPYECKQCGKAFAVISTLQMHKRTHTGAKPYECKQCGKAFAVIYTLQRHKQT-HTGEKP--YKCKQCGKTFAR-SSHLRIHKRTHTGEKPYECKQCGKAFARSGVLQEHKRTHTGEKPYECKQCGKAFAQSSHLRIHKRTH 349          

HSP 3 Score: 101.679 bits (252), Expect = 2.969e-21
Identity = 144/626 (23.00%), Postives = 217/626 (34.66%), Query Frame = 1
Query: 1915 EQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYEC 3771
            EQ  DF+     K F        ++S  + +  K NG+   D C  CG++F+    +  H+  H G   + C +   VF      + H++                    +      +C QC K ++        R HL I      + RT    K           + C  CG  +++  +L  H   H       C  C      I  +  H R H             K   C  C   +        H+    G    P K  +  +   +    R+++ ++  TG K + CK C    K   R  V   + K   T E    C+ C   F     L  H R     +GE         + C++C       G +      H    P  YEC  C +  A     RIH   H   +  + C++C   F     L+ H  T  G K    +C  C K F++S  +  H    H G     P+ C  C + F   + LQ H   H G    +C+ C K    +   ++H   H   + ++C +C   F     +R H R  H   +P  YEC+ CGK   Q S H+ IHK                       + H GE+PYEC
Sbjct:   72 EQPSDFIQ--CGKAF-------AYESGRQRHQIKHNGEKHHD-CNQCGKDFRTWNVLQIHKRTHTGEKPYDCKQCGKVFARSCHLQIHNQ-------------------THAGEKQYECNQCGKAFE-------RRSHLQI------HKRTHTGEKP----------YECNQCGKAFARSGVLQKHKRTHTGEKPYECKQCGKAFAVISTLQMHKRTHT----------GAKPYECKQCGKAFAVIYTLQRHKQTHTGE--KPYKCKQCGKTFARSSHLRIHKRTH--TGEKPYECKQCG---KAFARSGVL-QEHKRTHTGEKPYECKQCGKAFAQSSHLRIHKR---THTGE-------KPYECNQCGKAFARSGDLQQHKRTHTGEKP--YECKQCGKAFAQSSHLRIHKRTH-TGEKPYECNQCGKAFARSDDLQKHKRTHTGEK--PYECKQCGKAFAHSSHLHKH-ERTHTG---DKPYECNQCGKAFAESSTLQIHNRTHTGDKPYECNQCGKAFAVISTLQMHNRTHTGEKPYKCKQCGKAFAQSSHLRIHKRT-HTGEKP--YECKQCGKAFAQ-SSHLRIHK-----------------------QTHTGERPYEC 581          

HSP 4 Score: 75.8702 bits (185), Expect = 3.684e-13
Identity = 52/185 (28.11%), Postives = 81/185 (43.78%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C +C + F      +SH++IH +  T  +   CK C + F    +  +H +++   T  K Y+C  C K  A  + H++IH      E    C  C K F +     +H R HTGEKPY+CK CG  F++  +   H + H   +    +  G         +  K+    EK     QCG +
Sbjct:  271 YKCKQCGKTFA----RSSHLRIHKRTHTGEKPYECKQCGKAFARSGVLQEHKRTH---TGEKPYECKQCGKAFA-QSSHLRIHKRTHTGEKPYECNQCGKAFARSGDLQQHKRTHTGEKPYECKQCGKAFAQSSHLRIHKRTHTGEKPYECNQCGKAFARSDDLQKHKRTHTGEKPYECKQCGKA 447          

HSP 5 Score: 74.3294 bits (181), Expect = 8.935e-13
Identity = 57/204 (27.94%), Postives = 85/204 (41.67%), Query Frame = 1
Query: 5035 SIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            S +L K     T +K    Y C +C + F  +  L  H + H    T  +   CK C + F       +H +++   T  K Y+C  C K  A  + H++IH      E    C+ C K F +     EH R HTGEKPY+CK CG  F++  +   H + H   +    +  G         +  K+    EK     QCG +
Sbjct:  199 SGVLQKHKRTHTGEK---PYECKQCGKAFAVISTLQMHKRTH----TGAKPYECKQCGKAFAVIYTLQRHKQTH---TGEKPYKCKQCGKTFA-RSSHLRIHKRTHTGEKPYECKQCGKAFARSGVLQEHKRTHTGEKPYECKQCGKAFAQSSHLRIHKRTHTGEKPYECNQCGKAFARSGDLQQHKRTHTGEKPYECKQCGKA 391          

HSP 6 Score: 73.1738 bits (178), Expect = 2.075e-12
Identity = 50/163 (30.67%), Postives = 76/163 (46.63%), Query Frame = 1
Query: 5035 SIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            S +L +     T +K    Y C +C + F      +SH++IH +  T  +   C  C + F       +H +++   T  K Y+C  C K  A  + H++IH      E    C  C K F +     +H R HTGEKPY+CK CG  F+    ++ HL +HE
Sbjct:  311 SGVLQEHKRTHTGEK---PYECKQCGKAFAQ----SSHLRIHKRTHTGEKPYECNQCGKAFARSGDLQQHKRTH---TGEKPYECKQCGKAFA-QSSHLRIHKRTHTGEKPYECNQCGKAFARSDDLQKHKRTHTGEKPYECKQCGKAFA----HSSHLHKHE 458          

HSP 7 Score: 69.707 bits (169), Expect = 2.822e-11
Identity = 48/159 (30.19%), Postives = 74/159 (46.54%), Query Frame = 1
Query: 5053 ESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + + RT+  +K  Y C +C + F    +L+ H + H  D    +   C  C + F        H +++   T  K Y+C  C K  A I+    H + H+ E    C+ C K F + S+   H R HTGEKPY+CK CG  F++  +   H + H   R
Sbjct:  427 QKHKRTHTGEK-PYECKQCGKAFAHSSHLHKHERTHTGD----KPYECNQCGKAFAESSTLQIHNRTH---TGDKPYECNQCGKAFAVISTLQMHNRTHTGEKPYKCKQCGKAFAQSSHLRIHKRTHTGEKPYECKQCGKAFAQSSHLRIHKQTHTGER 577          

HSP 8 Score: 57.3806 bits (137), Expect = 1.722e-7
Identity = 43/143 (30.07%), Postives = 66/143 (46.15%), Query Frame = 1
Query: 5032 NSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKC 5445
            +S  LHK     T  K    Y C +C + F      +S ++IHN+  T ++   C  C + F        H +++   T  K Y+C  C K  A  + H++IH      E    C+ C K F + S+   H + HTGE+PY+C
Sbjct:  450 HSSHLHKHERTHTGDK---PYECNQCGKAFAE----SSTLQIHNRTHTGDKPYECNQCGKAFAVISTLQMHNRTH---TGEKPYKCKQCGKAFA-QSSHLRIHKRTHTGEKPYECKQCGKAFAQSSHLRIHKQTHTGERPYEC 581          

HSP 9 Score: 56.9954 bits (136), Expect = 2.132e-7
Identity = 41/140 (29.29%), Postives = 63/140 (45.00%), Query Frame = 1
Query: 5101 VKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            ++C + F        H   HN +   +    C  C + F+   +   H +++   T  K Y C  C KV A  + H++IH      E    C  C K F+++S+   H R HTGEKPY+C  CG  F++      H + H
Sbjct:   78 IQCGKAFAYESGRQRHQIKHNGEKHHD----CNQCGKDFRTWNVLQIHKRTH---TGEKPYDCKQCGKVFA-RSCHLQIHNQTHAGEKQYECNQCGKAFERRSHLQIHKRTHTGEKPYECNQCGKAFARSGVLQKHKRTH 209          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|P10076|ZFP26_MOUSE (Zinc finger protein 26 OS=Mus musculus OX=10090 GN=Zfp26 PE=2 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 2.055e-35
Identity = 143/563 (25.40%), Postives = 213/563 (37.83%), Query Frame = 1
Query: 2275 QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSY-------MATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIR---------VDH----------------LNLEPERYECQICGKIVT---QISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            QCD+C + F  +  L  HL    G                     + F C ICG  +++   L  H+  H       C VC         ++ HLR H          G+R    C  C   + +     + Q  EH      IKT    +P   +   R    S        + TG+K + C +C  +   A     KH+ + +G   E    C+ C   F T   L +H+R   I +GE         F C +C     H   +V H    H    P  +EC  C +        RIH+  H   +  + C EC   F   + L  H+ T  G  +   +C  C K F +  ++ VHI           PF C +C + F   + L+ H  +H G+   +C  C K   +     +H   H   + + C EC   F +   +  HIR          DH                ++   + ++C +CGK  T    + +HM  H   + +QC  CGK F  S+Y   H+RIH GEKPY C  C + F + S LN H+  H
Sbjct:  331 QCDQCGNAFASSSYLTTHLRTHTG--------------------EKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHT---------GERP-YPCTECEKAFTS-----FAQLTEH------IKTHTGEKPFRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYC-GKAFTARSGLTKHVLIHNG---EKPYECKECGKAFSTSSGLVEHIR---IHTGE-------KPFECYQCGKALAHSSSLVGH-LRTHTGEKP--FECNQCDKTFTRSSYLRIHMRTHT-GEKPYECKECGKTFPERSCLTKHIRTHTG--ERPYECKECGKGFISFAQLTVHIKTH----SSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCGKAFASSSYLNVHLKIHTGEKPFQCTVCGKTFTCSSYLPVHMRTHTGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLRKH 828          

HSP 2 Score: 129.413 bits (324), Expect = 1.058e-28
Identity = 101/360 (28.06%), Postives = 150/360 (41.67%), Query Frame = 1
Query: 2860 TVELDTLCRICADIFETPERLSDHLRE-------------NHIQSGEYINAGIQS-----IFSCDKCT--------FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            T E    C+ C   F  P RL++H+R              N   S  Y+   +++      F C+ C           GH R         H    P  YEC  C +  + R    IHL KH   +  + C EC+  F + A L  H++T  G K    +C +C + F NS  ++ H    H G   + P+ C  C + F   + L  H  +H G    +C  C K   +      H   H   + F+C +C        ++  H+R  H   +P  +EC  C K  T+ S   +HM  H   + Y+C+ CGK F + +   +H+R H GE+PYEC  C + F   + L VHI  H   R
Sbjct:  297 TREKSYECKECGKTFIQPSRLTEHMRSHTGEKPYQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIR--------THTGEKP--YECKVCGKAFSGRSWLTIHLRKHT-GERPYPCTECEKAFTSFAQLTEHIKTHTGEK--PFRCKVCARTFRNSSCLKTH-FRIHTG---IKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRT-HTGEKP--FECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSER 636          

HSP 3 Score: 92.0485 bits (227), Expect = 3.647e-17
Identity = 50/146 (34.25%), Postives = 76/146 (52.05%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C +C + F    +L  H++ H ++ +      CK C + F       +HM+S+   T  K YQC  C    A   ++  H++ H+ E    C IC K F + SY + H+R HTGEKPY+CK+CG  FS +     HL++H   R
Sbjct:  274 YDCKECGKAFTERSSLIVHLRQHTREKSYE----CKECGKTFIQPSRLTEHMRSH---TGEKPYQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGER 412          

HSP 4 Score: 91.2781 bits (225), Expect = 6.904e-17
Identity = 63/228 (27.63%), Postives = 98/228 (42.98%), Query Frame = 1
Query: 3247 QNDLKCSICEKDFSNSQEIRVHILEEHE---------GCVELYPFS--------------CFMCQEKFLFENELQAHQEVHG--GMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            +  ++CS C + F N  E++ H     E         G    +P S              C  C++ F     L  H + H       C  C K      +  +H  +H R + ++C EC  TF     +  H+R  H   +P  Y+C  CG        ++ H+  H   + ++C  CGK FT+S+Y   H+R H GEKPYEC +C + F+ +S L +H+  H   R
Sbjct:  188 EKSVECSDCGETFVNQLELQTHSSSHREKNIHKSEECGQASTHPISHGGHVIPTEKKYYECKKCEKFFTHPVYLNIHMQSHTVEKPYDCKECGKAFTERSSLIVHLRQHTREKSYECKECGKTFIQPSRLTEHMR-SHTGEKP--YQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGER 412          

HSP 5 Score: 88.9669 bits (219), Expect = 3.138e-16
Identity = 52/152 (34.21%), Postives = 77/152 (50.66%), Query Frame = 1
Query: 5062 NRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            N T +K    Y C +C + F T   L +H++ H  +    +   C HC + F +      H+K +   T  K +QCT+C K     +++  HM+ H+ E    C IC K F   SY   H+R HTGEKPY C+ CG  F++    N HL++H
Sbjct:  687 NHTGEKS---YACQECGKAFSTSSGLIAHIRSHKGE----KPFECDHCGKAFASSSYLNVHLKIH---TGEKPFQCTVCGKTFTCSSYLPVHMRTHTGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLRKH 828          

HSP 6 Score: 84.7297 bits (208), Expect = 6.473e-15
Identity = 121/557 (21.72%), Postives = 193/557 (34.65%), Query Frame = 1
Query: 1990 SIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGV----------SFNARTPLDSKY--DPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRR--TKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDT-------LCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRH 3570
            S + L H + +   +   C  CG+ F   + +  H  +H G   + C + +  FT       H                       I     + P +C  C   F  +  L+ H  I  G+          +F AR+ L        GE      + C  CG  +S    L  H+  H       C  C   L     +  HLR H             K   C+ C+  + T+ +Y       H     P +  E  +   +R   TK +       TG + + CK C       G+ ++        LTV + T        C++C   F     L  H R         I+ G++  + C  C   F    G+  H  +   + +   Y C  C +  +       H+  H + +  F CD C   F + + L +HL+   G K    +C++C K F+ S  + VH +  H G     PF C +C + FL+ + L+ H  +H G     C  C K          H  KH   + ++  EC   F +      H
Sbjct:  370 SSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEH-----------------------IKTHTGEKPFRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKP----YECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHT----------GEKPFECNQCDKTF-TRSSYLRIHMRTH-TGEKPYECKECGKTFPERSCLTKHIR----THTGERPYECKEC-------GKGFISFAQ----LTVHIKTHSSERPFQCKVCTKSFRNSSSLETHFR---------IHTGVKP-YKCSYCGKAFTARSGLTIHLRNHTGEKS---YACQECGKAFSTSSGLIAHIRSH-KGEKPFECDHCGKAFASSSYLNVHLKIHTGEK--PFQCTVCGKTFTCSSYLPVH-MRTHTG---EKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLRKHTGEKPYEYKECGENFTTSADANEH 852          

HSP 7 Score: 83.1889 bits (204), Expect = 1.750e-14
Identity = 58/199 (29.15%), Postives = 83/199 (41.71%), Query Frame = 1
Query: 3334 CVELYPFSCFMCQEKFLFENELQAHQE---------------------VHGGMM--------QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            C       C  C E F+ + ELQ H                        HGG +        +C  C+K         +H   H   + + C EC   F  + ++  H+R    +   + YEC+ CGK   Q   ++ HM  H   + YQC+ CG  F  S+Y   H+R H GEKP+EC+IC + F + S L  HI  H
Sbjct:  185 CTPEKSVECSDCGETFVNQLELQTHSSSHREKNIHKSEECGQASTHPISHGGHVIPTEKKYYECKKCEKFFTHPVYLNIHMQSHTVEKPYDCKECGKAFTERSSLIVHLR---QHTREKSYECKECGKTFIQPSRLTEHMRSHTGEKPYQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTH 380          

HSP 8 Score: 81.2629 bits (199), Expect = 7.169e-14
Identity = 48/146 (32.88%), Postives = 70/146 (47.95%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y C  C + F     L  HV IHN +    +   CK C + F       +H++ +   T  K ++C  C K +A  +    H++ H+ E    C  CDK F + SY   H+R HTGEKPY+CK CG  F ++     H++ H   R
Sbjct:  470 YKCNYCGKAFTARSGLTKHVLIHNGE----KPYECKECGKAFSTSSGLVEHIRIH---TGEKPFECYQCGKALAHSSSLVGHLRTHTGEKPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGER 608          

HSP 9 Score: 80.4925 bits (197), Expect = 1.194e-13
Identity = 54/164 (32.93%), Postives = 80/164 (48.78%), Query Frame = 1
Query: 5026 TENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            T + +I H  S+     K +  + C  C + F +   LN H+KIH    T  +   C  C + F        HM+++   T  K +QC IC K     +++  HM+IH+ E    C+ C K F + S   +HLR HTGEKPY+ K CG  F+   + N+H   H
Sbjct:  705 TSSGLIAHIRSH-----KGEKPFECDHCGKAFASSSYLNVHLKIH----TGEKPFQCTVCGKTFTCSSYLPVHMRTH---TGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLRKHTGEKPYEYKECGENFTTSADANEHETPH 856          

HSP 10 Score: 78.5666 bits (192), Expect = 4.765e-13
Identity = 48/151 (31.79%), Postives = 76/151 (50.33%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            RT+  +K  + C +C++ F      +S+++IH +  T  +   CK C + F  +    KH++++   T  + Y+C  C K     A +  H+K HS E    C++C K F+  S    H R HTG KPYKC  CG  F+ +     HL+ H
Sbjct:  546 RTHTGEK-PFECNQCDKTF----TRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTH---TGERPYECKECGKGFISFAQLTVHIKTHSSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNH 688          

HSP 11 Score: 77.0258 bits (188), Expect = 1.462e-12
Identity = 49/174 (28.16%), Postives = 82/174 (47.13%), Query Frame = 1
Query: 5008 IVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
              ++G+T++ +I + E            Y C +C + F T   L  H++IH    T  +   C  C +   +      H++++   T  K ++C  C K     +++  HM+ H+ E    C+ C K F ++S   +H+R HTGE+PY+CK CG  F        H+K H S R
Sbjct:  480 TARSGLTKHVLIHNGEK----------PYECKECGKAFSTSSGLVEHIRIH----TGEKPFECYQCGKALAHSSSLVGHLRTH---TGEKPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSER 636          

HSP 12 Score: 74.7146 bits (182), Expect = 8.259e-12
Identity = 45/162 (27.78%), Postives = 76/162 (46.91%), Query Frame = 1
Query: 5032 NSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            +S+I+H   + R     +  Y C +C + F     L  H++ H    T  +   C  C   F +      H++++   T  K ++C IC K     +++  H++ H+ E    C++C K F  +S+   HLR HTGE+PY C  C   F+      +H+K H
Sbjct:  287 SSLIVHLRQHTR-----EKSYECKECGKTFIQPSRLTEHMRSH----TGEKPYQCDQCGNAFASSSYLTTHLRTH---TGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIKTH 436          

HSP 13 Score: 71.2478 bits (173), Expect = 7.960e-11
Identity = 46/151 (30.46%), Postives = 70/151 (46.36%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            RT+  +K  + C  C + F     L  H++ H    T  +   CK C + F  +     H++ +   T  + Y CT C+K     A + EH+K H+ E    C++C + F+  S    H R HTG KPYKC  CG  F+ +     H+  H
Sbjct:  350 RTHTGEK-PFECNICGKAFTRSSYLLGHIRTH----TGEKPYECKVCGKAFSGRSWLTIHLRKH---TGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIH 492          

HSP 14 Score: 67.0106 bits (162), Expect = 1.631e-9
Identity = 45/153 (29.41%), Postives = 69/153 (45.10%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            RT+  +K  Y C +C + F     L  H++ H    T      CK C + F +      H+K++   +  + +QC +C K     + +  H +IH+      C  C K F  +S    HLR HTGEK Y C+ CG  FS       H++ H+ 
Sbjct:  574 RTHTGEK-PYECKECGKTFPERSCLTKHIRTH----TGERPYECKECGKGFISFAQLTVHIKTH---SSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSHKG 718          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|Q9NYT6|ZN226_HUMAN (Zinc finger protein 226 OS=Homo sapiens OX=9606 GN=ZNF226 PE=2 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 8.410e-35
Identity = 152/603 (25.21%), Postives = 242/603 (40.13%), Query Frame = 1
Query: 2083 VYDH-EIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDH--LHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGL-TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
             +DH  + H G   ++C++ +  F+D+ S+  H      E+ + C    +         ++    + +  +CD+C   F Q   L+ H  +                     +  + + C  CG  +S+   L  H   H +     C  C    G     + HL+DH  LH  E        K   CD C   +    +   HQ    G    P K +E  +         +++   + TG K + C+ C       G      L    G+ T E   +C +C   F     L  H R   + +GE         + C++C               VH    P  Y+C  C +  +     +IH + H   +  F C+EC   F   + L++H     G K    KC  C K FS   ++++H    H G     P++C  C + F   + L AHQ VH G    +C+ C K        + H+  H   + ++C EC   F+  L +  H RV H   +P  Y+C  CGK  +Q S   +H  +H   + Y+C+ CGK F++S+    H R+H GEKPY+C IC + F+ +SNL VH   H
Sbjct:  238 TFDHNSMIHTGQKSYQCNECKKPFSDLSSFDLHQQLQSGEKSLTCVERGKGFCYSPVLPVHQKVHVGEKLKCDECGKEFSQGAHLQTHQKV--------------------HVIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEEC----GRAFSQASHLQDHQRLHTGE--------KPFKCDACGKSFSRNSHLQSHQRVHTG--EKPYKCEECGKGFICSSNLYIHQR--VHTGEKPYKCEECGK-----GFSRPSSLQAHQGVHTGEKSYICTVCGKGFTLSSNLQAHQR---VHTGE-------KPYKCNECGKSFRRNSHYQVHLVVHTGEKP--YKCEICGKGFSQSSYLQIHQKAHSIEK-PFKCEECGQGFNQSSRLQIHQLIHTGEK--PYKCEECGKGFSRRADLKIHC-RIHTG---EKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRV-HTGEKP--YKCGECGKYFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTVHHRIH 777          

HSP 2 Score: 93.2041 bits (230), Expect = 1.495e-17
Identity = 118/494 (23.89%), Postives = 188/494 (38.06%), Query Frame = 1
Query: 2041 SCVFCGREFKASANVYDHEIRHVGLIRFKC-------------HKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHL--HKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVK---HGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEE---NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG 3426
            +C  CGR F  ++++ DH+  H G   FKC               HQ V T  K YK        CE   +  +  +   ++      + P +C++C   F +   L+ H  +  G                     + +IC +CG  ++    L +H   H       CN C    G     + H + HL  H  E        K   C+IC   +        HQ  +   +  P K +E  +   +    ++++L  + TG K + C+ C       G+ + +  D+K      T E    C  C  +F     L  H R   + SGE         F C++C   FG    + AH   VH    P  Y+C  C +       W ++L+ H+     +  + C EC  YF   ++L+LH     G K    KC +C K FS S ++    RVH  E+        P+ C +C + F + + L  H  +H G
Sbjct:  364 NCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYK--------CEECGKGFICSSNLYIHQRVHTGEKPYKCEECGKGFSRPSSLQAHQGVHTG--------------------EKSYICTVCGKGFTLSSNLQAHQRVHTGEKPYKCNEC----GKSFRRNSHYQVHLVVHTGE--------KPYKCEICGKGFSQSSYLQIHQ--KAHSIEKPFKCEECGQGFNQSSRLQIHQL--IHTGEKPYKCEEC-------GKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQR---VHSGE-------KPFKCEECGKSFGRSAHLQAHQ-KVHTGDKP--YKCDECGKGFK----WSLNLDMHQRVHTGEKPYKCGECGKYFSQASSLQLHQSVHTGEK--PYKCDVCGKVFSRSSQLQSHQRVHTGEK--------PYKCEICGKSFSWRSNLTVHHRIHVG 779          

HSP 3 Score: 78.5666 bits (192), Expect = 4.625e-13
Identity = 54/168 (32.14%), Postives = 81/168 (48.21%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH---ESYRDDFG--NYLQIKQRGKPIK 5568
            + C +C + FG   +L +H K+H  D    +   C  C + F+  +    H + +   T  K Y+C  C K     + +  H  +H+ E    C++C K F + S    H R HTGEKPYKC+ICG  FS + N   H + H   +SY+ + G  N  +  Q  K IK
Sbjct:  643 FKCEECGKSFGRSAHLQAHQKVHTGD----KPYKCDECGKGFKWSLNLDMHQRVH---TGEKPYKCGECGKYFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTVHHRIHVGDKSYKSNRGGKNIRESTQEKKSIK 803          

HSP 4 Score: 78.1814 bits (191), Expect = 6.176e-13
Identity = 61/199 (30.65%), Postives = 90/199 (45.23%), Query Frame = 1
Query: 5005 DIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIKKVFNTEK 5589
            D      + NS   H +S+ R +  +K  Y C +C + F    NL  H ++H    T  +   C+ C + F        H   +   T  K Y CT+C K   + + +  H ++H+ E    C  C K F++ S+Y  HL  HTGEKPYKC+ICG  FS+                   +YLQI Q+   I+K F  E+
Sbjct:  394 DACGKSFSRNS---HLQSHQRVHTGEK-PYKCEECGKGFICSSNLYIHQRVH----TGEKPYKCEECGKGFSRPSSLQAHQGVH---TGEKSYICTVCGKGFTLSSNLQAHQRVHTGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKPYKCEICGKGFSQ------------------SSYLQIHQKAHSIEKPFKCEE 563          

HSP 5 Score: 68.5514 bits (166), Expect = 4.919e-10
Identity = 40/127 (31.50%), Postives = 61/127 (48.03%), Query Frame = 1
Query: 5098 CVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEF 5466
            C +C + F    +L +H K+H     + +   CK C + F  +     H K +   T  K Y C  C +     + + +H ++H+ E    C+ C K F + S+   H R HTGEKPYKC+ CG  F
Sbjct:  309 CDECGKEFSQGAHLQTHQKVH----VIEKPYKCKQCGKGFSRRSALNVHCKVH---TAEKPYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYKCEECGKGF 428          

HSP 6 Score: 67.781 bits (164), Expect = 8.914e-10
Identity = 56/187 (29.95%), Postives = 83/187 (44.39%), Query Frame = 1
Query: 5029 ENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHN--KDLT---------------------VNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIH-SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            +N  IL  + N+  +  QK  Y C +C + F  L + + H ++ +  K LT                     V EK+ C  C + F        H K +      K Y+C  C K  +    +N H K+H +E    CE C + F + S+  +H R HTGEKP+KC  CG  FS+    N HL+ H+
Sbjct:  232 DNMKILTFDHNSMIHTGQK-SYQCNECKKPFSDLSSFDLHQQLQSGEKSLTCVERGKGFCYSPVLPVHQKVHVGEKLKCDECGKEFSQGAHLQTHQKVH---VIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEECGRAFSQASHLQDHQRLHTGEKPFKCDACGKSFSR----NSHLQSHQ 410          

HSP 7 Score: 65.855 bits (159), Expect = 4.075e-9
Identity = 45/142 (31.69%), Postives = 68/142 (47.89%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C  C + F    + +S+++IH K  ++ +   C+ C Q F        H   +   T  K Y+C  C K     A +  H +IH+ E    CE C K F++ S  + H R H+GEKP+KC+ CG  F +  +   H K H
Sbjct:  531 YKCEICGKGF----SQSSYLQIHQKAHSIEKPFKCEECGQGFNQSSRLQIHQLIH---TGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSAHLQAHQKVH 665          

HSP 8 Score: 56.9954 bits (136), Expect = 1.997e-6
Identity = 40/132 (30.30%), Postives = 59/132 (44.70%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSK 5472
            Y C +C + F    +L +H  +H    T  +   C  C + F        H + +   T  K Y+C  C K     N H ++H      E    CEIC K F + SY   H + H+ EKP+KC+ CG  F++
Sbjct:  447 YKCEECGKGFSRPSSLQAHQGVH----TGEKSYICTVCGKGFTLSSNLQAHQRVH---TGEKPYKCNECGKSFR-RNSHYQVHLVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKPFKCEECGQGFNQ 570          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|Q96IR2|ZN845_HUMAN (Zinc finger protein 845 OS=Homo sapiens OX=9606 GN=ZNF845 PE=1 SV=3)

HSP 1 Score: 139.428 bits (350), Expect = 9.585e-32
Identity = 164/650 (25.23%), Postives = 257/650 (39.54%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADIL----RLHL-------DICD-GVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYK--RRTKRMNELSYMA------TGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSN----SQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H+KI+   +   C  C R F   +++  H   H G   +KC+     F+ M S   H      E+   CE   E    ++    +      + P +C+ C   F Q   L    RLH        + CD   SF +          GE L    + C  CG  +S+   L  H   H       CN C         +  H        + + G GK  +  C+ C+  +        H W  H           + E  YK  R  K     SY+A      +G K + C+ C+        +  +H  +  G   E    C  C   F     L+ H R   + +GE         + C++C   FG    ++ H  ++H    P  Y+C  C +  + +     HL  H   +  + C+EC   F  +++L+ H     G K    KC +C+K F      +Q  R+H  E+        P+ C  C + F   + L  H+ +H G    +C+ C K  +   A E+H+  H   + ++C+EC   F  K  + RH R+ H   +P  Y+C  CGK+  Q   ++ H  IH   + Y+C  CGK F  ++    H  IH GEKPY+C+ C + FN+K+ L  H   H
Sbjct:  373 HRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQTSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRIIHTGEKL----YKCNECGKTFSRKSSLTRHCRLHTGEKPYQCNECGKAFRGQSALIYH--------QAIHGIGK--LYKCNDCHQVFSNATTIANH-WRIH-----------NEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKS-NLQRHRRIHTG---EKPYRCNECGKTFSRKSYLTCHRR---LHTGE-------KPYKCNECGKTFGRNSALIIHK-AIHTGEKP--YKCNECGKAFSQKSSLTCHLRLHT-GEKPYKCEECDKVFSRKSSLEKHRRIHTGEK--PYKCKVCDKAFGRDSHLAQHTRIHTGEK--------PYKCNECGKNFRHNSALVIHKAIHSGEKPYKCNECGKTFRHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRL-HTGEKP--YKCNKCGKVFNQQAHLACHHRIHTGEKPYKCNECGKTFRHNSVLVIHKTIHTGEKPYKCNECGKVFNRKAKLARHHRIH 965          

HSP 2 Score: 131.724 bits (330), Expect = 2.300e-29
Identity = 172/732 (23.50%), Postives = 294/732 (40.16%), Query Frame = 1
Query: 1753 AKINPQIDKRNSIQTLYLAPNGMSTTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADIL----RLHL-------DICD-GVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVA--HSTSVHADSNPCLYECPHCPERMADRRL----WRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
             KI  Q++K  +  +L      +S   +   ++   N ++++SL         +E+   F    + K F+       + S+ R  HQ I+   +   C  CG+ F     +  H   H G   +KC+     F+   +   HH     E+   C    +T    +  +++ +    +   +C++C   F Q   L    RLH        + CD   SF +      K   GE      + C  C   +S+   L  H   H       CN C      +  +  H R  LH  E        K   C+ C++ +  K N   H+    G    P K ++  +     +T  +     + TG K + C+ C+        +  +H  +  G   E    C  C   F     L+ H R   + +GE         + C++C     FRG  A  +  ++H      LY+C  C +  ++       WRIH E     + ++ C+ C  +F++ + L +H  T  G K    KC  C++ FS    +    R+H  E+        P+ C  C + F  ++ L  H+ +H G    +C+ C K      A  +H+  H   + ++C EC   F  K ++  H+R+ H   +P  Y+C+ C K+ ++ S    H  IH   + Y+C+ C K F + ++  +H RIH GEKPY+C+ C + F   S L +H   H
Sbjct:  158 GKIGNQVEKSINSASLVSTSQRISCRPKTHISKNYGNNFLNSSLLTQKQEVHMREK--SFQCNESGKAFN-------YSSVLRK-HQIIHLGAKQYKCDVCGKVFNQKRYLACHRRCHTGKKPYKCNDCGKTFSQELTLTCHHRLHTGEKHYKCSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEECDKAFSFKSNLERHRKIHTGEKP----YKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRR--LHTGE--------KPYKCEECDEAFSFKSNLERHRRIHTG--EKPYKCNDCGKTF--SQTSSLVYHRRLHTGEKPYKCEECDEAFSFKS-NLERHRIIHTG---EKLYKCNECGKTFSRKSSLTRHCR---LHTGE-------KPYQCNECGKA--FRGQSALIYHQAIHGIGK--LYKCNDCHQVFSNATTIANHWRIHNE-----ERSYKCNRCGKFFRHRSYLAVHWRTHSGEK--PYKCEECDEAFSFKSNLQRHRRIHTGEK--------PYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGRNSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRL-HTGEKP--YKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIHTGEKPYKCNECGKNFRHNSALVIHKAIH 825          

HSP 3 Score: 115.546 bits (288), Expect = 2.276e-24
Identity = 147/671 (21.91%), Postives = 244/671 (36.36%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALT--------SECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDE------------------SAEPLYK--------RRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINA------------------GIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H +++   +   C  CG+ F  ++ +  H+  H G   +KC++    F+   SY  +H                    L+       C +CDK + +      L  H  I  G            +    +LT         + + C  CG  +S++  L  H   H       C  C         + +H R  +H  E        K   C+ C   +    +  YH+    G    P K +E                  + E LYK         R   +     + TG K + C  C    +  G+  + +    HG+       C  C  +F     +++H R ++ +     N                     +  + C++C     F+  +     +H    P  Y C  C +  + +     H   H   +  + C+EC   F   +AL +H     G K    KC+ C K FS    +  H L  H G     P+ C  C + F  ++ L+ H+ +H G    +C +C K          H   H   + ++C EC   FR   A+  H  + H   +P  Y+C  CGK     + + +H  IH   + Y+C  CGK F + A  + H R+H GEKPY+C+ C + FN++++L  H   H
Sbjct:  289 HHRLHTGEKHYKCSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQT-SYLVYHRR------------------LHTGEKPYKCEECDKAFSF---KSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRR--IHTGE--------KPYKCNDCGKTFSQTSSLVYHRRLHTG--EKPYKCEECDEAFSFKSNLERHRIIHTGEKLYKCNECGKTFSRKSSLTRHCRLHTGEKPYQCNECGKAFR--GQSALIYHQAIHGIGKLYK--CNDCHQVFSNATTIANHWRIHNEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKSNLQRHRRIHTGEKP--YRCNECGKTFSRKSYLTCHRRLHT-GEKPYKCNECGKTFGRNSALIIHKAIHTGEK--PYKCNECGKAFSQKSSLTCH-LRLHTG---EKPYKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIHTGEKPYKCNECGKNFRHNSALVIHKAI-HSGEKP--YKCNECGKTFRHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLHTGEKPYKCNKCGKVFNQQAHLACHHRIH 909          

HSP 4 Score: 93.5893 bits (231), Expect = 1.350e-17
Identity = 100/393 (25.45%), Postives = 164/393 (41.73%), Query Frame = 1
Query: 2734 KRMNELSYMA------TGMKKFSCKFCNAEVKVAGRDYVKHLDVK--HGL-TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEE---NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRD 3846
            K  N+  Y+A      TG K + C  C       G+ + + L +   H L T E    C  C   F     L  H         + I+ G +S + C++C         + +   +H    P  Y+C  C +  +    ++ +LE+H +    +  + C+EC   F  +++L  H     G K    KC+ C K FS    +    R+H  E+        P+ C  C E F F++ L+ H+ +H G    +C+ C K      +   HR  H   + ++C EC   F  K  + RH R+ H     + Y+C  CGK  ++   ++ H  +H   + YQC  CGK F   +    H  IH   K Y+C+ C + F+  + +  H   H + R 
Sbjct:  250 KVFNQKRYLACHRRCHTGKKPYKCNDC-------GKTFSQELTLTCHHRLHTGEKHYKCSECGKTFSRNSALVIH---------KAIHTGEKS-YKCNECGKTFSQTSYLVYHRRLHTGEKP--YKCEECDKAFS----FKSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEK--PYKCNDCGKTFSQMSSLVYHRRLHTGEK--------PYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQTSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERH-RIIHTG--EKLYKCNECGKTFSRKSSLTRHCRLHTGEKPYQCNECGKAFRGQSALIYHQAIHGIGKLYKCNDCHQVFSNATTIANHWRIHNEERS 606          

HSP 5 Score: 78.1814 bits (191), Expect = 6.866e-13
Identity = 44/131 (33.59%), Postives = 68/131 (51.91%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSK 5472
            Y C  C++VF     + +H +IHN++ +      C  C + F+++   A H +++   +  K Y+C  C +  +F   +  H +IH+ E    C  C K F +KSY   H R HTGEKPYKC  CG  F +
Sbjct:  579 YKCNDCHQVFSNATTIANHWRIHNEERSYK----CNRCGKFFRHRSYLAVHWRTH---SGEKPYKCEECDEAFSFKSNLQRHRRIHTGEKPYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGR 702          

HSP 6 Score: 74.3294 bits (181), Expect = 9.569e-12
Identity = 46/129 (35.66%), Postives = 65/129 (50.39%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEF 5466
            Y C +C + FG     NS + IH    T  +   C  C + F  K     H++ +   T  K Y+C  C KV +    + +H +IH+ E    C++CDK F + S+  +H R HTGEKPYKC  CG  F
Sbjct:  691 YKCNECGKTFGR----NSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRLH---TGEKPYKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIHTGEKPYKCNECGKNF 812          

HSP 7 Score: 74.3294 bits (181), Expect = 1.077e-11
Identity = 48/131 (36.64%), Postives = 65/131 (49.62%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSK 5472
            Y C +C++ F    NL  H KIH    T  +   C  CS+ F  K    +H + +   T  K Y+C  C K  + ++    H ++H+ E    CE CD+ F  KS    H R HTGEKPYKC  CG  FS+
Sbjct:  355 YKCEECDKAFSFKSNLERHRKIH----TGEKPYKCNECSRTFSRKSSLTRHRRLH---TGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIHTGEKPYKCNDCGKTFSQ 478          

HSP 8 Score: 70.8626 bits (172), Expect = 1.214e-10
Identity = 51/143 (35.66%), Postives = 67/143 (46.85%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            +Y C  C +VF   R L  H + H    T  +   C  C + F  ++    H + +   T  K Y+C+ C K  +  +    H  IH+ E S  C  C K F + SY V H R HTGEKPYKC+ C   FS K N   H K H
Sbjct:  242 QYKCDVCGKVFNQKRYLACHRRCH----TGKKPYKCNDCGKTFSQELTLTCHHRLH---TGEKHYKCSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEECDKAFSFKSNLERHRKIH 377          

HSP 9 Score: 70.0922 bits (170), Expect = 1.967e-10
Identity = 50/138 (36.23%), Postives = 68/138 (49.28%), Query Frame = 1
Query: 5104 KCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            KCNE   T R+ NS ++IH    T  +   C  C ++F  K   ++H + +   T  K Y+C  C KV    A +  H +IH+ E    C  C K F+  S  V H   HTGEKPYKC  CG  F++K     H + H
Sbjct:  832 KCNECGKTFRH-NSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLH---TGEKPYKCNKCGKVFNQQAHLACHHRIHTGEKPYKCNECGKTFRHNSVLVIHKTIHTGEKPYKCNECGKVFNRKAKLARHHRIH 965          

HSP 10 Score: 69.3218 bits (168), Expect = 3.439e-10
Identity = 57/192 (29.69%), Postives = 88/192 (45.83%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSEP-SIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH---ESYR-DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTSDYPDLELI 5643
            Y C +C + F    +L  H ++H    T  +   C  C + F+ +     H ++ H +   K Y+C  C +V +    I  H +IH+E  S  C  C K F+ +SY   H R H+GEKPYKC+ C   FS K N   H + H   + YR ++ G     K      +++   EK     +CG +   +  LI
Sbjct:  523 YKCNECGKTFSRKSSLTRHCRLH----TGEKPYQCNECGKAFRGQSALIYH-QAIHGIG--KLYKCNDCHQVFSNATTIANHWRIHNEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKSNLQRHRRIHTGEKPYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGRNSALI 707          

HSP 11 Score: 67.781 bits (164), Expect = 1.097e-9
Identity = 47/142 (33.10%), Postives = 67/142 (47.18%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C + F     L  H ++H    T  +   C  C + F        H K+ H  T  K Y+C  C K  +    +  H+++H+ E    CE CDK F +KS   +H R HTGEKPYKCK+C   F +  +   H + H
Sbjct:  663 YRCNECGKTFSRKSYLTCHRRLH----TGEKPYKCNECGKTFGRNSALIIH-KAIH--TGEKPYKCNECGKAFSQKSSLTCHLRLHTGEKPYKCEECDKVFSRKSSLEKHRRIHTGEKPYKCKVCDKAFGRDSHLAQHTRIH 797          

HSP 12 Score: 65.855 bits (159), Expect = 3.618e-9
Identity = 48/145 (33.10%), Postives = 65/145 (44.83%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            K  Y C  C + F     L  H ++H    T  +   C  C + F        H K+ H  T  K Y+C  C K     +++  H ++H+ E    CE CDK F  KS    H + HTGEKPYKC  C   FS+K +   H + H
Sbjct:  268 KKPYKCNDCGKTFSQELTLTCHHRLH----TGEKHYKCSECGKTFSRNSALVIH-KAIH--TGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEECDKAFSFKSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLH 405          

HSP 13 Score: 65.4698 bits (158), Expect = 4.664e-9
Identity = 49/142 (34.51%), Postives = 67/142 (47.18%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C++VF    +L  H +IH    T  +   CK C + F      A+H + +   T  K Y+C  C K     + +  H  IHS E    C  C K F+  S    H   HTGEKPYKC  CG  F++K N + H + H
Sbjct:  747 YKCEECDKVFSRKSSLEKHRRIH----TGEKPYKCKVCDKAFGRDSHLAQHTRIH---TGEKPYKCNECGKNFRHNSALVIHKAIHSGEKPYKCNECGKTFRHNSALEIHKAIHTGEKPYKCSECGKVFNRKANLSRHHRLH 881          

HSP 14 Score: 64.3142 bits (155), Expect = 1.042e-8
Identity = 46/142 (32.39%), Postives = 65/142 (45.77%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C + F     L  H ++H    T  +   C+ C + F  K    +H K +   T  K Y+C  C +     + +  H ++H+ E    C  C K F + S  V H R HTGEKPYKC+ C   FS K N   H + H
Sbjct:  327 YKCNECGKTFSQTSYLVYHRRLH----TGEKPYKCEECDKAFSFKSNLERHRKIH---TGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTFSQMSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRRIH 461          

HSP 15 Score: 62.7734 bits (151), Expect = 3.708e-8
Identity = 45/142 (31.69%), Postives = 66/142 (46.48%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C  C + F  + +L  H ++H    T  +   C+ C + F  K    +H + +   T  K Y+C  C K  +  +    H ++H+ E    CE CD+ F  KS    H   HTGEK YKC  CG  FS+K +   H + H
Sbjct:  411 YKCNDCGKTFSQMSSLVYHRRLH----TGEKPYKCEECDEAFSFKSNLERHRRIH---TGEKPYKCNDCGKTFSQTSSLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRIIHTGEKLYKCNECGKTFSRKSSLTRHCRLH 545          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|Q08AN1|ZN616_HUMAN (Zinc finger protein 616 OS=Homo sapiens OX=9606 GN=ZNF616 PE=2 SV=2)

HSP 1 Score: 136.732 bits (343), Expect = 4.817e-31
Identity = 127/487 (26.08%), Postives = 203/487 (41.68%), Query Frame = 1
Query: 2416 FICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTV---ELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            ++C  CG  +     L +H   H +     CN C         ++ H   H           + K   CD+C   +     +  HQ +  G    P   +E  +   K  +  +     + TG K + C  C       G+ + + + ++   TV   E    C  C   F+    L+ H         + I+AG +  + CD C   F H   +V H   +H+      Y+C  C +  + R    +H   H   +    C+EC   F   ++L +H     G  Q   KC+ C K +S    + VH    H G      + C  C + F   + L AHQ +H G    +C+ C KV        +HR  H   + ++C EC   F  + A  RH R+ H   +P  Y+C+ CGK+ +Q   +++H  IH   + Y+C  CGK +++ ++   H R+H GEKPY+CH C + FN+ S LN H   H
Sbjct:  185 YVCNECGKAFKASSSLINHQRIHTTEKPYKCNECGKAFHRASLLTVHKVVHT----------RGKSYQCDVCGKIFRKNSYFVRHQRSHTG--QKPYICNECGKSFSK--SSHLAVHQRIHTGEKPYKCNLC-------GKSFSQRVHLRLHQTVHTGERPFKCNECGKTFKRSSNLTVH---------QVIHAG-KKPYKCDVCGKAFRHRSNLVCHR-RIHSGEKQ--YKCNECGKVFSKRSSLAVHRRIHTVEKPC-KCNECGKVFSKRSSLAVHQRIHTG--QKTYKCNKCGKVYSKHSHLAVH-WRIHTG---EKAYKCNECGKVFSIHSRLAAHQRIHTGEKPYKCNECGKVFSQHSRLAVHRRIHTGEKPYKCKECGKVFSDRSAFARHRRI-HTGEKP--YKCKECGKVFSQCSRLTVHRRIHSGEKPYKCNECGKVYSQYSHLVGHRRVHTGEKPYKCHECGKAFNQGSTLNRHQRIH 627          

HSP 2 Score: 130.183 bits (326), Expect = 4.631e-29
Identity = 165/638 (25.86%), Postives = 258/638 (40.44%), Query Frame = 1
Query: 2044 CVFCGREFKASANVYDHEIRHVGLIRFKCHK-------------HQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQ-CDKCYDYFPQADILRLHLDI--------CD--GVSFNART--PLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKH--LDVKHGL-TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC--TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKN-ARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVH 3819
            C  CG+ FKAS+++ +H+  H     +KC++             H++V T  KSY+        C+   +   + +  + +  +     P  C++C   F ++  L +H  I        C+  G SF+ R    L      GE      F C  CG  + +   L  H   H       C+VC         +  H R H       SG  + K   C+ C   +  + +   H+      V  P K +E  +   KR +  +++   + TG K + C  C       G+ Y KH  L V   + T E    C  C  +F    RL+ H R   I +GE         + C++C   F  H R  +A    +H    P  Y+C  C +  +DR  +  H   H   +  + C EC   F   + L +H     G K    KC+ C K +S    +    RVH  E+        P+ C  C + F   + L  HQ +H G    +C+ C           LH+  H   R ++C EC  TF+    +  H ++ H   +P  Y+C  CGK+    + +  H  IH    RY+C  CGK F +    ++H RIH G+KPY+C+ C + F  +S L  H
Sbjct:  187 CNECGKAFKASSSLINHQRIHTTEKPYKCNECGKAFHRASLLTVHKVVHTRGKSYQ--------CDVCGKIFRKNSYFVRHQRSHTGQKPYICNECGKSFSKSSHLAVHQRIHTGEKPYKCNLCGKSFSQRVHLRLHQTVHTGERP----FKCNECGKTFKRSSNLTVHQVIHAGKKPYKCDVCGKAFRHRSNLVCHRRIH-------SGEKQYK---CNECGKVFSKRSSLAVHRRIH--TVEKPCKCNECGKVFSKRSSLAVHQR--IHTGQKTYKCNKC-------GKVYSKHSHLAVHWRIHTGEKAYKCNECGKVFSIHSRLAAHQR---IHTGE-------KPYKCNECGKVFSQHSR--LAVHRRIHTGEKP--YKCKECGKVFSDRSAFARHRRIHT-GEKPYKCKECGKVFSQCSRLTVHRRIHSGEK--PYKCNECGKVYSQYSHLVGHRRVHTGEK--------PYKCHECGKAFNQGSTLNRHQRIHTGEKPYKCNQCGNSFSQRVHLRLHQTVHTGDRPYKCNECGKTFKRSSNLTAH-QIIHAGKKP--YKCDECGKVFRHSSHLVSHQRIHTGEKRYKCIECGKAFGRLFSLSKHQRIHSGKKPYKCNECGKSFICRSGLTKH 763          

HSP 3 Score: 127.487 bits (319), Expect = 3.166e-28
Identity = 129/493 (26.17%), Postives = 199/493 (40.37%), Query Frame = 1
Query: 2404 TSECFICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFR--SKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            T + + C  CG  + +  +L  H   H       C+VC           +H R H            +K  IC+ C   +    +   HQ    G    P K +   +   +R   R+++   + TG + F C  C    K +    V H  +  G   +    C +C   F     L  H R   I SGE         + C++C      R  +A    +H    PC  +C  C +  + R    +H   H   Q T+ C++C   +   + L +H     G K    KC+ C K FS    +    R+H  E+        P+ C  C + F   + L  H+ +H G    +C  C KV     A+  HR  H   + ++C EC   F   S+L + R I   H   +P  Y+C  CGK+ +Q S    H  +H   + Y+C  CGK F + +  N H RIH GEKPY+C+ C   F+++ +L +H   H
Sbjct:  209 TEKPYKCNECGKAFHRASLLTVHKVVHTRGKSYQCDVCGKIFRKNSYFVRHQRSHT----------GQKPYICNECGKSFSKSSHLAVHQRIHTG--EKPYKCNLCGKSFSQRVHLRLHQT--VHTGERPFKCNECGKTFKRSSNLTV-HQVIHAG---KKPYKCDVCGKAFRHRSNLVCHRR---IHSGE-------KQYKCNECGKVFSKRSSLAVHRRIHTVEKPC--KCNECGKVFSKRSSLAVHQRIHT-GQKTYKCNKCGKVYSKHSHLAVHWRIHTGEK--AYKCNECGKVFSIHSRLAAHQRIHTGEK--------PYKCNECGKVFSQHSRLAVHRRIHTGEKPYKCKECGKVFSDRSAFARHRRIHTGEKPYKCKECGKVFSQCSRLTVHRRI---HSGEKP--YKCNECGKVYSQYSHLVGHRRVHTGEKPYKCHECGKAFNQGSTLNRHQRIHTGEKPYKCNQCGNSFSQRVHLRLHQTVH 655          

HSP 4 Score: 79.7221 bits (195), Expect = 2.294e-13
Identity = 51/142 (35.92%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C +VF     L  H +IH    T  +   CK C ++F ++  FA+H + +   T  K Y+C  C KV    + +  H +IHS E    C  C K + + S+ V H R HTGEKPYKC  CG  F++    N H + H
Sbjct:  493 YKCNECGKVFSQHSRLAVHRRIH----TGEKPYKCKECGKVFSDRSAFARHRRIH---TGEKPYKCKECGKVFSQCSRLTVHRRIHSGEKPYKCNECGKVYSQYSHLVGHRRVHTGEKPYKCHECGKAFNQGSTLNRHQRIH 627          

HSP 5 Score: 77.7962 bits (190), Expect = 7.949e-13
Identity = 43/116 (37.07%), Postives = 66/116 (56.90%), Query Frame = 1
Query: 3496 HFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H R + + C EC   F++  ++  H R+ H   +P  Y+C  CGK   + S+   H ++H   + YQC+ CGK F K++Y+  H R H G+KPY C+ C + F+K S+L VH   H
Sbjct:  179 HIREKTYVCNECGKAFKASSSLINHQRI-HTTEKP--YKCNECGKAFHRASLLTVHKVVHTRGKSYQCDVCGKIFRKNSYFVRHQRSHTGQKPYICNECGKSFSKSSHLAVHQRIH 291          

HSP 6 Score: 73.1738 bits (178), Expect = 2.015e-11
Identity = 51/147 (34.69%), Postives = 70/147 (47.62%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS--EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y C +C + F    +L +H +IH    T  +   C  C + F    L   H K  H  T  K YQC +C K+    ++   H + H+  +P I C  C K F K S+   H R HTGEKPYKC +CG  FS++ +   H   H   R
Sbjct:  185 YVCNECGKAFKASSSLINHQRIH----TTEKPYKCNECGKAFHRASLLTVH-KVVH--TRGKSYQCDVCGKIFRKNSYFVRHQRSHTGQKPYI-CNECGKSFSKSSHLAVHQRIHTGEKPYKCNLCGKSFSQRVHLRLHQTVHTGER 323          

HSP 7 Score: 72.4034 bits (176), Expect = 3.532e-11
Identity = 45/140 (32.14%), Postives = 71/140 (50.71%), Query Frame = 1
Query: 3436 CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            C+ C K  K+  +   H+  H   + ++C EC   F     +  H  V   +   + Y+C +CGKI  + S    H   H   + Y C  CGK F+KS++   H RIH GEKPY+C++C + F+++ +L +H   H   R
Sbjct:  187 CNECGKAFKASSSLINHQRIHTTEKPYKCNECGKAFHRASLLTVHKVV---HTRGKSYQCDVCGKIFRKNSYFVRHQRSHTGQKPYICNECGKSFSKSSHLAVHQRIHTGEKPYKCNLCGKSFSQRVHLRLHQTVHTGER 323          

HSP 8 Score: 72.4034 bits (176), Expect = 3.878e-11
Identity = 47/131 (35.88%), Postives = 65/131 (49.62%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSK 5472
            Y C KC +V+    +L  H +IH    T  +   C  C ++F      A H + +   T  K Y+C  C KV +    +  H +IH+ E    C+ C K F  +S +  H R HTGEKPYKCK CG  FS+
Sbjct:  437 YKCNKCGKVYSKHSHLAVHWRIH----TGEKAYKCNECGKVFSIHSRLAAHQRIH---TGEKPYKCNECGKVFSQHSRLAVHRRIHTGEKPYKCKECGKVFSDRSAFARHRRIHTGEKPYKCKECGKVFSQ 560          

HSP 9 Score: 67.781 bits (164), Expect = 8.272e-10
Identity = 60/212 (28.30%), Postives = 92/212 (43.40%), Query Frame = 1
Query: 4915 RKIDEEFSDLDQEWS-----------IEESDMEHSMWNISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            R+I +   DL+ +W              E+++       S+  V+N   EN +  + ES     +K + E    +CNE   T  N    V  H ++ T      C  C + F+       H + +   T  K Y+C  C K     + +  H  +H+   S  C++C K F+K SY+V H R HTG+KPY C  CG  FSK  +   H + H
Sbjct:   88 REIQKHLHDLEFQWKDGETNDKEVPVPHENNLTGKRDQHSQGDVENNHIENQLTSNFESRLAELQKVQTEGRLYECNETEKTGNN-GCLVSPHIREKT----YVCNECGKAFKASSSLINHQRIH---TTEKPYKCNECGKAFHRASLLTVHKVVHTRGKSYQCDVCGKIFRKNSYFVRHQRSHTGQKPYICNECGKSFSKSSHLAVHQRIH 291          

HSP 10 Score: 63.5438 bits (153), Expect = 1.688e-8
Identity = 111/516 (21.51%), Postives = 176/516 (34.11%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKC--------HK-----HQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVEL--------------------YPFSCFMCQEKFLFENELQAHQEVHGG 3426
            HQ ++   R   C  CG+ FK S+N+  H++ H G   +KC        H+     H+ + +  K YK        C    +   +++   ++      + P +C++C   F +   L +H  I  G                     + + C  CG  YSK   L  H   H       CN C         ++ H R  +H  E        K   C+ C   +        H+    G    P K  E  +    R          + TG K + CK C        R  V H  +  G   E    C  C  ++     L  H R   + +GE         + C +C    +    +     +H    P  Y+C  C    + R   R+H   H  ++  + C+EC   FK  + L  H +  H  K+   KC  C K F +S  +    R+H  E+   C+E                      P+ C  C + F+  + L  H+  H G
Sbjct:  315 HQTVHTGERPFKCNECGKTFKRSSNLTVHQVIHAGKKPYKCDVCGKAFRHRSNLVCHRRIHSGEKQYK--------CNECGKVFSKRSSLAVHRRIHTVEKPCKCNECGKVFSKRSSLAVHQRIHTG--------------------QKTYKCNKCGKVYSKHSHLAVHWRIHTGEKAYKCNECGKVFSIHSRLAAHQR--IHTGE--------KPYKCNECGKVFSQHSRLAVHRRIHTG--EKPYKCKECGKVFSDRSA--FARHRRIHTGEKPYKCKECGKVFSQCSRLTV-HRRIHSG---EKPYKCNECGKVYSQYSHLVGHRR---VHTGE-------KPYKCHECGKAFNQGSTLNRHQRIHTGEKP--YKCNQCGNSFSQRVHLRLHQTVHTGDR-PYKCNECGKTFKRSSNLTAH-QIIHAGKK-PYKCDECGKVFRHSSHLVSHQRIHTGEKRYKCIECGKAFGRLFSLSKHQRIHSGKKPYKCNECGKSFICRSGLTKHRIRHTG 769          

HSP 11 Score: 63.1586 bits (152), Expect = 2.431e-8
Identity = 43/144 (29.86%), Postives = 64/144 (44.44%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            Y C +C + F     LN H +IH    T  +   C  C   F  ++    H   +   T  + Y+C  C K     + +  H  IH+ +    C+ C K F+  S+ V H R HTGEK YKC  CG  F + ++ + H + H  
Sbjct:  605 YKCHECGKAFNQGSTLNRHQRIH----TGEKPYKCNQCGNSFSQRVHLRLHQTVH---TGDRPYKCNECGKTFKRSSNLTAHQIIHAGKKPYKCDECGKVFRHSSHLVSHQRIHTGEKRYKCIECGKAFGRLFSLSKHQRIHSG 741          

HSP 12 Score: 60.8474 bits (146), Expect = 1.150e-7
Identity = 51/182 (28.02%), Postives = 82/182 (45.05%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH---ESYR-DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            + C +C + F    NL  H  IH       +   C  C + F+++     H + +   +  K+Y+C  C KV +    +  H +IH+ E    C  C K F K+S    H R HTG+K YKC  CG  +SK  +   H + H   ++Y+ ++ G    I  R    +++   EK     +CG
Sbjct:  325 FKCNECGKTFKRSSNLTVHQVIH----AGKKPYKCDVCGKAFRHRSNLVCHRRIH---SGEKQYKCNECGKVFSKRSSLAVHRRIHTVEKPCKCNECGKVFSKRSSLAVHQRIHTGQKTYKCNKCGKVYSKHSHLAVHWRIHTGEKAYKCNECGKVFSIHSRLAAHQRIHTGEKPYKCNECG 499          

HSP 13 Score: 58.151 bits (139), Expect = 8.099e-7
Identity = 48/195 (24.62%), Postives = 85/195 (43.59%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGT--SDYPDLELIW 5646
            Y C +C + F      +SH+ +H +  T  +   C  C + F  ++    H   +   T  + ++C  C K     + +  H  IH+ +    C++C K F+ +S  V H R H+GEK YKC  CG  FSK+ +   H + H   +    ++ G     +      +++   +K     +CG   S +  L + W
Sbjct:  269 YICNECGKSFSK----SSHLAVHQRIHTGEKPYKCNLCGKSFSQRVHLRLHQTVH---TGERPFKCNECGKTFKRSSNLTVHQVIHAGKKPYKCDVCGKAFRHRSNLVCHRRIHSGEKQYKCNECGKVFSKRSSLAVHRRIHTVEKPCKCNECGKVFSKRSSLAVHQRIHTGQKTYKCNKCGKVYSKHSHLAVHW 456          
BLAST of Zinc finger protein vs. UniProt/SwissProt
Match: sp|Q14588|ZN234_HUMAN (Zinc finger protein 234 OS=Homo sapiens OX=9606 GN=ZNF234 PE=2 SV=3)

HSP 1 Score: 134.806 bits (338), Expect = 1.068e-30
Identity = 168/676 (24.85%), Postives = 272/676 (40.24%), Query Frame = 1
Query: 1879 SLFENIPYCKRQEQIDDFLNEIADKIF-DLPLQISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADI-LRLHL-------DICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHP---PIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTS--VHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            S  E +P   R E++  +  +I  +I  DL        SI R   Q       D SC       +  A +Y     H G   ++C +++  FTD+ ++  H +                   L+       C +C K + Y     I  R+H+       D+C G  F+  + L +          + F C  CG  +S+   L  H   H      +C  C         + +H R  +H  E        K   CD C   +  +        N H +VH    P K ++  +        R+++   + TG K + C+ C  +  +    +  H  +  G   E   +C++C   F         +  +  Q+ + ++ G +  + C++C     FR  + +     VH    P  Y+C  C +        +IHL+ H   Q  F C+EC   F   + L++H     G K    KC  C K FS   ++++H    H G     P++C  C + F   + L  HQ VH G    +C+ C K        + H+  H   + ++C EC   F+  L +  H RV H   +P  Y C  CGK  +Q S   +H  +H   + Y+C+ CGK F++S+    H R+H GEKPY+C IC +RF+ +SNL  H   H
Sbjct:   84 SEVETVPEAGRHEEL--YWGQIWKQIASDLIKYEDSMISISRFPRQG------DLSC-------QVRAGLY---TTHTGQKFYQCDEYKKSFTDVFNFDLHQQ-------------------LHSGEKSHTCDECGKSFCYISALHIHQRVHMGEKCYKCDVC-GKEFSQSSHLQTHQRV--HTVEKPFKCVECGKGFSRRSTLTVHCKLHSGEKPYNCEECGRAFIHASHLQEHQR--IHTGE--------KPFKCDTCGKNFRRRS-----ALNNHCMVHTGEKPYKCEDCGKCFTCSSNLRIHQR--VHTGEKPYKCEEC-GKCFIQPSQFQAHRRIHTG---EKPYVCKVCGKGF---------IYSSSFQAHQGVHTG-EKPYKCNECG--KSFRMKIHYQVHLVVHTGEKP--YKCEVCGKAFRQSSYLKIHLKAHS-VQKPFKCEECGQGFNQSSRLQIHQLIHTGEK--PYKCEECGKGFSRRADLKIHC-RIHTG---EKPYNCEECGKVFSQASHLLTHQRVHSGEKPFKCEECGKSFSRSAHLQAHQKVHTGEKPYKCGECGKGFKWSLNLDMHQRV-HTGEKP--YTCGECGKHFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQYHRRVHTGEKPYKCEICGKRFSWRSNLVSHHKIH 674          

HSP 2 Score: 73.9442 bits (180), Expect = 1.217e-11
Identity = 47/142 (33.10%), Postives = 64/142 (45.07%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C  C + F    NL  H ++H    T  +   C+ C + F     F  H + +   T  K Y C +C K   +      H  +H+ E    C  C K F+ K +Y  HL  HTGEKPYKC++CG  F +      HLK H
Sbjct:  316 YKCEDCGKCFTCSSNLRIHQRVH----TGEKPYKCEECGKCFIQPSQFQAHRRIH---TGEKPYVCKVCGKGFIYSSSFQAHQGVHTGEKPYKCNECGKSFRMKIHYQVHLVVHTGEKPYKCEVCGKAFRQSSYLKIHLKAH 450          

HSP 3 Score: 70.0922 bits (170), Expect = 1.584e-10
Identity = 46/144 (31.94%), Postives = 68/144 (47.22%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            + C +C + F    +L +H K+H    T  +   C  C + F+  +    H + +   T  K Y C  C K     + +  H  +H+ E    C++C K F + S    H R HTGEKPYKC+ICG  FS + N   H K H +
Sbjct:  540 FKCEECGKSFSRSAHLQAHQKVH----TGEKPYKCGECGKGFKWSLNLDMHQRVH---TGEKPYTCGECGKHFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQYHRRVHTGEKPYKCEICGKRFSWRSNLVSHHKIHAA 676          

HSP 4 Score: 69.3218 bits (168), Expect = 2.642e-10
Identity = 48/142 (33.80%), Postives = 68/142 (47.89%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C  C + F      +S++KIH K  +V +   C+ C Q F        H   +   T  K Y+C  C K     A +  H +IH+ E    CE C K F + S+ + H R H+GEKP+KC+ CG  FS+  +   H K H
Sbjct:  428 YKCEVCGKAF----RQSSYLKIHLKAHSVQKPFKCEECGQGFNQSSRLQIHQLIH---TGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFSQASHLLTHQRVHSGEKPFKCEECGKSFSRSAHLQAHQKVH 562          

HSP 5 Score: 66.6254 bits (161), Expect = 1.767e-9
Identity = 48/158 (30.38%), Postives = 76/158 (48.10%), Query Frame = 1
Query: 5047 HKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNL-TETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            H +++ R +  +K  + CV+C + F     L  H K+H+ +   N    C+ C + F    + A H++ +  + T  K ++C  C K     + +N H  +H+ E    CE C K F   S    H R HTGEKPYKC+ CG  F +   +  H + H
Sbjct:  218 HLQTHQRVHTVEK-PFKCVECGKGFSRRSTLTVHCKLHSGEKPYN----CEECGRAF----IHASHLQEHQRIHTGEKPFKCDTCGKNFRRRSALNNHCMVHTGEKPYKCEDCGKCFTCSSNLRIHQRVHTGEKPYKCEECGKCFIQPSQFQAHRRIH 366          

HSP 6 Score: 62.3882 bits (150), Expect = 3.952e-8
Identity = 51/183 (27.87%), Postives = 79/183 (43.17%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKI-PCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            + C +C + F  +  L+ H ++H     + EK   C  C + F        H + +   T  K ++C  C K  +    +  H K+HS E    CE C + F   S+  EH R HTGEKP+KC  CG  F ++   N+H   H   +    +D G         +  ++V   EK     +CG
Sbjct:  176 HTCDECGKSFCYISALHIHQRVH-----MGEKCYKCDVCGKEFSQSSHLQTHQRVH---TVEKPFKCVECGKGFSRRSTLTVHCKLHSGEKPYNCEECGRAFIHASHLQEHQRIHTGEKPFKCDTCGKNFRRRSALNNHCMVHTGEKPYKCEDCGKCFTCSSNLRIHQRVHTGEKPYKCEECG 350          

HSP 7 Score: 62.003 bits (149), Expect = 5.650e-8
Identity = 43/142 (30.28%), Postives = 61/142 (42.96%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C + F    +L  H +IH  +   N    C+ C ++F        H + +   +  K ++C  C K     A +  H K+H+ E    C  C K FK       H R HTGEKPY C  CG  FS+  +   H   H
Sbjct:  484 YKCEECGKGFSRRADLKIHCRIHTGEKPYN----CEECGKVFSQASHLLTHQRVH---SGEKPFKCEECGKSFSRSAHLQAHQKVHTGEKPYKCGECGKGFKWSLNLDMHQRVHTGEKPYTCGECGKHFSQASSLQLHQSVH 618          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A4Z2DFW3 (Zinc finger protein OS=Schistosoma japonicum OX=6182 GN=EWB00_001337 PE=4 SV=1)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 498/1478 (33.69%), Postives = 728/1478 (49.26%), Query Frame = 1
Query:  325 ELFQDDEN--DKDVYDFDQQSSIVSSRQVKDKKWLNQQAKMKSSFKVI-------KSEPMQNPSWGSNIYSYLATFLNTREELDIYSRYLKCSYVNKSLDQAISDLCKPF-RNLNL-EGPTASLQNLMAKINDNATVVGLMKEIMSDRFENAAHRISHFVSIVSQPINGLVFYPKFNEILH----QIDGKIISESGFIIEVEK---------------SESRKN-----------IPDVDTIVITDSFYSYVCEKLLGQSSR--------------------------DLQRLVLGIDENKSLIGLFVLDSWNRAGVPYNRSRIKYNTSNAAQQINNSCEQSQPIISNGESN-EIKTSQ--------------------------------------NIDFIDGFFVRMGGKKDVLHLVT----------KIES-KFLVFNVVSEYMFAFKKHGLSSKTPIVLEGMYSTFSEVLGEEKSILIIPDQFYKSLLKTLHKEIHL----------------------------PNCKF--KKFVLLDKQTRAPLGVFFDTDVTLDIQIHDRILSEQQLS---------ILP---QTYVQNLKPTKQNVMLGSLNGILVGFEITPQKYITKCYEIISDSCAKINPQIDKRN-SIQTLYLAPNGMSTTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWR---------LYHQKINGDCRDDS-----------------------CVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSD-------------------------------------CPQCDKCYDYFPQADILRLHLDICDGVSFNARTPL--------------DSKYDPGEALTSECF----------------ICGICGLNYSKLDILCSHMN-NHLSCNVCKTRLGSIDEVSQHLRDH--------LHKNEN------VSGPGKR-------------KILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPL--YKRRTK-RMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAH-QEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGR 3885
            +LF+D+ N   +D+YDFD QS I   R    KK ++    +  S           ++   +  SWGSNIYS LA  L TR +LD YS +LK + +N S D+ ++++CKP  ++ NL  G +ASLQ+LM++IND+  VV L+   +S  ++   HRI + + I+ QP+ G+       + L      ID ++I + G+I+  E                S ++ N           +PD++ +++    Y  + E +     R                          +LQR+VL I+++ +L+G+ +LD+WN   + +NR +I  +  N     NN+C  +Q  +    SN +I+  Q                                       I F+D F V+  G++D L LV            +ES  F V++VV E  F  +KHG   +  I L+G+++   E + E+KS+L++PD  + +L K + +E+                              P       KFV+LD+Q R PL + FD+ V L +Q+ D  L               I P   ++Y  + KPT     L ++NG+L G +I  Q+ I +  EI+      I P     +   Q++  A     + V+  N ET  +T + A  + +    K    +  F +++    F+LP+ ISL+D + R         L  Q I                               C  C +E ++   + DHE+RH+GL RF+C  H + F D +S++SH  E   C       +      +N + S SD                                      PQC+KC DYFP A++L  HLD CDG+SF+ RTPL              DS    G+  + E                  +CGICG   +  D +  H    HL C +C   L S++E+S H   H        L ++EN       S P K              K++ CDIC +FYGTK NYY+HQW EHGVVHP     E+   +  + R  + R+++    + G++K  CK C   V+ +G+DYV+HL  KH +   ++ +CRICAD+FE+PE LS HL E H  +GE+ NAG+Q+IF C  C F+G  +G++ HS  VH D  P +YEC HC ER  D+R+WR H++KH E   +  C EC   F+   +L  H+   HG  Q    C  C   +     +R HI   H    +     CFMCQ +F  E EL+ H +E+H G ++C++C KVC +++ Y  HR KHFRTRI+QCT+CQ TF+SKLAM+RHIRV+HL L PE++ECQICGKIVTQI MHMLIHK AR++CEYC KRFTK+AYYNEH+RIH+GE+P+ECHIC++RFNKKSNLNVH+ FHEKHRDD GNYLE+KPRGR
Sbjct:  224 QLFEDENNRMQRDIYDFDAQSIISDKRATSLKKRMSTTNAVNRSVNTTAGSRSTRRTASGKGTSWGSNIYSALAAALKTRADLDAYSSFLKSNILNASYDKFLAEVCKPSNQHANLFYGASASLQSLMSRINDHDKVVELLHAFVSRPYDELQHRIIYLLPIIHQPLFGVSHMTPITQHLETLSKNIDEELIIKPGYILNQETNLLAIRSSVASDFGVSNTQYNFITGAGNLGRYMPDINQLIVPSDLYQKLTELVALPPERIYELALARVHQQEDEADIDISPLEPPNLQRIVLAINKDGNLVGIALLDTWNSTDILHNRPKIPIDLINVTSLSNNTCSVNQNGVDTEVSNRQIREEQVREVLDNIIDWVVLKSDPKDHASSSKRMNNKQQSSIIGPIRFVDAFIVKPNGRRDTLLLVAHPVNCHPSENAVESDNFFVYSVVDESKFCLEKHGFMPELSIALDGVHTVDPEDILEDKSLLVVPDLLFDTLRKVMLRELASSSSTAAAAAAVVASSRQDSTTLSLTSTGPAAVIHCTKFVILDRQRRVPLAIAFDSPVRLTLQVQDDKLGVHPHGEAASINFDQITPSELKSYESSFKPTSAEYRLVAINGLLYGLQIDDQRVIRRIIEIVPARYDSIFPHTGNPSLCAQSISAAHKSCPSNVRIVNDETNSSTVLPAFYYPHYEQTKLCNVVSGFTDQLCSLFFELPVSISLYDVVLRMAQKYMPEILARQHIEAAEAAAYAEAAANPHAPPPSPVPLPEHWGVCCLCAKELRSPNGLLDHEMRHLGLSRFRCGVHNVSFLDRRSWQSHMNEQHACPRSGPLSVLLRPNPVNQTDSGSDQDEEEDELVEQDTVPGSGLLAGLANVFNTSLLVGRMEAPQCEKCSDYFPSAEVLAQHLDFCDGISFSLRTPLSRATSGVPKPILGDDSCARSGDDASMEASVQNVDETTSDVRDDACVCGICGTQVNSRDKILRHFTVYHLQCILCNNVLRSMEELSDHYHTHLKTDAPNALEESENEESDIIKSDPDKESVPKVGVNKKSPTKLMTCDICTEFYGTKFNYYFHQWAEHGVVHPGEGMSENMLQMLTHARHLRHRVDKDDLSSIGIRKMKCKLCGFIVRCSGKDYVQHLSEKHNINTTIEDICRICADVFESPEDLSSHLGEVHFPTGEFTNAGVQTIFRCTHCEFWGFNKGLLRHSREVHDDPFPSIYECMHCYERFTDKRVWRAHMDKHNEG-YSHRCMECGRAFRLRPSLLHHMRCHHGDDQGPATCEYCGLIYPKRSSLRYHIFRMHN---QELAHECFMCQRRFRLETELRRHVKEMHSGAVKCEICHKVCANLRCYAQHRQKHFRTRIYQCTDCQTTFKSKLAMKRHIRVEHLQLGPEKFECQICGKIVTQIGMHMLIHKEARFECEYCNKRFTKAAYYNEHLRIHRGEQPFECHICRKRFNKKSNLNVHLKFHEKHRDDEGNYLELKPRGR 1697          

HSP 2 Score: 130.183 bits (326), Expect = 3.600e-26
Identity = 64/154 (41.56%), Postives = 89/154 (57.79%), Query Frame = 1
Query: 5098 CVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGK 5559
            C  C++V   LR    H + H +         C  C   F++K+   +H++  H     +K++C IC K+V  I  HM IH E    CE C+K+F K +YY EHLR H GE+P++C IC   F+KK N N HLK HE +RDD GNYL++K RG+
Sbjct: 1548 CEICHKVCANLRCYAQHRQKHFRTRIYQ----CTDCQTTFKSKLAMKRHIRVEHLQLGPEKFECQICGKIVTQIGMHMLIHKEARFECEYCNKRFTKAAYYNEHLRIHRGEQPFECHICRKRFNKKSNLNVHLKFHEKHRDDEGNYLELKPRGR 1697          
BLAST of Zinc finger protein vs. TrEMBL
Match: G4VKL6 (Putative zinc finger protein OS=Schistosoma mansoni OX=6183 GN=Smp_086750 PE=4 SV=1)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 495/1474 (33.58%), Postives = 723/1474 (49.05%), Query Frame = 1
Query:  325 ELFQDDEN--DKDVYDFDQQSSIVSSRQVKDKKWLNQQAKMK------SSFKVIKSEPMQNPSWGSNIYSYLATFLNTREELDIYSRYLKCSYVNKSLDQAISDLCKPF-RNLNL-EGPTASLQNLMAKINDNATVVGLMKEIMSDRFENAAHRISHFVSIVSQPINGLVFYPKFNEILH----QIDGKIISESGFIIEVEK---------------SESRKN-----------IPDVDTIVITDSFYSYVCEKLLGQSSR--------------------------DLQRLVLGIDENKSLIGLFVLDSWNRAGVPYNR----------SRIKYNTS-----NAAQQINNSC--EQSQPIISN-------------------GESNEIKTSQNIDFIDGFFVRMGGKKDVLHLVTKIES-----------KFLVFNVVSEYMFAFKKHGLSSKTPIVLEGMYSTFSEVLGEEKSILIIPDQFYKSLLKTLHKEIH----------------------LPNCKF--------KKFVLLDKQTRAPLGVFFDTDVTLDIQIHDRILSEQQLS---------ILP---QTYVQNLKPTKQNVMLGSLNGILVGFEITPQKYITKCYEIISDSCAKINPQIDKRN-SIQTLYLAPNGMSTTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWR---------LYHQKINGDCRDDS-----------------------CVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSD-------------------------------------CPQCDKCYDYFPQADILRLHLDICDGVSFNARTPL--------------DSKYDPGEALTSE----------------CFICGICGLNYSKLDILCSHMN-NHLSCNVCKTRLGSIDEVSQHLRDHLHKNENV--------------SGPGKR-------------KILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLY---KRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAH-QEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGR 3885
            +LF+D+ N   +D+YDFD QS I   R    KK ++  A  +      +S    ++ P +  SWGSNIYS LA  L TR +LD YS +LK + +N S D+ ++++CKP  ++ NL  G +ASLQ+LM++IND+  VV L+   ++  ++   HRI + + I+ QP+ G+      ++ L      ID +++ +  +I+  E                S ++ N           +PD+  +++    Y  + E +     R                          +LQR+VL I++   LIG+ +LD+WN   +P+NR          + +  NT+     N A+  N     EQ + ++ N                   G   E      + FID F V+  G++D L LV    S            F V++VV E  F  +KHG   +  I L+G+++   E + E+KS+L++PD  + +L K + +E+                       LP             KFV+LD+Q R PL + FD+ V L +Q+ D  L               I P   ++Y  + KPT     L ++NG+L G +I  Q+ I +  EI+   C  I P     +   Q++  A     + ++  N ET  +T + A  + +    K    +  F + +    F+LP+ +SL+D + R         L  Q I                               C  C +E ++   + DHE+RH+GL RF+C  H + F D +S++ H  E   C       +      +N + S SD                                      PQC+KC DYFP A++L  HLD CDGVSF+ RTPL              DS    G+  T E                  +CGICG   +  D +  H    HL C +C   L S++E+S H   H+  +                 S P K              K++ CDIC +FYGTK NYY+HQW EHGVVHP     E+   +    +    R+++    + G++K  CK C   V+ +G+DYV+HL  KH +   L+ +CRICAD+FE+PE LS HL E H  +GE+ NAG+Q+IF C  C F+G  +G++ HS  VH D +P +YEC HC ER  D+R+WR H++KH E   +  C EC   F+   +L  H+   HG  Q    C  C   +     +R HI   H    +     CFMCQ +F  E EL+ H +E+H G ++C++C KVC +++ Y  HR KHFRTRI+QCT+CQ TF+SKLAM+RHIRV+HL L PE++ECQICGKIVTQI MHMLIHK AR++CEYC KRFTK+AYYNEH+RIH+GE+P+ECHIC++RFNKKSNLNVH+ FHEKHRD+ GNYLE+KPRGR
Sbjct:  222 QLFEDESNHIQRDIYDFDAQSIISDKRVTSLKKKISTNAANRGMNVTSASRSTRRTAPGKGTSWGSNIYSALAAALKTRADLDAYSSFLKSNVLNASFDKFLAEICKPSNQHANLFYGASASLQSLMSRINDHDKVVELLHAFVARPYDQLQHRIVYLIPIIHQPLFGVAHMTPISQHLETLSKDIDEELVIKPAYILNQETNLLAIRSSVASDFGVSNTQYNFITGAGNLGRYMPDIHQLIVPSDLYQRLTELVALPPERIYELALARVHQQDEEADIDISPLEPPNLQRIVLAINKEGQLIGIAILDTWNSTEIPHNRPIAPIDLINITPLSDNTTCPVDQNGAEGTNRQTREEQVREVLDNIIDWVVLKSDPKEYSSSKRGNKQESSPLGPVRFIDAFIVKPNGRRDTLLLVAHPVSCHPSENDHENDNFFVYSVVDESKFCLEKHGFMPELSIALDGVHTVDPEDILEDKSLLVVPDLLFDTLRKVMLRELASSSSTAAAAAAVVASSRPDTTTLPLTSTGPAAVIHCTKFVILDRQRRVPLAIAFDSPVRLTLQVADDKLGVHPHGEAASVNFDQITPSELKSYESSFKPTSAEYRLVAINGLLYGLQIDDQRVIRRIIEIVPARCDSIYPHTGNPSLCAQSISAAHKSCPSNIRIVNDETNSSTVLPAFYYPHYEQTKLCSVVSGFTDHLCSLFFELPVSVSLYDVVLRMAQKYMPEILARQHIEAAEAAAYAEAAANPHAPPPSPVPLPEHWGVCCLCAKELRSPNGLLDHEMRHLGLSRFRCGVHNVSFLDRRSWQVHMNEHHACPRSGPLSVLLRPNPVNQNDSGSDQDEEDDELVEQDTVPGSGLLAGLANVFNTNLLVGRMEAPQCEKCSDYFPSAEVLAQHLDFCDGVSFSLRTPLSRIGGGVSKTILADDSYTRSGDDTTVEGSVPNADEVTSDAKDDACVCGICGTQVNSRDKILRHFTVYHLQCILCNNILRSMEELSDHYHTHIKTDAPNALEEFENEEAEIVKSDPDKEVNLKDGTNKKSANKLMTCDICTEFYGTKFNYYFHQWAEHGVVHPGDGVSENMLHMLTHTRHLRPRVDKEDLSSLGIRKMKCKLCGFVVRCSGKDYVQHLSEKHNINTTLEDICRICADVFESPEDLSAHLGEVHFPTGEFANAGVQTIFRCTHCEFWGFNKGLLRHSREVHDDPSPPIYECIHCYERFNDKRVWRAHMDKHNEG-YSHRCMECGRAFRLRPSLLHHMRCHHGDDQGPATCEYCGLIYPKRSSLRYHIFRMHN---QELAHECFMCQRRFRLETELRRHVKEMHSGAVKCEICHKVCANLRCYAQHRQKHFRTRIYQCTDCQTTFKSKLAMKRHIRVEHLQLGPEKFECQICGKIVTQIGMHMLIHKEARFECEYCNKRFTKAAYYNEHLRIHRGEQPFECHICRKRFNKKSNLNVHLKFHEKHRDEEGNYLELKPRGR 1691          

HSP 2 Score: 125.946 bits (315), Expect = 8.324e-25
Identity = 65/161 (40.37%), Postives = 92/161 (57.14%), Query Frame = 1
Query: 5098 CVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIKKVFN 5580
            C  C++V   LR    H + H +         C  C   F++K+   +H++  H     +K++C IC K+V  I  HM IH E    CE C+K+F K +YY EHLR H GE+P++C IC   F+KK N N HLK HE +RD+ GNYL++K RG+ I  +F 
Sbjct: 1542 CEICHKVCANLRCYAQHRQKHFRTRIYQ----CTDCQTTFKSKLAMKRHIRVEHLQLGPEKFECQICGKIVTQIGMHMLIHKEARFECEYCNKRFTKAAYYNEHLRIHRGEQPFECHICRKRFNKKSNLNVHLKFHEKHRDEEGNYLELKPRGR-ISTMFG 1697          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A267GR52 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020568g1 PE=4 SV=1)

HSP 1 Score: 812.372 bits (2097), Expect = 0.000e+0
Identity = 456/1282 (35.57%), Postives = 685/1282 (53.43%), Query Frame = 1
Query:  487 SWGSNIYSYLATFLNTREELDIYSRYLKCSYVNKSLDQAISDLCKPFRNLN--LEGPTASLQNLMAKINDNATVVGLMKEIMSDRFENAAHRISHFVSIVSQPINGLVFYPKFNEILHQIDGKIISESGFIIE--VEKSESRKNIP----DVDTIVITDSFYSYVCEKLLGQSSRDLQRLVLGIDENKSLIGLFVLDSWNRAGVPYNRSRIKYNTSNAAQQINNSCE--QSQPIISNGESNEIKTSQN---------------------------IDFIDGFFVRMGGKKDVLHLVTKIESKFLVFNVVSEYMFAFKKHGLSSKTPIVLEGMYSTFSEVLGEEKSILIIPDQFYKSLLKTLHKEI-HLPNCKFKKFVLLDKQTRAPLGVFFDTDVTLDIQIHDRILSEQQLSILPQTYVQNLKPTKQNVMLGSLNGILVGFEITPQKYITKCYEII-------SDSCAKINPQIDKRNSIQTLYLAPNGMSTTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKINGDCRDDS---------------------------------------CVFCGREFKASANVYDHEIRHVGLIRFKCHKH-QMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSH-MNNHLSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLY------KRRTK---RMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAH-QEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGRGHPDYDPQKTIARKNAQKKIDAIC----GPDIQIIMENVLINSKSCDTSDLDA 4032
            SWGSNIYS +AT L +R +LD+Y+ +LK S  N  LD   +++CKP  N +    GP+A+LQ++M++IN++  ++ +++ +M+   +   +R  + V IV QP+    + P+     H  D ++  + G+ +E  V    +R ++      + TIV++D+F+  +   +    + D  RL++ + E+  L+ + ++     A VPY   +  + +S    +  ++     +QP +S+    E ++S                             +  +D   ++  GK+DVL L T  +    +F ++ E+ F +++ G S + PI LEGM + + E L  EKS+L++PD  +KS  K L K +   P     KFVLLD   + PLGV    + TL +     I +   LS++                   LNG+L    I     ++K   I+       S S   + P +         Y    G   T++             A+L++     + Q  +D F+++   +    P+++SL+D ++R+            S                                       C  C +E KA ++++DHE+RH+G  +F C +H   VF D KSYK+H +E    +   + + +  +  +       D  QC  C DYFP +    LH   CDG SF  RTPL+     G+       +CG+CG + S  D L  H ++ H+ C +C+    +++ +SQH + H      V+ PG RKI  CD+C DFYGTK N+Y+HQW EHG+  P +K D + E         KRR+K     +ELSY ATG KKFSCKFCN +V+V G++YVKHL  KHGL V+++ +CR C ++ E  +RLS+HLR+ H+  GEY+NAGIQ+IF CD C F+G  R V+ HS  VH D+NP +Y+C HC ER +DR+LWR HL+KH    +   CD C   F+   +L  H+   H  ++  + C  C + +     ++ HI   H    +   F C +C+ +F  E EL+ H +E+H G ++CD+C K C +++ Y  HR KHFRT+IFQCT+CQATF+SK+AM+RHIRV+HLNL PERYECQICGK+VTQI+MHML HK A+Y+CE CGKRFTKS YYNEHVRIHKGEKP+ CH+C RRFNKKSNLNVH+ FHEKHRD  GNYLE+K + RG     P   +   +   K DA+       D + I+   L    +CDT+DL A
Sbjct:  196 SWGSNIYSSIATALKSRADLDVYTSFLKSSVRNDELDALYTEVCKPSNNHSSIFYGPSAALQSMMSRINNHDKIIEILRNLMARDLDGLVNRAVYIVPIVQQPLLSAEYLPQIGR--HSGDQQLRVDCGYSLESDVNLLSARFDLGYKSGGISTIVVSDAFFQRLFSAIQSGDA-DECRLLVALTEDNQLVAIALVRPDESAAVPYKLKKPIFESSVDVDEQPSAAPMPSTQPPLSSASWPEAESSAKSTAEWLKQADAIESAFNSAPSSDGGSPLRLLDAVVLKPNGKRDVLLLFTGRKPDGQIFCIIDEHRFMYQRFGFSKEVPISLEGMVTAYPEDLLSEKSLLVVPDAVFKSYKKLLSKSVASAPASVQSKFVLLDSFKKTPLGVVMTANATLRVP---EIDASAPLSLV------------------CLNGLLYALRID-NLVVSKAVSILPLRYFLRSWSPGMVQPTMGS-------YWEAEGKQVTIEMEGDPAIAGQSSPAALYDRYASHEWQRALDRFVDDFLQRSLASPVEVSLYDQVFRMAQASTPEVVEVPSSSTGQSAAAGAAAAAAAAASATGADAPASAAAQMEQWGVCSICAKELKALSSLFDHEMRHLGCNKFSCSEHPDFVFHDRKSYKAHMDEAHAGQKLPDEDSDFEEDDIERLRQAIDPRQCTSCKDYFPSSQAFDLHNSSCDGASFQTRTPLNRGL-AGQRNNPYVVVCGMCGYSLSSRDRLKRHFISMHMQCAICQATADTMEGMSQHYKSH--SEAGVTAPGPRKIFNCDLCGDFYGTKHNFYFHQWAEHGIA-PSVKADLAGESGVSGDKHRKRRSKVQVAKDELSYQATGNKKFSCKFCNTDVRVTGQEYVKHLSTKHGLNVDINNICRCCGELCENTDRLSEHLRDVHVPGGEYVNAGIQTIFQCDACPFWGFLRSVMDHSRIVHKDTNPSVYQCHHCQERFSDRKLWRTHLDKHN-MAMCHQCDYCDKTFRMRTSLLQHVRNHHSAEEEPVNCEYCGQQYPKQSALKAHIFRMHSLEGQEMKFQCEVCERRFRLEPELRRHIKEMHSGQIECDICGKECPNLRCYSQHRQKHFRTKIFQCTDCQATFKSKMAMKRHIRVEHLNLGPERYECQICGKVVTQIAMHMLTHKEAKYECEVCGKRFTKSTYYNEHVRIHKGEKPFMCHLCGRRFNKKSNLNVHVRFHEKHRDKDGNYLELKNQNRG---TYPTIVVQSPSDVPKTDAVTDTHDDADARAILG--LEAGAACDTADLAA 1435          

HSP 2 Score: 119.783 bits (299), Expect = 5.053e-23
Identity = 61/179 (34.08%), Postives = 92/179 (51.40%), Query Frame = 1
Query: 5023 ITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGK 5559
            + E    L  E      +    +  C  C +    LR  + H + H +     +   C  C   F++K+   +H++  H     ++Y+C IC KVV  I  HM  H E    CE+C K+F K +YY EH+R H GEKP+ C +CG  F+KK N N H++ HE +RD  GNYL++K + +
Sbjct: 1213 VCERRFRLEPELRRHIKEMHSGQIECDICGKECPNLRCYSQHRQKHFR----TKIFQCTDCQATFKSKMAMKRHIRVEHLNLGPERYECQICGKVVTQIAMHMLTHKEAKYECEVCGKRFTKSTYYNEHVRIHKGEKPFMCHLCGRRFNKKSNLNVHVRFHEKHRDKDGNYLELKNQNR 1387          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A1I8HRL9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 463/1346 (34.40%), Postives = 700/1346 (52.01%), Query Frame = 1
Query:  352 KDVYDFDQQSSIVSSRQVKDKKWLNQQAKMKSSFKV-------------------IKSEPMQNPSWGSNIYSYLATFLNTREELDIYSRYLKCSYVNKSLDQAISDLCKPFRNLN--LEGPTASLQNLMAKINDNATVVGLMKEIMSDRFENAAHRISHFVSIVSQPINGLVFYPKFNEILHQIDGKIISESGFIIE--VEKSESRKNIP----DVDTIVITDSFYSYVCEKLLGQSSRDLQRLVLGIDENKSLIGLFVLDSWNRAGVPYNRSRIKYNTSNAAQQINNSCE--QSQPIISNGESNEIKTSQN---------------------------IDFIDGFFVRMGGKKDVLHLVTKIESKFLVFNVVSEYMFAFKKHGLSSKTPIVLEGMYSTFSEVLGEEKSILIIPDQFYKSLLKTLHKEI-HLPNCKFKKFVLLDKQTRAPLGVFFDTDVTLDIQIHDRILSEQQLSILPQTYVQNLKPTKQNVMLGSLNGILVGFEITPQKYITKCYEII-------SDSCAKINPQIDKRNSIQTLYLAPNGMSTTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKINGDCRDDS---------------------------------------CVFCGREFKASANVYDHEIRHVGLIRFKCHKH-QMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSH-MNNHLSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLY------KRRTK---RMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAH-QEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGRGHPDYDPQKTIARKNAQKKIDAIC----GPDIQIIMENVLINSKSCDTSDLDA 4032
            +D+YDFD QS I   ++        ++ +                            S      SWGSNIYS +AT L +R +LD+Y+ +L+ S  N  LD   +++CKP  N +    GP+A+LQ++M++IN++  ++ +++ +M+   +   +R  + V IV QP+    + P+     H  D ++  + G+ +E  V    +R ++      + TIV++D+F+  +   +    + +  RL++ + E+  L+ + ++     A VPY   +  +  S    +  ++     +QP +S+    E ++S                             +  +D   ++  GK+DVL L T  +    +F ++ E+ F +++ G S + PI LEGM + + E L  EKS+L++PD  +KS  K L K +   P     KFVLLD   + PLGV    + TL +     I +   LS++                   LNG+L    I     ++K   I+       S S   + P +         Y    G   T++             A+L++     + Q  +D F+++   +    P+++SL+D ++R+            S                                       C  C +E KA ++++DHE+RH+G  +F C +H   VF D KSYK+H +E    +   + + +  +  +       D  QC  C DYFP +    LH   CDG SF  RTPL+     G+       +CG+CG + S  D L  H ++ H+ C +C+    +++ +SQH + H      V+ PG RKI  CD+C DFYGTK N+Y+HQW EHG+  P +K D + E         KRR+K     +ELSY ATG KKFSCKFCN +V+V G++YVKHL  KHGL V+++ +CR C ++ E  +RLS+HLR+ H+  GEY+NAGIQ+IF CD C F+G  R V+ HS  VH D+NP +Y+C HC ER +DR+LWR HL+KH    +   CD C   F+   +L  H+   H  ++  + C  C + +     ++ HI   H    +   F C +C+ +F  E EL+ H +E+H G ++CD+C K C +++ Y  HR KHFRT+IFQCT+CQATF+SK+AM+RHIRV+HLNL PERYECQICGK+VTQI+MHML HK A+Y+CE CGKRFTKS YYNEHVRIHKGEKP+ CH+C RRFNKKSNLNVH+ FHEKHRD  GNYLE+K + RG     P   +   +   K DA+       D + I+   L    +CDT+DL A
Sbjct:  132 RDIYDFDAQSIISEDQRRTPASGQKRRGRPPGGGAASGRRAATGGAGDAAATPAAAMSSTTAKSSWGSNIYSSIATALKSRADLDVYTSFLRSSVRNDELDALYTEVCKPSNNHSSMFYGPSAALQSMMSRINNHDKIIEILRNLMARDLDGLVNRAVYIVPIVQQPLLSAEYLPQIGR--HSGDQQLRVDCGYSLESDVNLLSARFDLGYKSGGISTIVVSDAFFQRLFSAIQSGDAEEC-RLLVALTEDNQLVAIALVRPDESAAVPYKLKKPIFEASVDVDEQPSAAPMTSTQPPLSSASWPEAESSAKSTAEWLKQADVIESAFGSAPSSDGGSPLRLLDAVVLKPNGKRDVLLLFTGRKPDGQIFCIIDEHRFMYQRFGFSKEVPISLEGMVTAYPEDLLSEKSLLVVPDAVFKSYKKLLSKSVASAPASVQSKFVLLDSFKKTPLGVVMTANATLRVP---EIDASAPLSLV------------------CLNGLLYALRID-NLVVSKAVSILPLRYFLRSWSPGMVQPTMGS-------YWEAEGKQVTIEMEGDPAIAGQSSPAALYDRYASHEWQRALDRFVDDFLQRSLASPVEVSLYDQVFRMAQASTPEVVEVPSSSTGQSAAAGAAAAAAAAASATGADAPASAAAQMEQWGVCSICAKELKALSSLFDHEMRHLGCNKFSCSEHPDFVFHDRKSYKAHMDEAHAGQKLPDEDSDFEEDDIERLRQAIDPRQCTSCKDYFPSSQAFDLHNSSCDGASFQTRTPLNRGL-AGQRNNPYVVVCGMCGYSLSSRDRLKRHFISMHMQCAICQATADTMEGMSQHYKSH--SEAGVTAPGPRKIFNCDLCGDFYGTKHNFYFHQWAEHGIA-PSVKADLAGESGVSGDKHRKRRSKVQVAKDELSYQATGNKKFSCKFCNTDVRVTGQEYVKHLSTKHGLNVDINNICRCCGELCENTDRLSEHLRDVHVPGGEYVNAGIQTIFQCDACPFWGFLRSVMDHSRIVHKDTNPSVYQCHHCQERFSDRKLWRTHLDKHN-MAMCHQCDYCDKTFRMRTSLLQHVRNHHSAEEEPVNCEYCGQQYPKQSALKAHIFRMHSLEGQEMKFQCEVCERRFRLEPELRRHIKEMHSGQIECDICGKECPNLRCYSQHRQKHFRTKIFQCTDCQATFKSKMAMKRHIRVEHLNLGPERYECQICGKVVTQIAMHMLTHKEAKYECEVCGKRFTKSTYYNEHVRIHKGEKPFMCHLCGRRFNKKSNLNVHVRFHEKHRDKDGNYLELKNQNRG---TYPTIVVQSPSDVPKTDAVTDTHDDADARAILG--LEAGAACDTADLAA 1435          

HSP 2 Score: 119.783 bits (299), Expect = 4.885e-23
Identity = 61/179 (34.08%), Postives = 92/179 (51.40%), Query Frame = 1
Query: 5023 ITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGK 5559
            + E    L  E      +    +  C  C +    LR  + H + H +     +   C  C   F++K+   +H++  H     ++Y+C IC KVV  I  HM  H E    CE+C K+F K +YY EH+R H GEKP+ C +CG  F+KK N N H++ HE +RD  GNYL++K + +
Sbjct: 1213 VCERRFRLEPELRRHIKEMHSGQIECDICGKECPNLRCYSQHRQKHFR----TKIFQCTDCQATFKSKMAMKRHIRVEHLNLGPERYECQICGKVVTQIAMHMLTHKEAKYECEVCGKRFTKSTYYNEHVRIHKGEKPFMCHLCGRRFNKKSNLNVHVRFHEKHRDKDGNYLELKNQNR 1387          
BLAST of Zinc finger protein vs. TrEMBL
Match: A0A267GAR8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020568g2 PE=4 SV=1)

HSP 1 Score: 810.831 bits (2093), Expect = 0.000e+0
Identity = 463/1346 (34.40%), Postives = 700/1346 (52.01%), Query Frame = 1
Query:  352 KDVYDFDQQSSIVSSRQVKDKKWLNQQAKMKSSFKV-------------------IKSEPMQNPSWGSNIYSYLATFLNTREELDIYSRYLKCSYVNKSLDQAISDLCKPFRNLN--LEGPTASLQNLMAKINDNATVVGLMKEIMSDRFENAAHRISHFVSIVSQPINGLVFYPKFNEILHQIDGKIISESGFIIE--VEKSESRKNIP----DVDTIVITDSFYSYVCEKLLGQSSRDLQRLVLGIDENKSLIGLFVLDSWNRAGVPYNRSRIKYNTSNAAQQINNSCE--QSQPIISNGESNEIKTSQN---------------------------IDFIDGFFVRMGGKKDVLHLVTKIESKFLVFNVVSEYMFAFKKHGLSSKTPIVLEGMYSTFSEVLGEEKSILIIPDQFYKSLLKTLHKEI-HLPNCKFKKFVLLDKQTRAPLGVFFDTDVTLDIQIHDRILSEQQLSILPQTYVQNLKPTKQNVMLGSLNGILVGFEITPQKYITKCYEII-------SDSCAKINPQIDKRNSIQTLYLAPNGMSTTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKINGDCRDDS---------------------------------------CVFCGREFKASANVYDHEIRHVGLIRFKCHKH-QMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSH-MNNHLSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLY------KRRTK---RMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAH-QEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGRGHPDYDPQKTIARKNAQKKIDAIC----GPDIQIIMENVLINSKSCDTSDLDA 4032
            +D+YDFD QS I   ++        ++ +                            S      SWGSNIYS +AT L +R +LD+Y+ +L+ S  N  LD   +++CKP  N +    GP+A+LQ++M++IN++  ++ +++ +M+   +   +R  + V IV QP+    + P+     H  D ++  + G+ +E  V    +R ++      + TIV++D+F+  +   +    + +  RL++ + E+  L+ + ++     A VPY   +  +  S    +  ++     +QP +S+    E ++S                             +  +D   ++  GK+DVL L T  +    +F ++ E+ F +++ G S + PI LEGM + + E L  EKS+L++PD  +KS  K L K +   P     KFVLLD   + PLGV    + TL +     I +   LS++                   LNG+L    I     ++K   I+       S S   + P +         Y    G   T++             A+L++     + Q  +D F+++   +    P+++SL+D ++R+            S                                       C  C +E KA ++++DHE+RH+G  +F C +H   VF D KSYK+H +E    +   + + +  +  +       D  QC  C DYFP +    LH   CDG SF  RTPL+     G+       +CG+CG + S  D L  H ++ H+ C +C+    +++ +SQH + H      V+ PG RKI  CD+C DFYGTK N+Y+HQW EHG+  P +K D + E         KRR+K     +ELSY ATG KKFSCKFCN +V+V G++YVKHL  KHGL V+++ +CR C ++ E  +RLS+HLR+ H+  GEY+NAGIQ+IF CD C F+G  R V+ HS  VH D+NP +Y+C HC ER +DR+LWR HL+KH    +   CD C   F+   +L  H+   H  ++  + C  C + +     ++ HI   H    +   F C +C+ +F  E EL+ H +E+H G ++CD+C K C +++ Y  HR KHFRT+IFQCT+CQATF+SK+AM+RHIRV+HLNL PERYECQICGK+VTQI+MHML HK A+Y+CE CGKRFTKS YYNEHVRIHKGEKP+ CH+C RRFNKKSNLNVH+ FHEKHRD  GNYLE+K + RG     P   +   +   K DA+       D + I+   L    +CDT+DL A
Sbjct:  153 RDIYDFDAQSIISEDQRRTPASGQKRRGRPPGGGAASGRRAATGGAGDAAATPAAAMSSTTAKSSWGSNIYSSIATALKSRADLDVYTSFLRSSVRNDELDALYTEVCKPSNNHSSMFYGPSAALQSMMSRINNHDKIIEILRNLMARDLDGLVNRAVYIVPIVQQPLLSAEYLPQIGR--HSGDQQLRVDCGYSLESDVNLLSARFDLGYKSGGISTIVVSDAFFQRLFSAIQSGDAEEC-RLLVALTEDNQLVAIALVRPDESAAVPYKLKKPIFEASVDVDEQPSAAPMTSTQPPLSSASWPEAESSAKSTAEWLKQADVIESAFGSAPSSDGGSPLRLLDAVVLKPNGKRDVLLLFTGRKPDGQIFCIIDEHRFMYQRFGFSKEVPISLEGMVTAYPEDLLSEKSLLVVPDAVFKSYKKLLSKSVASAPASVQSKFVLLDSFKKTPLGVVMTANATLRVP---EIDASAPLSLV------------------CLNGLLYALRID-NLVVSKAVSILPLRYFLRSWSPGMVQPTMGS-------YWEAEGKQVTIEMEGDPAIAGQSSPAALYDRYASHEWQRALDRFVDDFLQRSLASPVEVSLYDQVFRMAQASTPEVVEVPSSSTGQSAAAGAAAAAAAAASATGADAPASAAAQMEQWGVCSICAKELKALSSLFDHEMRHLGCNKFSCSEHPDFVFHDRKSYKAHMDEAHAGQKLPDEDSDFEEDDIERLRQAIDPRQCTSCKDYFPSSQAFDLHNSSCDGASFQTRTPLNRGL-AGQRNNPYVVVCGMCGYSLSSRDRLKRHFISMHMQCAICQATADTMEGMSQHYKSH--SEAGVTAPGPRKIFNCDLCGDFYGTKHNFYFHQWAEHGIA-PSVKADLAGESGVSGDKHRKRRSKVQVAKDELSYQATGNKKFSCKFCNTDVRVTGQEYVKHLSTKHGLNVDINNICRCCGELCENTDRLSEHLRDVHVPGGEYVNAGIQTIFQCDACPFWGFLRSVMDHSRIVHKDTNPSVYQCHHCQERFSDRKLWRTHLDKHN-MAMCHQCDYCDKTFRMRTSLLQHVRNHHSAEEEPVNCEYCGQQYPKQSALKAHIFRMHSLEGQEMKFQCEVCERRFRLEPELRRHIKEMHSGQIECDICGKECPNLRCYSQHRQKHFRTKIFQCTDCQATFKSKMAMKRHIRVEHLNLGPERYECQICGKVVTQIAMHMLTHKEAKYECEVCGKRFTKSTYYNEHVRIHKGEKPFMCHLCGRRFNKKSNLNVHVRFHEKHRDKDGNYLELKNQNRG---TYPTIVVQSPSDVPKTDAVTDTHDDADARAILG--LEAGAACDTADLAA 1456          

HSP 2 Score: 119.398 bits (298), Expect = 6.029e-23
Identity = 61/179 (34.08%), Postives = 92/179 (51.40%), Query Frame = 1
Query: 5023 ITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGK 5559
            + E    L  E      +    +  C  C +    LR  + H + H +     +   C  C   F++K+   +H++  H     ++Y+C IC KVV  I  HM  H E    CE+C K+F K +YY EH+R H GEKP+ C +CG  F+KK N N H++ HE +RD  GNYL++K + +
Sbjct: 1234 VCERRFRLEPELRRHIKEMHSGQIECDICGKECPNLRCYSQHRQKHFR----TKIFQCTDCQATFKSKMAMKRHIRVEHLNLGPERYECQICGKVVTQIAMHMLTHKEAKYECEVCGKRFTKSTYYNEHVRIHKGEKPFMCHLCGRRFNKKSNLNVHVRFHEKHRDKDGNYLELKNQNR 1408          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ENSAMXT00000056400.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000086.1:69498:76270:-1 gene:ENSAMXG00000037923.1 transcript:ENSAMXT00000056400.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.813 bits (351), Expect = 1.168e-32
Identity = 142/631 (22.50%), Postives = 238/631 (37.72%), Query Frame = 1
Query: 2002 LYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGV----------SFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            + HQ+I+   +  +C  CG  F A   +  H++ H G   + C      FT   S K+H                     ++       C  C K    F     L++H  I  GV          SF  +T L +       +    + C  CG ++++   L +H   H       C+ C  R  +   +  H R H             K   C  C   +  +     HQ    GV   P    +      ++ + + ++   + TG+K + C  C       G  + +   +K    +        C+D        +   R+  +++ + I+ G++  +  D  T F     +  H   +H    P  Y C  C +R   +   +IH   H   +  + C +C T F  + +LK H     GVK     CS C   F+    ++ H    H G   + P+ C  C   F  +  L+ HQ +H G+    C  C K   +  A ++H+  H   + + C++C  +F  + +++ H R+ H  ++P  Y C  CG   T+   +  H  IH   + Y C  CG  FT+      H RIH G KPY C  C   F ++++L  H   H
Sbjct:  338 IIHQRIHTGVKPYNCSDCGTRFNAQGTLKRHQVTHTGEKPYYCSDCGTSFTRQTSLKTHQR-------------------IHTGVKPYYCSDCGK---RFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHT----------GVKPYYCSDCGKRFNAQGALKIHQRIHTGV--KPYYCSDCGTSFTRQTSLKTHQR--IHTGVKPYYCSDC-------GTSFTRQTSLKTHQRIHTGVKPYYCSDC------GTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQ-RIHTGVKP--YYCSDCGKRFNAQGALKIHQRIHTGVK-PYYCSDCGTSFTRQTSLKTHQRIHTGVK--PYYCSDCGTSFTRQTSLKTH-QRIHTG---VKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRI-HTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIH 904          

HSP 2 Score: 133.65 bits (335), Expect = 1.062e-30
Identity = 148/638 (23.20%), Postives = 234/638 (36.68%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFI--------DCXXX-XXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVS----------FNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            HQ+I+   +   C  CG+ F A   +  H+  H G+  + C      FT   S K+H             DC +  +     +T + ++       C  C K    F     L++H  I  GV           FNA+  L         +    + C  CG ++++   L +H   H       C+ C T       +  H R H             K   C  C   +  + +   HQ    GV   P    +      ++ + + ++   + TG+K + C  C       G   + H  +  G+       C  C   F     L  H R         I+ G++  +  D  T F     +  H   +H    P  Y C  C      +   + H   H   +  + C +C   F  + ALK+H     GVK     CS C   F+    ++ H    H G   + P+ C  C   F  +  L+ HQ +H G+    C  C        + + H+  H   + + C++C  +F  + +++ H R+ H  ++P  Y C  CG   T+   +  H  IH   + Y C  CGKRF        H RIH G KPY C  C +RFN +  L +H   H
Sbjct:  396 HQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGK---RFNAQGALKIHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHT----------GVKPYYCSDCGTSFTRQTSLKTHQRIHTGV--KPYYCSDCGTSFTRQTSLKTHQR--IHTGVKPYYCSDCGKRFNAQGALKI-HQRIHTGVKPYY---CSDCGTSFTRQTSLKTHQR---------IHTGVKPYYCSDCGTSFTRQTSLKTHQ-RIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYY-CSDCGKRFNAQGALKIHQRIHTGVK--PYYCSDCGTSFTRQTSLKTH-QRIHTG---VKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRI-HTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCFDCGKRFNAQGALKIHQRIH 988          

HSP 3 Score: 130.568 bits (327), Expect = 8.723e-30
Identity = 170/732 (23.22%), Postives = 272/732 (37.16%), Query Frame = 1
Query: 1825 TTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCH---------------KHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXX-XXLNISASLSDCPQCDKCYDY-FPQADILRLHLDICDGV----------SFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLH-KNENVSGPGKR-----------------KILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLY-KRRTKRMNELSYMA------TGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            T+ Q  +T+   N +   +     P  + Q++    ++  +D       Q SL        HQ+I+   +   C  CG+ F A   +  H+  H G  +  CH                 Q + T +K Y        +C      +   T+ ++++    L +C  C K +   F +   L++H  I  GV          SF+ +T L  K         + + C  CG ++++   L +H   H       C+ C  R  +   +  H R H   K    S  GKR                 K   C  C   +  + +   HQ    GV           +P Y     KR N    +       TG+K ++C  C       G   +K   V H  T E    C  C   F     L  H R         I+ G++  + C  C    + +G +     +H    P  Y C  C      +   + H   H   +  + C +C T F  + +LK H     GVK     CS C K F+    +++H    H G   + P+ C  C ++F  +  L+ HQ +H G+    C  C        + + H+  H   + + C++C  +F  + +++ H R+ H  ++P  Y C  CG   T+   +  H  IH   + Y C  CG  FT+      H RIH G KPY C  C +RFN +  L +H   H
Sbjct:    2 TSKQLSSTDEPMNNFAKPTS-SPTPSRQMQQRAGKKIHHCSDCGTSFTRQTSLKT------HQRIHTGEKPYHCSECGKSFTAQGTLNRHQRIHTG--KKTCHCSDRGKSFTTQGIIEAQQCIHTGVKPY-----SCSECGKSYTRQSSVTRHQVIHTGVKLYNCSDCGKSFTKNFTRQTSLKIHQRIHTGVKPYNCSDCKKSFSRQTSL--KRHQVTHTGEKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGV-----------KPYYCSDCGKRFNAQGALIIHQRIHTGVKPYNCSDCGTRFNAQGT--LKRHQVTH--TGEKPYYCSDCGTSFTRQTSLKTHQR---------IHTGVKPYY-CSDCGKRFNAQGALKIHQRIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVK-PYYCSDCGTSFTRQTSLKTHQRIHTGVK--PYYCSDCGKRFNAQGALKIH-QRIHTG---VKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRI-HTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIH 680          

HSP 4 Score: 129.798 bits (325), Expect = 1.515e-29
Identity = 147/671 (21.91%), Postives = 248/671 (36.96%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEAL--------TSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLH-KNENVSGPGKR-----------------KILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVK-------------QNDLK-------------CSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            HQ+I+   +  +C  C + F    ++  H++ H G   + C      FT   S K+H                     ++       C  C K    F     L++H  I  GV     +    +++   AL          + + C  CG ++++   L +H   H       C+ C  R  +   +  H R H   K  N S  G R                 K   C  C   +  + +   HQ    GV   P    +  +    +   ++++   + TG+K + C  C       G  + +   +K    +        C+D        +   R+  +++ + I+ G++  + C  C    + +G +     +H    P  Y C  C +R   +   +IH   H   +  + C +C T F  + +LK H     GVK             Q  LK             CS C   F+    ++ H    H G   + P+ C  C   F  +  L+ HQ +H G+    C  C K   +  A ++H+  H   + + C++C  +F  + +++ H R+ H  ++P  Y C  CG   T+   +  H  IH   + Y C  CG  FT+      H RIH G KPY C  C +RFN +  L +H   H
Sbjct:  172 HQRIHTGVKPYNCSDCKKSFSRQTSLKRHQVTHTGEKPYYCSDCGTSFTRQTSLKTHQR-------------------IHTGVKPYYCSDCGK---RFNAQGALKIHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYNCSDCGTRFNAQGTLKRHQVTHTGEKPYYCSDCGTSFTRQTSLKTHQRIHTGV--KPYYCSDCGKRFNAQGALKIHQR--IHTGVKPYYCSDC-------GTSFTRQTSLKTHQRIHTGVKPYYCSDC------GTSFTRQTSLKTHQRIHTGVKPYY-CSDCGKRFNAQGALKIHQRIHTGVKP--YYCSDCGKRFNAQGALKIHQRIHTGVK-PYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTH-QRIHTG---VKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRI-HTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIH 792          

HSP 5 Score: 129.413 bits (324), Expect = 1.720e-29
Identity = 142/629 (22.58%), Postives = 232/629 (36.88%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVS----------FNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            HQ+I+   +   C  CG  F    ++  H+  H G+  + C      FT   S K+H       +                         C  C   F +   L+ H  I  GV           FNA+  L         +    + C  CG ++++   L +H   H       C+ C T       +  H R H             K   C  C   +  + +   HQ    GV   P    +  +    +   ++++   + TG+K + C  C       G  + +   +K    +        C+D        +   R+  +++ + I+ G++  +  D  T F     +  H   +H    P  Y C  C      +   + H   H   +  + C +C T F  + +LK H     GVK     CS C K F+    +++H    H G   + P+ CF C ++F  +  L+ HQ +H G+    C  C        + + H+  H   + + C++C   F ++ A+  H R+ H  ++P  Y C  CG   T+   +  H  IH   + Y C  CGKRF        H RIH G KPY C  C +RFN +  L +H   H
Sbjct:  564 HQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYY----------------------CSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHT----------GVKPYYCSDCGTSFTRQTSLKTHQRIHTGV--KPYYCSDCGKRFNAQGALKIHQR--IHTGVKPYYCSDC-------GTSFTRQTSLKTHQRIHTGVKPYYCSDC------GTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQ-RIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYY-CSDCGTSFTRQTSLKTHQRIHTGVK--PYYCSDCGKRFNAQGALKIH-QRIHTG---VKPYYCFDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRI-HTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCFDCGKRFNAQGALKIHQRIH 1128          

HSP 6 Score: 129.413 bits (324), Expect = 2.073e-29
Identity = 143/628 (22.77%), Postives = 233/628 (37.10%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADIL---RLHLDI----CD--GVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            HQ+I+   +   C  CG+ F A   +  H+  H G+  + C      FT   S K+H                     ++       C  C K ++   Q  ++   R+H  +    C   G  FNA+  L  K         + + C  CG ++++   L +H   H       C+ C  R  +   +  H R H             K   C  C   +  + +   HQ    GV   P    +      ++ + + ++   + TG+K + C  C       G   + H  +  G+       C  C   F     L  H R         I+ G++  +  D  T F     +  H   +H    P  Y C  C      +   + H   H   +  + C +C T F  + +LK H     GVK     CS C   F+    ++ H    H G   + P+ C  C ++F  +  L+ HQ +H G+    C  C        + + H+  H   + + C++C  +F  + +++ H R+ H  ++P  Y C  CG   T+   +  H  IH   + Y C  CGKRF        H RIH G KPY C  C   F ++++L  H   H
Sbjct:  256 HQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQR-------------------IHTGVKPYYCSDCGKRFN--AQGALIIHQRIHTGVKPYNCSDCGTRFNAQGTL--KRHQVTHTGEKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHT----------GVKPYYCSDCGTSFTRQTSLKTHQRIHTGV--KPYYCSDCGTSFTRQTSLKTHQR--IHTGVKPYYCSDCGKRFNAQGALKI-HQRIHTGVKPY---YCSDCGKRFNAQGALKIHQR---------IHTGVKPYYCSDCGTSFTRQTSLKTHQ-RIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVK-PYYCSDCGTSFTRQTSLKTHQRIHTGVK--PYYCSDCGTSFTRQTSLKTH-QRIHTG---VKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRI-HTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIH 820          

HSP 7 Score: 127.102 bits (318), Expect = 1.005e-28
Identity = 141/633 (22.27%), Postives = 233/633 (36.81%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGV----------SFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            HQ+I+   +   C  CG  F    ++  H+  H G+  + C      FT   S K+H                     ++       C  C K    F     L++H  I  GV          SF  +T L +       +    + C  CG ++++   L +H   H       C+ C T       +  H R H             K   C  C   +  +     HQ    GV   P    +      ++ + + ++   + TG+K + C  C       G  + +   +K    +        C+D        +   R+  +++ + I+ G++  +  D  T F     +  H   +H    P  Y C  C      +   + H   H   +  + C +C   F  + ALK+H     GVK     C  C K F+    +++H    H G   + P+ C  C   F  +  L+ HQ +H G+    C  C K   +  A  +H+  H   + + C++C  +F  + +++ H R+ H  ++P  Y C  CGK       + +H  IH   + Y C  CGKRF        H RIH G KPY C  C   F ++++L  H   H   R
Sbjct:  592 HQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQR-------------------IHTGVKPYYCSDCGK---RFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHT----------GVKPYYCSDCGKRFNAQGALKIHQRIHTGV--KPYYCSDCGTSFTRQTSLKTHQR--IHTGVKPYYCSDC-------GTSFTRQTSLKTHQRIHTGVKPYYCSDC------GTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQ-RIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYY-CSDCGKRFNAQGALKIHQRIHTGVK--PYYCFDCGKRFNAQGALKIH-QRIHTG---VKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRI-HTGVKP--YYCSDCGKRFNAQGALKIHQRIHTGVKPYYCFDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTDKR 1160          

HSP 8 Score: 107.457 bits (267), Expect = 9.980e-23
Identity = 95/341 (27.86%), Postives = 143/341 (41.94%), Query Frame = 1
Query: 2860 TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDEC-QTYFKN---EAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDY 3852
            T E    C  C   F     L+ H R         I+ G ++    D+   F   +G++     +H    P  Y C  C +    +     H   H   +L + C +C +++ KN   + +LK+H     GVK     CS C+K FS    ++ H +  H G     P+ C  C   F  +  L+ HQ +H G+    C  C K   +  A ++H+  H   + + C++C   F ++ A+  H R+ H  ++P  Y C  CG   T+   +  H  IH   + Y C  CGKRF        H RIH G KPY C  C  RFN +  L  H   H   +  Y
Sbjct:   61 TGEKPYHCSECGKSFTAQGTLNRHQR---------IHTGKKTCHCSDRGKSFT-TQGIIEAQQCIHTGVKP--YSCSECGKSYTRQSSVTRHQVIHTGVKL-YNCSDCGKSFTKNFTRQTSLKIHQRIHTGVK--PYNCSDCKKSFSRQTSLKRHQVT-HTG---EKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRI-HTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYNCSDCGTRFNAQGTLKRHQVTHTGEKPYY 379          

HSP 9 Score: 61.2326 bits (147), Expect = 1.146e-8
Identity = 47/186 (25.27%), Postives = 75/186 (40.32%), Query Frame = 1
Query: 3400 QAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVD---------------------------HLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNE----HVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDY 3852
            Q  Q     +  C  C        + + H+  H   + + C+EC  +F ++  + RH R+                            H  ++P  Y C  CGK  T+   ++ H +IH   + Y C  CGK FTK+         H RIH G KPY C  C++ F+++++L  H   H   +  Y
Sbjct:   28 QMQQRAGKKIHHCSDCGTSFTRQTSLKTHQRIHTGEKPYHCSECGKSFTAQGTLNRHQRIHTGKKTCHCSDRGKSFTTQGIIEAQQCIHTGVKP--YSCSECGKSYTRQSSVTRHQVIHTGVKLYNCSDCGKSFTKNFTRQTSLKIHQRIHTGVKPYNCSDCKKSFSRQTSLKRHQVTHTGEKPYY 211          

HSP 10 Score: 58.9214 bits (141), Expect = 6.048e-8
Identity = 57/245 (23.27%), Postives = 92/245 (37.55%), Query Frame = 1
Query: 4936 SDLDQEWSIEESDMEHS-------MWNIS---RDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGT 5616
            S+  + ++ + S   H        ++N S   +   KN   + S+ +H+  +          YNC  C + F    +L  H   H    T  +   C  C   F  +     H + +   T  K Y C+ C K       +  H +IH+      C  C K+F  +   + H R HTG KPY C  CG  F+++ +   H + H      Y  D G     +      +++    K  N   CGT
Sbjct:  125 SECGKSYTRQSSVTRHQVIHTGVKLYNCSDCGKSFTKNFTRQTSLKIHQRIHTGVK-----PYNCSDCKKSFSRQTSLKRHQVTH----TGEKPYYCSDCGTSFTRQTSLKTHQRIH---TGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYNCSDCGT 357          

HSP 11 Score: 56.225 bits (134), Expect = 3.683e-7
Identity = 49/184 (26.63%), Postives = 71/184 (38.59%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C  C   F    +L +H +IH    T  +   C  C   F  +     H + +   T  K Y C+ C K       +  H +IH+      C  C K+F  +     H R HTG KPY C  CG  F+++ +   H + H      Y  D G     +   K  +++    K      CGTS
Sbjct:  434 YYCSDCGTSFTRQTSLKTHQRIH----TGVKPYYCSDCGTSFTRQTSLKTHQRIH---TGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTS 610          

HSP 12 Score: 54.6842 bits (130), Expect = 1.067e-6
Identity = 48/184 (26.09%), Postives = 70/184 (38.04%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C  C   F    +L +H +IH    T  +   C  C   F  +     H + +   T  K Y C+ C         +  H +IH+      C  C K+F  +     H R HTG KPY C  CG  F+++ +   H + H      Y  D G     +   K  +++    K      CGTS
Sbjct:  574 YYCSDCGTSFTRQTSLKTHQRIH----TGVKPYYCSDCGTSFTRQTSLKTHQRIH---TGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTS 750          

HSP 13 Score: 54.6842 bits (130), Expect = 1.067e-6
Identity = 48/184 (26.09%), Postives = 70/184 (38.04%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C  C   F    +L +H +IH    T  +   C  C   F  +     H + +   T  K Y C+ C         +  H +IH+      C  C K+F  +     H R HTG KPY C  CG  F+++ +   H + H      Y  D G     +   K  +++    K      CGTS
Sbjct:  686 YYCSDCGTSFTRQTSLKTHQRIH----TGVKPYYCSDCGTSFTRQTSLKTHQRIH---TGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTS 862          

HSP 14 Score: 53.1434 bits (126), Expect = 3.507e-6
Identity = 47/184 (25.54%), Postives = 71/184 (38.59%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C  C   F    +L +H +IH    T  +   C  C + F  +     H + +   T  K Y C+ C         +  H +IH+      C  C   F +++    H R HTG KPY C  CG  F+++ +   H + H      Y  D G     +   K  +++    K      CGTS
Sbjct:  742 YYCSDCGTSFTRQTSLKTHQRIH----TGVKPYYCSDCGKRFNAQGALKIHQRIH---TGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTS 918          

HSP 15 Score: 51.9878 bits (123), Expect = 7.623e-6
Identity = 38/144 (26.39%), Postives = 57/144 (39.58%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            Y C  C   F    +L +H +IH    T  +   C  C   F  +     H + +   T  K Y C+ C         +  H +IH+      C  C   F +++    H R HTG KPY C  CG  F+++ +   H + H  
Sbjct:  798 YYCSDCGTSFTRQTSLKTHQRIH----TGVKPYYCSDCGTSFTRQTSLKTHQRIH---TGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTG 934          

HSP 16 Score: 51.9878 bits (123), Expect = 8.725e-6
Identity = 39/144 (27.08%), Postives = 59/144 (40.97%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            Y C  C + F    N    +KIH +  T  +   C  C + F  +     H + +   T  K Y C+ C         +  H +IH+      C  C K+F  +   + H R HTG KPY C  CG  F+++ +   H + H  
Sbjct:  938 YYCSDCGKRF----NAQGALKIHQRIHTGVKPYYCFDCGKRFNAQGALKIHQRIH---TGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTG 1074          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ENSAMXT00000039103.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000052.1:2092417:2202492:1 gene:ENSAMXG00000040630.1 transcript:ENSAMXT00000039103.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.117 bits (344), Expect = 4.355e-32
Identity = 161/639 (25.20%), Postives = 241/639 (37.72%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFE-NELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            HQ+I+   +   C  CG+ F    ++  H+  H G   ++C      F    S +SH      E+   C    ++  ++     ++     + P  C +C   F ++  L+ H  +        C   G SFN +  L S  +   GE      + C  CG ++++   L SH   H       C+ C         +  H R H             K   C  C   +  + +   HQ      +H   K    +E   + R         + TG K + C  C    + +G    KH  V      E    C +C   F     L  HLR   I SGE         F C  C   F       AH   +H    P  Y+C  C +   ++  +R H   H   +  + C +C   F  +  L+ HL    G K     C  C K F+    +++H    H G     P+ C  C + F F+ + L+ HQ +H G     C  C K    +  ++ HR  H   + ++C+EC   F  +   R H RV H    P  + C  CGK  TQ   +  H  IH   + YQC  CGK FT+      H R+H GEKPYEC  C + F  ++ L  H   H
Sbjct:  203 HQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSQCGKSFSQKINLQSHLRIHTEEKPFPCSECGKTFRESGALKKHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKP----YQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRVHT----------GEKPYQCSDCGKSFNQQGSLQSHQR-----IHTGEKPYHCSECGLRFRHSFKLFHQRIHTGEKPYQCSECGRSFRESG-ALRKHDCV---FLGEKPYHCPVCQKGFTVQGNLQAHLR---IHSGE-------KPFYCSVCGKSFTQHNNFQAHQR-IHTGEKP--YQCLECGKSFNEQGYFRAHQRVHT-GEKPYQCLDCGKSFTQQGNLQKHLRIHTGEK--PFHCEECGKSFTQQGNLQIH-QRVHTG---EKPYECSECGKSFTFQTSSLKVHQRIHTGEKPYHCSDCSKSFGHLSHFKSHRRIHTGEKPYKCSECGKRFNERGYFRAHQRV-HTGERP--FPCLDCGKSFTQQANLQKHQRIHTGEKPYQCSDCGKSFTQQGNLTMHQRVHTGEKPYECSECGKSFTFQTALRRHQRLH 795          

HSP 2 Score: 133.65 bits (335), Expect = 5.286e-31
Identity = 159/684 (23.25%), Postives = 253/684 (36.99%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICD------GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYK-----RRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLR-------------------ENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFT-------------------------KS----AYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            H +I+ + +  SC  CG+ F+  + +  H+  H G   +KC +    F      K+H                   +  +      +C +C K +       +LR   +  D      G SFN +  L S  +   GE      + C  CG ++++   L SH   H       C+ C         +  H R  +H  E        K   C  C   +  K+N            H  I T+E   P  +     R +  + +   + TG K + C  C       G     H  +    T E    C  C   F     L  H R                   +  +QS + ++ G +  + C  C    + +G +     +H    P  Y C  C  R   R  +++  ++    +  + C EC   F+   AL+ H   F G K     C +C+K F+    ++ H L  H G     PF C +C + F   N  QAHQ +H G    QC  C K       +  H+  H   + +QC +C  +F  +  +++H+R+ H   +P  + C+ CGK  TQ   + +H  +H   + Y+C  CGK FT                         KS    +++  H RIH GEKPY+C  C +RFN++     H   H   R
Sbjct:   94 HLRIHTEEKPYSCSECGKTFREDSALKKHQSVHTGEKPYKCLECGKSFPIESQLKTH-------------------QRYHTGEKPYECLECGKSFSI--TGHLLRHQREKKDYHCLDCGKSFNQQGSLQSHQRIHTGEKP----YQCSDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQR--IHTGE--------KPYHCSQCGKSFSQKINL---------QSHLRIHTEEKPFPCSECGKTFRESGALKKHQRVHTGEKPYQCSDCGKSFNQQG-SLQSHQRIH---TGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTG-EKPYQCSDCGKSFNQQGSLQSHQRIHTGEKP--YHCSECGLRF--RHSFKLFHQRIHTGEKPYQCSECGRSFRESGALRKHDCVFLGEK--PYHCPVCQKGFTVQGNLQAH-LRIHSG---EKPFYCSVCGKSFTQHNNFQAHQRIHTGEKPYQCLECGKSFNEQGYFRAHQRVHTGEKPYQCLDCGKSFTQQGNLQKHLRI-HTGEKP--FHCEECGKSFTQQGNLQIHQRVHTGEKPYECSECGKSFTFQTSSLKVHQRIHTGEKPYHCSDCSKSFGHLSHFKSHRRIHTGEKPYKCSECGKRFNERGYFRAHQRVHTGER 715          

HSP 3 Score: 130.183 bits (326), Expect = 5.958e-30
Identity = 167/672 (24.85%), Postives = 246/672 (36.61%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLH-------------------------------------LDICDGVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYK-----RRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVEL--YPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFN-KKSNLNVHINFH 3831
            HQ+ +   +   C  CG+ F    ++  H   H G   F+C      F    S K H      E+   C    +T  E +    + S    + P +C +C   FP    L+ H                                     LD   G SFN +  L S  +   GE      + C  CG ++++   L SH   H       C+ C         +  H R  +H  E        K   C  C   +  K+N            H  I T+E   P  +     R +  + +   + TG K + C  C       G     H  +    T E    C  C   F     L  H R   + +GE         + C  C    + +G +     VH    P  Y+C  C +    +   + H   H   +  + C EC   F++  + KL  +  H   +   +CS C + F  S  +R H       CV L   P+ C +CQ+ F  +  LQAH  +H G     C +C K       ++ H+  H   + +QC EC  +F  +   R H RV H   +P  Y+C  CGK  TQ   +  H+ IH   + + CE CGK FT+      H R+H GEKPYEC  C + F  + S+L VH   H
Sbjct:   38 HQRYHTGEKPYECPDCGKSFTILGHLQRHRRVHTGEKPFQCSDCGKSFYQQSSLKIHLRIHTEEKPYSCSECGKTFREDSALKKHQSVHTGEKPYKCLECGKSFPIESQLKTHQRYHTGEKPYECLECGKSFSITGHLLRHQREKKDYHCLDC--GKSFNQQGSLQSHQRIHTGEKP----YQCSDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQR--IHTGE--------KPYHCSQCGKSFSQKINL---------QSHLRIHTEEKPFPCSECGKTFRESGALKKHQRVHTGEKPYQCSDCGKSFNQQG-SLQSHQRIH---TGEKPYQCSDCGKSFNQQGSLQSHQR---VHTGE-------KPYQCSDCGKSFNQQGSLQSHQRVHTGEKP--YQCSDCGKSFNQQGSLQSHQRIH-TGEKPYHCSECGLRFRH--SFKLFHQRIH-TGEKPYQCSECGRSFRESGALRKHD------CVFLGEKPYHCPVCQKGFTVQGNLQAHLRIHSGEKPFYCSVCGKSFTQHNNFQAHQRIHTGEKPYQCLECGKSFNEQGYFRAHQRV-HTGEKP--YQCLDCGKSFTQQGNLQKHLRIHTGEKPFHCEECGKSFTQQGNLQIHQRVHTGEKPYECSECGKSFTFQTSSLKVHQRIH 655          

HSP 4 Score: 120.553 bits (301), Expect = 5.464e-27
Identity = 133/538 (24.72%), Postives = 205/538 (38.10%), Query Frame = 1
Query: 2344 GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLR-------------------ENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICG-KIVTQISM-HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDY 3852
            G  F+A + L +  +Y  GE      + C  CG +++ L  L  H   H       C+ C         +  HLR H           + K   C  C   +        HQ    G    P K  E  +        + ++  +  TG K + C  C     + G   ++H   K       D  C  C   F     L  H R                   +  +QS + I+ G +  + C  C    + +G +     +H    P  Y C  C +  + +   + HL  H E +  F C EC   F+   ALK H     G K    +CS C K F+    +    R+H  E+        P+ C  C + F  +  LQ+HQ VH G    QC  C K      + + H+  H   + +QC++C  +F  + +++ H R+ H   +P  Y C  CG +      + H  IH   + YQC  CG+ F +S    +H  +  GEKPY C +CQ+ F  + NL  H+  H   +  Y
Sbjct:   26 GKCFSAESQLKTHQRYHTGEKP----YECPDCGKSFTILGHLQRHRRVHTGEKPFQCSDCGKSFYQQSSLKIHLRIHT----------EEKPYSCSECGKTFREDSALKKHQSVHTGEK--PYKCLECGKSFPIESQLKTHQRYH--TGEKPYECLECGKSFSITGH-LLRHQREK------KDYHCLDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTG-EKPYQCSDCGKSFNQQGSLQSHQRIHTGEKP--YHCSQCGKSFSQKINLQSHLRIHTEEK-PFPCSECGKTFRESGALKKHQRVHTGEK--PYQCSDCGKSFNQQGSLQSHQRIHTGEK--------PYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRI-HTGEKP--YHCSECGLRFRHSFKLFHQRIHTGEKPYQCSECGRSFRESGALRKHDCVFLGEKPYHCPVCQKGFTVQGNLQAHLRIHSGEKPFY 521          

HSP 5 Score: 117.472 bits (293), Expect = 5.521e-26
Identity = 143/629 (22.73%), Postives = 238/629 (37.84%), Query Frame = 1
Query: 2044 CVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDG----------VSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNH--LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGL---TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            C  CG+ F A + +  H+  H G   ++C      FT +   + H      E+   C    ++  +Q+   +++     + P  C +C   F +   L+ H  +  G           SF   + L +  +Y  GE      + C  CG ++S    L  H        C  C         +  H R  +H  E        K   C  C   +  + +   HQ    G    P +  +  +   ++ +  +     + TG K + C  C       G+ + + ++++  L   T E    C  C   F     L  H R   + +GE         + C  C    + +G +     +H    P  Y+C  C +    +   + H   H   +  + C +C   F  + +L+ H     G K    +CS C K F+    +    R+H  E+        P+ C  C  +F    +L  HQ +H G    QC  C +  +   A   H       + + C  CQ  F  +  ++ H+R+ H   +P  + C +CGK  TQ      H  IH   + YQC  CGK F +  Y+  H R+H GEKPY+C  C + F ++ NL  H+  H
Sbjct:   22 CSDCGKCFSAESQLKTHQRYHTGEKPYECPDCGKSFTILGHLQRHRRVHTGEKPFQCSDCGKSFYQQSSLKIHLRIHTEEKPYSCSECGKTFREDSALKKHQSVHTGEKPYKCLECGKSFPIESQLKTHQRYHTGEKP----YECLECGKSFSITGHLLRHQREKKDYHCLDCGKSFNQQGSLQSHQR--IHTGE--------KPYQCSDCGKSFNQQGSLQSHQRIHTGEK--PYQCSDCGKSFNQQGS--LQSHQRIHTGEKPYHCSQC-------GKSFSQKINLQSHLRIHTEEKPFPCSECGKTFRESGALKKHQR---VHTGE-------KPYQCSDCGKSFNQQGSLQSHQRIHTGEKP--YQCSDCGKSFNQQGSLQSHQRVHT-GEKPYQCSDCGKSFNQQGSLQSHQRVHTGEK--PYQCSDCGKSFNQQGSLQSHQRIHTGEK--------PYHCSECGLRFRHSFKL-FHQRIHTGEKPYQCSECGRSFRESGALRKHDCVFLGEKPYHCPVCQKGFTVQGNLQAHLRI-HSGEKP--FYCSVCGKSFTQHNNFQAHQRIHTGEKPYQCLECGKSFNEQGYFRAHQRVHTGEKPYQCLDCGKSFTQQGNLQKHLRIH 598          

HSP 6 Score: 91.2781 bits (225), Expect = 5.767e-18
Identity = 68/226 (30.09%), Postives = 99/226 (43.81%), Query Frame = 1
Query: 3244 KQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPER--------------------------YECQICGKIVTQISMHMLIHKNAR--YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            ++ +  CS C K FS   +++ H    H G     P+ C  C + F     LQ H+ VH G    QC  C K      + ++H   H   + + C+EC  TFR   A+++H  V H   +P +                          YEC  CGK  + I+ H+L H+  +  Y C  CGK F +      H RIH GEKPY+C  C + FN++ +L  H   H
Sbjct:   16 EKKEYHCSDCGKCFSAESQLKTH-QRYHTG---EKPYECPDCGKSFTILGHLQRHRRVHTGEKPFQCSDCGKSFYQQSSLKIHLRIHTEEKPYSCSECGKTFREDSALKKHQSV-HTGEKPYKCLECGKSFPIESQLKTHQRYHTGEKPYECLECGKSFS-ITGHLLRHQREKKDYHCLDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRIH 235          

HSP 7 Score: 82.8037 bits (203), Expect = 2.752e-15
Identity = 53/182 (29.12%), Postives = 83/182 (45.60%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            Y+C +C + F    NL SH++IH    T  +  PC  C + F+      KH + +   T  K YQC+ C K       +  H +IH+ E    C  C K F ++     H R HTGEKPY+C  CG  F+++ +   H + H   +     D G     +   +  +++   EK  +  +CG
Sbjct:  269 YHCSQCGKSFSQKINLQSHLRIH----TEEKPFPCSECGKTFRESGALKKHQRVH---TGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSECG 443          

HSP 8 Score: 79.337 bits (194), Expect = 3.192e-14
Identity = 53/173 (30.64%), Postives = 85/173 (49.13%), Query Frame = 1
Query: 3352 FSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDY 3852
            + C  C + F  E++L+ HQ  H G    +C  C K    +   + HR  H   + FQC++C  +F  + +++ H+R+   + E + Y C  CGK   + S    H  +H   + Y+C  CGK F   +    H R H GEKPYEC  C + F    ++  H+  H++ + DY
Sbjct:   20 YHCSDCGKCFSAESQLKTHQRYHTGEKPYECPDCGKSFTILGHLQRHRRVHTGEKPFQCSDCGKSFYQQSSLKIHLRI---HTEEKPYSCSECGKTFREDSALKKHQSVHTGEKPYKCLECGKSFPIESQLKTHQRYHTGEKPYECLECGKSF----SITGHLLRHQREKKDY 185          

HSP 9 Score: 77.7962 bits (190), Expect = 1.015e-13
Identity = 53/185 (28.65%), Postives = 79/185 (42.70%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD----DFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C+ C + F    NL  H++IH    T  +   C+ C + F  +     H + +   T  K Y+C+ C K   F    +K+H      E    C  C K F   S++  H R HTGEKPYKC  CG  F+++  +  H + H   R     D G     +   +  +++   EK      CG S
Sbjct:  576 YQCLDCGKSFTQQGNLQKHLRIH----TGEKPFHCEECGKSFTQQGNLQIHQRVH---TGEKPYECSECGKSFTFQTSSLKVHQRIHTGEKPYHCSDCSKSFGHLSHFKSHRRIHTGEKPYKCSECGKRFNERGYFRAHQRVHTGERPFPCLDCGKSFTQQANLQKHQRIHTGEKPYQCSDCGKS 753          

HSP 10 Score: 75.0998 bits (183), Expect = 6.209e-13
Identity = 120/527 (22.77%), Postives = 188/527 (35.67%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPL-DSKYDPGEALTSECFICGICGLNYSKLDILCSH-----MNNHLSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGE-----------------------YINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQC 3438
            HQ+++   +   C  CG+ F    ++  H+  H G   ++C      F    S +SH      E+   C    ++  +Q     +      + P QC  C   F Q   L+ H  I        C   G+ F     L   +   GE      + C  CG ++ +   L  H           C VC+        +  HLR  +H  E        K   C +C   +    N+  HQ    G    P +  E  +   ++   R ++   + TG K + C  C       G +  KHL +    T E    C  C   F     L  H R   + +GE                        I+ G +  + C  C+  FGH     +H   +H    P  Y+C  C +R  +R  +R H   H   +  F C +C   F  +A L+ H     G K    +CS C K F+    +    RVH  E+        P+ C  C + F F+  L+ HQ +H  +++C
Sbjct:  315 HQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSECGLRFRHSFKLFHQRIHTGEKP----YQCSECGRSFRESGALRKHDCVFLGEKPYHCPVCQKGFTVQGNLQAHLR--IHSGE--------KPFYCSVCGKSFTQHNNFQAHQRIHTGEK--PYQCLECGKSFNEQGYFRAHQR--VHTGEKPYQCLDCGKSFTQQG-NLQKHLRIH---TGEKPFHCEECGKSFTQQGNLQIHQR---VHTGEKPYECSECGKSFTFQTSSLKVHQRIHTG-EKPYHCSDCSKSFGHLSHFKSHRR-IHTGEKP--YKCSECGKRFNERGYFRAHQRVHT-GERPFPCLDCGKSFTQQANLQKHQRIHTGEK--PYQCSDCGKSFTQQGNLTMHQRVHTGEK--------PYECSECGKSFTFQTALRRHQRLHLVVIKC 801          

HSP 11 Score: 72.0182 bits (175), Expect = 5.154e-12
Identity = 51/184 (27.72%), Postives = 79/184 (42.93%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSEPS-IACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C  C + F    +L SH +IH    T  +   C  C + F  +     H + +   T  K Y C+ C K  +    +  H++IH+E     C  C K F++     +H R HTGEKPY+C  CG  F+++ +   H + H   +     D G     +   +  ++V   EK      CG S
Sbjct:  213 YQCSDCGKSFNQQGSLQSHQRIH----TGEKPYQCSDCGKSFNQQGSLQSHQRIH---TGEKPYHCSQCGKSFSQKINLQSHLRIHTEEKPFPCSECGKTFRESGALKKHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKS 389          

HSP 12 Score: 71.2478 bits (173), Expect = 9.503e-12
Identity = 54/185 (29.19%), Postives = 80/185 (43.24%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDF-----GNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C  C + F  L +L  H ++H    T  +   C  C + F  +     H++ +   TE K Y C+ C K     + + +H  +H+ E    C  C K F  +S    H RYHTGEKPY+C  CG  FS       HL RH+  + D+     G     +   +  +++   EK      CG S
Sbjct:   48 YECPDCGKSFTILGHLQRHRRVH----TGEKPFQCSDCGKSFYQQSSLKIHLRIH---TEEKPYSCSECGKTFREDSALKKHQSVHTGEKPYKCLECGKSFPIESQLKTHQRYHTGEKPYECLECGKSFS----ITGHLLRHQREKKDYHCLDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKS 221          

HSP 13 Score: 70.0922 bits (170), Expect = 2.076e-11
Identity = 45/143 (31.47%), Postives = 68/143 (47.55%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            Y+C  C++ FG L +  SH +IH    T  +   C  C + F  +  F  H + +   T  + + C  C K     A + +H +IH+ E    C  C K F ++     H R HTGEKPY+C  CG  F+    +   L+RH+
Sbjct:  661 YHCSDCSKSFGHLSHFKSHRRIH----TGEKPYKCSECGKRFNERGYFRAHQRVH---TGERPFPCLDCGKSFTQQANLQKHQRIHTGEKPYQCSDCGKSFTQQGNLTMHQRVHTGEKPYECSECGKSFT----FQTALRRHQ 792          

HSP 14 Score: 68.9366 bits (167), Expect = 4.348e-11
Identity = 52/191 (27.23%), Postives = 81/191 (42.41%), Query Frame = 1
Query: 5071 NKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            ++++K +Y+C+ C + F    +L SH +IH    T  +   C  C + F  +     H + +   T  K YQC+ C K       +  H +IH+ E    C  C K F +K     HLR HT EKP+ C  CG  F +      H + H   +     D G     +   +  +++   EK      CG S
Sbjct:  178 HQREKKDYHCLDCGKSFNQQGSLQSHQRIH----TGEKPYQCSDCGKSFNQQGSLQSHQRIH---TGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSQCGKSFSQKINLQSHLRIHTEEKPFPCSECGKTFRESGALKKHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKS 361          

HSP 15 Score: 67.781 bits (164), Expect = 1.195e-10
Identity = 52/184 (28.26%), Postives = 78/184 (42.39%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C++C + F    ++  H+  H ++    +   C  C + F  +     H + +   T  K YQC+ C K       +  H +IH+ E    C  C K F ++     H R HTGEKPY C  CG  FS+K N   HL+ H   +     + G   +     K  ++V   EK      CG S
Sbjct:  160 YECLECGKSF----SITGHLLRHQRE---KKDYHCLDCGKSFNQQGSLQSHQRIH---TGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSQCGKSFSQKINLQSHLRIHTEEKPFPCSECGKTFRESGALKKHQRVHTGEKPYQCSDCGKS 333          

HSP 16 Score: 65.855 bits (159), Expect = 3.922e-10
Identity = 46/155 (29.68%), Postives = 71/155 (45.81%), Query Frame = 1
Query: 5053 ESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHSEPS-IACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            +S    + K+K EY+C  C + F     L +H + H    T  +   C  C + F       +H + +   T  K +QC+ C K     + +  H++IH+E    +C  C K F++ S   +H   HTGEKPYKC  CG  F  +     H + H
Sbjct:    7 KSKQENSSKEKKEYHCSDCGKCFSAESQLKTHQRYH----TGEKPYECPDCGKSFTILGHLQRHRRVH---TGEKPFQCSDCGKSFYQQSSLKIHLRIHTEEKPYSCSECGKTFREDSALKKHQSVHTGEKPYKCLECGKSFPIESQLKTHQRYH 154          

HSP 17 Score: 65.855 bits (159), Expect = 4.531e-10
Identity = 44/142 (30.99%), Postives = 70/142 (49.30%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C +C + F T +   S +K+H +  T  +   C  CS+ F +   F  H + +   T  K Y+C+ C K      +   H ++H+ E    C  C K F +++   +H R HTGEKPY+C  CG  F+++ N   H + H
Sbjct:  632 YECSECGKSF-TFQT--SSLKVHQRIHTGEKPYHCSDCSKSFGHLSHFKSHRRIH---TGEKPYKCSECGKRFNERGYFRAHQRVHTGERPFPCLDCGKSFTQQANLQKHQRIHTGEKPYQCSDCGKSFTQQGNLTMHQRVH 767          

HSP 18 Score: 64.3142 bits (155), Expect = 1.255e-9
Identity = 41/129 (31.78%), Postives = 56/129 (43.41%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEF 5466
            Y C  C + F    +L SH +IH    T  +   C  C + F  +     H + +   T  K YQC+ C K       +  H ++H+ E    C  C K F ++     H R HTGEKPY C  CG  F
Sbjct:  325 YQCSDCGKSFNQQGSLQSHQRIH----TGEKPYQCSDCGKSFNQQGSLQSHQRVH---TGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSECGLRF 446          

HSP 19 Score: 61.6178 bits (148), Expect = 7.716e-9
Identity = 67/252 (26.59%), Postives = 94/252 (37.30%), Query Frame = 1
Query: 5053 ESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDL-----------------------TVNEKIPCKHCSQIFQNKILFAKH------MKSYH------------NL-------TETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR-----------DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            +S+ R +  +K  Y C  C + F    +L SH +IH  +                        T  +   C  C + F+      KH       K YH            NL       +  K + C++C K     N    H +IH+ E    C  C K F ++ Y+  H R HTGEKPY+C  CG  F+++ N   HL+ H   +              GN LQI QR      V   EK     +CG S
Sbjct:  397 QSHQRVHTGEK-PYQCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSECGLRFRHSFKLFHQRIHTGEKPYQCSECGRSFRESGALRKHDCVFLGEKPYHCPVCQKGFTVQGNLQAHLRIHSGEKPFYCSVCGKSFTQHNNFQAHQRIHTGEKPYQCLECGKSFNEQGYFRAHQRVHTGEKPYQCLDCGKSFTQQGNLQKHLRIHTGEKPFHCEECGKSFTQQGN-LQIHQR------VHTGEKPYECSECGKS 640          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ENSAMXT00000033422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001296.1:17993:22342:1 gene:ENSAMXG00000039879.1 transcript:ENSAMXT00000033422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.806 bits (338), Expect = 5.054e-31
Identity = 156/641 (24.34%), Postives = 249/641 (38.85%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCN------AEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            HQ+I+   +   C  CG+ F   + +  H+  H G   + C     +FT   + K H      E+   C    +    Q+   ++        P  C  C   F     L++H  I        C   G SF  ++ L         +    + C  CG  ++    L  H   H       C+ C     +   +  H R  +H  E        K   C  C   + T+     HQ    G    P +  +  +    +   ++++   + TG+K + C  C       + +K+  R +          T E    C  C  IF T   L  H R         I+ G++  +  D    F     +  H   +H    P  Y C  C +    +   +IH   H   +  + C +C   F  ++ALK+H     GVK     CS C K F+    +++H    H G   + P+ C  C + F  ++ L+ HQ +H G+    C  C K+  +  A ++H+  H   + + C++C   F ++ A++ H R+ H   +P  Y C  CGKI T  S   +H  IH   + Y C  CGK FT  +    H RIH GEKPY C  C + FN++S L +H   H
Sbjct:   76 HQRIHTGEKPYHCSDCGKSFNQQSTLKKHQRIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKP--YYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQR--IHTGE--------KPYHCSDCGKIFTTQSALKIHQRIHTGE--KPYRCSDCGKSFTTQSALKIHQR--IHTGVKPYYCSDCGKIFTTQSALKIHQRIH----------TGEKPYYCSDCGKIFTTQSALKIHQR---------IHTGVKPYYCSDCGKIFTTQSALKIHQ-RIHTGVKP--YYCSDCGKIFTTQSALKIHQRIHTGVK-PYYCSDCGKIFTTQSALKIHQRIHTGVK--PYYCSDCGKIFTTQSALKIH-QRIHTG---VKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRI-HTGEKP--YHCSDCGKIFTTQSALKIHQCIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKIHQRIH 668          

HSP 2 Score: 130.568 bits (327), Expect = 9.037e-30
Identity = 152/628 (24.20%), Postives = 229/628 (36.46%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDH--LHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDY 3852
            HQ+I+   +   C  CG+ F   + +  H+  H G+  + C     +FT   + K H                     ++       C  C K    F     L++H  I  GV                    + + C  CG  ++    L  H   H       C+ C    G I      L+ H  +H  E        K   C  C   + T+     HQ    G    P    +  +   ++ T ++++   + TG+K + C  C         +  KH  +  G   E    C  C  IF T   L  H R   I +GE         + C  C      +  +     +H    P  Y C  C +    +   ++H   H   +  + C +C   F  ++ALK+H     G K     CS C K F+    +++H    H G     P+ C  C + F  ++ L  HQ +H G     C  C K          H+  H   + + C++C  +F  +  +  H R+ H   +P  Y C  CGK   Q S    H  IH   + Y C  CGK FTK +  N H RIH GEKPY C  C + FN++S LN H   H   +  Y
Sbjct:  468 HQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQR-------------------IHTGVKPYYCSDCGK---IFTTQSALKIHQRIHTGV--------------------KPYYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDC----GKIFTTQSALKIHQCIHTGE--------KPYHCSDCGKIFTTQSALKIHQRIHTGE--KPYHCSDCGKSFNQQSTLKIHQR--IHTGVKPYYCSDCGKSFNQQS-NLKKHQRIHTG---EKPYYCSDCGKIFTTQSALKIHQR---IHTGE-------KPYRCSDCGKSFTTQSALKIHQRIHTGVKP--YHCSDCGKSFNQQSTLKLHQRIHT-GEKPYHCSDCGKIFTTQSALKIHQRIHTGEK--PYHCSDCGKSFNQQSTLKIH-QRIHTG---EKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRI-HTGEKP--YHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFTKQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYY 1011          

HSP 3 Score: 126.716 bits (317), Expect = 1.615e-28
Identity = 156/645 (24.19%), Postives = 246/645 (38.14%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEAL--------TSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVH------PPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCN------AEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            HQ+I+   +   C  CG+ F   + +  H+  H G+  + C     +FT   + K H      E+   C    ++  +Q+    +      + P  C  C   F     L++H  I  G      +     +    AL          + + C  CG  ++    L  H   H       C+ C     +   +  H R H             K   C  C   + T+     HQ    GV          I T +SA  +++R          + TG K + C  C       + +K+  R +          T E    C  C   F T   L  H R         I+ G++  +  D    F     +  H   +H    P  Y C  C +    +   +IH   H   +  + C +C   F  ++ALK+H     GVK     CS C K F+    +++H    H G   + P+ C  C + F  ++ L+ HQ +H G+    C  C K+  +  A ++H+  H   + + C++C   F ++ A++ H R+ H  ++P  Y C  CGKI T  S   +H  IH   + Y C  CGK FT  +    H RIH GEKPY C  C + F  +S L +H   H
Sbjct:   20 HQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKKHQRIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHT----------GVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQR----------IHTGEKPYHCSDCGKIFTTQSALKIHQRIH----------TGEKPYRCSDCGKSFTTQSALKIHQR---------IHTGVKPYYCSDCGKIFTTQSALKIHQ-RIHTGEKP--YYCSDCGKIFTTQSALKIHQRIHTGVK-PYYCSDCGKIFTTQSALKIHQRIHTGVK--PYYCSDCGKIFTTQSALKIH-QRIHTG---VKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRI-HTGVKP--YYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKIFTTQSALKIHQCIH 612          

HSP 4 Score: 124.02 bits (310), Expect = 1.119e-27
Identity = 150/635 (23.62%), Postives = 228/635 (35.91%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            HQ+I+   +   C  CG+ F   + + +H+  H G   + C      F    +  +H                     ++       C  C K    F Q   L  H  I        C   G SFN ++ L++  +   GE      + C  CG +++K   L +H   H       C+ C         ++ H R  +H  E        K   C  C   +  +     HQ    G    P    +  +   K+ T  +N    + TG K + C  C         +  KH  +  G   E    C  C   F     L  H R   I +GE         + C  C    + +  + +   +H    P  Y C  C +    +     H   H   +  + C +C   F  ++ L  H     G K     CS C K F+    +    R+H  E+        P+ C  C + F  ++ L  HQ +H G     C  C K          H+  H   + + C++C  +F  +  +++H R+ H   +P  Y C  CGK   Q S    H  IH   + Y C  CGK F + +  N H RIH GEKPY C  C + FN++SNL  H   H
Sbjct:  832 HQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQR-------------------IHTGEKPYHCSDCGKS---FNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKP----YHCSDCGKSFTKQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQR--IHTGE--------KPYYCSDCGKSFNQQSTLNNHQRIHTGE--KPYYCSDCGKSFTKQST--LNNHQRIHTGEKPYHCSDCGKSFNQQS-NLKKHQRIHTG---EKPYHCSDCGKSFNQQSNLKKHQR---IHTGE-------KPYHCSDCGKSFNQQSTLNNHQRIHTGEKP--YYCSDCGKSFNQQSTLNNHQRIHT-GEKPYYCSDCGKSFNQQSTLNNHQRIHTGEK--PYYCSDCGKSFNQQSTLNNHQRIHTGEK--------PYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNYHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRI-HTGEKP--YHCSDCGKSFNQQSNLKKHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIH 1396          

HSP 5 Score: 123.635 bits (309), Expect = 1.207e-27
Identity = 96/330 (29.09%), Postives = 145/330 (43.94%), Query Frame = 1
Query: 2881 CRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDY 3852
            C  C  IF T   L  H R   I +GE         + C  C    + +  +     +H    P  Y C  C +    +   +IH   H   +  + C +C   F  ++ALK+H     GVK     CS C K F+    +++H    H G     P+ C  C + F  ++ L+ HQ +H G+    C  C K+  +  A ++H+  H   + + C++C   F ++ A++ H R+ H   +P  Y C  CGKI T  S   +H  IH   + Y+C  CGK FT  +    H RIH G KPY C  C + F  +S L +H   H   +  Y
Sbjct:   60 CSDCGKIFTTQSALKIHQR---IHTGE-------KPYHCSDCGKSFNQQSTLKKHQRIHTGEKP--YHCSDCGKIFTTQSALKIHQRIHT-GEKPYYCSDCGKIFTTQSALKIHQRIHTGVK--PYYCSDCGKIFTTQSALKIH-QRIHTG---EKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRI-HTGEKP--YHCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYY 367          

HSP 6 Score: 123.25 bits (308), Expect = 1.479e-27
Identity = 148/632 (23.42%), Postives = 231/632 (36.55%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVK---HGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            HQ+I+   +   C  CG+ F   + +  H+  H G+  + C     +FT   + K H      E+   C    +    Q+   ++      + P  C  C   F     L++H  I  G                     + + C  CG ++++   L  H   H       C+ C         + +H R  +H  E        K   C  C   + T+     HQ    G    P +  +  +    +   ++++   + TG+K + C  C       G+ + +   +K      T E    C  C  IF T   L  H R   I +GE         + C  C    + +  +     +H    P  Y C  C +    +     H   H   +  + C +C   F  ++ L  H     G K     CS C K F+    +    R+H  E+        P+ C  C + F  ++ L  HQ +H G     C  C K          H+  H   + + C++C  +F  +  +  H R+ H   +P  Y C  CGK   Q S    H  IH   + Y C  CGK FTK +  N H RIH GEKPY C  C + FN++SNL  H   H
Sbjct:  524 HQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKIFTTQSALKIHQCIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTG--------------------EKPYHCSDCGKSFNQQSTLKIHQRIHTGVKPYYCSDCGKSFNQQSNLKKHQR--IHTGE--------KPYYCSDCGKIFTTQSALKIHQRIHTGE--KPYRCSDCGKSFTTQSALKIHQR--IHTGVKPYHCSDC-------GKSFNQQSTLKLHQRIHTGEKPYHCSDCGKIFTTQSALKIHQR---IHTGE-------KPYHCSDCGKSFNQQSTLKIHQRIHTGEKP--YHCSDCGKSFNQQSTLNNHQRIHT-GEKPYHCSDCGKSFNQQSTLNNHQRIHTGEK--PYHCSDCGKSFNQQSTLNNHQRIHTGEK--------PYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFTKQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRI-HTGEKP--YYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFTKQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIH 1088          

HSP 7 Score: 121.709 bits (304), Expect = 5.574e-27
Identity = 97/346 (28.03%), Postives = 149/346 (43.06%), Query Frame = 1
Query: 2821 RDYVKHLDVKHGLTVELDT---LCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            + + K  D+K    +        C  C  IF T   L  H R         I+ G++  +  D    F     +  H   +H    P  Y C  C +    +   + H   H   +  + C +C   F  ++ALK+H     G K     CS C K F+    +++H    H G   + P+ C  C + F  ++ L+ HQ +H G    +C  C K   +  A ++H+  H   + + C++C   F ++ A++ H R+ H  ++P  Y C  CGKI T  S   +H  IH   + Y C  CGK FT  +    H RIH GEKPY C  C + F  +S L +H   H
Sbjct:    9 KSFTKQSDLKKHQRIHTGVKPYYCSDCGKIFTTQSALKIHQR---------IHTGVKPYYCSDCGKIFTTQSALKIHQ-RIHTGEKP--YHCSDCGKSFNQQSTLKKHQRIHT-GEKPYHCSDCGKIFTTQSALKIHQRIHTGEK--PYYCSDCGKIFTTQSALKIH-QRIHTG---VKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRI-HTGVKP--YYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIH 332          

HSP 8 Score: 121.324 bits (303), Expect = 6.015e-27
Identity = 152/648 (23.46%), Postives = 234/648 (36.11%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVS----------FNARTPLD--SKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDY 3852
            HQ+I+   +   C  CG+ F   +N+  H+  H G   + C     +FT   + K H      E+   C    ++   Q+   ++        P  C  C   F Q   L+LH  I  G            F  ++ L    +   GE      + C  CG ++++   L  H   H       C+ C         ++ H R  +H  E        K   C  C   +  +     HQ    G    P    +  +   ++ T  +N    + TG K + C  C             H  +  G   E    C  C   F     L++H R   I +GE         + C  C    + +  + +   +H    P  Y C  C +    +     H   H   +  + C +C   F  ++ L  H     G K     CS C K F+    +    R+H  E+        P+ C  C + F  ++ L+ HQ +H G     C  C K          H+  H   + + C++C  +F  +  +  H R+ H   +P  Y C  CGK   Q S    H  IH   + Y C  CGK F + +  N H RIH GEKPY C  C + FN++S LN H   H   +  Y
Sbjct:  664 HQRIHTGVKPYYCSDCGKSFNQQSNLKKHQRIHTGEKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYHCSDCGKSFNQQSTLKLHQRIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKP----YHCSDCGKSFNQQSTLKIHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQR--IHTGE--------KPYHCSDCGKSFNQQSTLNNHQRIHTGE--KPYHCSDCGKSFNQQST--LNNHQRIHTGEKPYHCSDCGKSFNQQS-TLNNHQRIHTG---EKPYHCSDCGKSFTKQSTLNNHQR---IHTGE-------KPYHCSDCGKSFNQQSTLNNHQRIHTGEKP--YYCSDCGKSFNQQSTLNNHQRIHT-GEKPYYCSDCGKSFTKQSTLNNHQRIHTGEK--PYHCSDCGKSFNQQSNLKKHQRIHTGEK--------PYHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRI-HTGEKP--YYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYY 1263          

HSP 9 Score: 119.783 bits (299), Expect = 1.980e-26
Identity = 152/648 (23.46%), Postives = 238/648 (36.73%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDY 3852
            HQ+I+   +   C  CG+ F   + +  H+  H G   + C     +FT   + K H      E+   C    ++  +Q+   ++      + P  C  C   F Q   L  H  I        C   G SFN ++ L++  +   GE      + C  CG ++++   L +H   H       C+ C         ++ H R  +H  E        K   C  C   +  +     HQ    G    P    +  +   ++ T  +N    + TG K + C  C             H  +  G   E    C  C   F     L++H R   I +GE         + C  C    + +  +     +H    P  Y C  C +    +   + H   H   +  + C +C   F  ++ L  H     G K     CS C K F+    +    R+H  E+        P+ C  C + F  ++ L  HQ +H G     C  C K          H+  H   + + C++C  +F  +  +  H R+ H   +P  Y C  CGK   Q S    H  IH   + Y C  CGK F + +   +H RIH GEKPY C  C + FN++SNL  H   H   +  Y
Sbjct:  748 HQRIHTGVKPYHCSDCGKSFNQQSTLKLHQRIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKIHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKP----YHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQR--IHTGE--------KPYHCSDCGKSFTKQSTLNNHQRIHTGE--KPYHCSDCGKSFNQQST--LNNHQRIHTGEKPYYCSDCGKSFNQQS-TLNNHQRIHTG---EKPYYCSDCGKSFTKQSTLNNHQR---IHTGE-------KPYHCSDCGKSFNQQSNLKKHQRIHTGEKP--YHCSDCGKSFNQQSNLKKHQRIHT-GEKPYHCSDCGKSFNQQSTLNNHQRIHTGEK--PYYCSDCGKSFNQQSTLNNHQRIHTGEK--------PYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRI-HTGEKP--YYCSDCGKSFNQQSTLNYHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYY 1347          

HSP 10 Score: 119.013 bits (297), Expect = 3.578e-26
Identity = 156/666 (23.42%), Postives = 241/666 (36.19%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGV----------SFNARTPLD--SKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLH-KNENVSGPGK-----------------RKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDY 3852
            HQ+I+   +   C  CG+ F   + +  H+  H G   + C     +FT   + K H      E+   C    +    Q+   ++      + P  C  C   F Q   L++H  I  GV          SFN ++ L    +   GE      + C  CG  ++    L  H   H       C+ C     +   +  H R H   K  + S  GK                  K   C  C   + T+     HQ    G    P    +  +   ++ T ++++   + TG K + C  C             H  +  G   E    C  C   F     L++H R   I +GE         + C  C    + +  + +   +H    P  Y C  C +    +     H   H   +  + C +C   F  ++ L  H     G K     CS C K F+    +    R+H  E+        P+ C  C + F  ++ L  HQ +H G     C  C K          H+  H   + + C++C  +F  +  +++H R+ H   +P  Y C  CGK   Q S    H  IH   + Y C  CGK F + +  N H RIH GEKPY C  C + FN++S LN H   H   +  Y
Sbjct:  552 HQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKIFTTQSALKIHQCIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKIHQRIHTGVKPYYCSDCGKSFNQQSNLKKHQRIHTGEKP----YYCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYHCSDCGKSFNQQSTLKLHQRIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGE--KPYHCSDCGKSFNQQSTLKIHQR--IHTGEKPYHCSDCGKSFNQQS-TLNNHQRIHTG---EKPYHCSDCGKSFNQQSTLNNHQR---IHTGE-------KPYHCSDCGKSFNQQSTLNNHQRIHTGEKP--YHCSDCGKSFNQQSTLNNHQRIHT-GEKPYHCSDCGKSFTKQSTLNNHQRIHTGEK--PYHCSDCGKSFNQQSTLNNHQRIHTGEK--------PYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFTKQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRI-HTGEKP--YHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYY 1179          

HSP 11 Score: 81.2629 bits (199), Expect = 1.183e-14
Identity = 129/604 (21.36%), Postives = 215/604 (35.60%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSA 3720
            HQ+I+   +   C  CG+ F   + + +H+  H G   + C      F    +  +H      E+   C    ++  +Q+    +      + P  C  C   F +   L  H  I        C   G SFN ++ L++  +   GE      + C  CG ++++   L +H   H       C+ C         ++ H R  +H  E        K   C  C   +  + N   HQ    G    P    +  +   ++   + ++   + TG K + C  C             H  +  G   E    C  C   F     L++H R   I +GE         + C  C    + +  + +   +H    P  Y C  C +    +     H   H   +  + C +C   F  ++ L  H     G K     CS C K F+    +    R+H  E+        P+ C  C + F  ++ L+ HQ +H G     C  C K        + H+  H   + + C++C  +F  +  +  H R+ H   +P  Y C  CGK   Q S    H  IH   + Y C  CGK F + +
Sbjct:  860 HQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFTKQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKP----YYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFTKQSTLNNHQR--IHTGE--------KPYHCSDCGKSFNQQSNLKKHQRIHTGE--KPYHCSDCGKSFNQQSNLKKHQR--IHTGEKPYHCSDCGKSFNQQS-TLNNHQRIHTG---EKPYYCSDCGKSFNQQSTLNNHQR---IHTGE-------KPYYCSDCGKSFNQQSTLNNHQRIHTGEKP--YYCSDCGKSFNQQSTLNNHQRIHT-GEKPYYCSDCGKSFNQQSTLNNHQRIHTGEK--PYYCSDCGKSFNQQSTLNYHQRIHTGEK--------PYHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRI-HTGEKP--YHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQS 1415          

HSP 12 Score: 75.8702 bits (185), Expect = 4.837e-13
Identity = 55/184 (29.89%), Postives = 81/184 (44.02%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y+C  C + F     LN+H +IH    T  +   C  C + F  +     H + +   T  K Y C+ C K     + +N H +IH+ E    C  C K F ++S    H R HTGEKPY C  CG  F+K+   N+H + H   +     D G     +   K  +++   EK  +   CG S
Sbjct:  926 YHCSDCGKSFNQQSTLNNHQRIH----TGEKPYHCSDCGKSFTKQSTLNNHQRIH---TGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFTKQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKS 1102          

HSP 13 Score: 73.1738 bits (178), Expect = 2.679e-12
Identity = 44/127 (34.65%), Postives = 65/127 (51.18%), Query Frame = 1
Query: 3484 HRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDY 3852
            H+  H   + + C++C   F ++ A++ H R+ H  ++P  Y C  CGKI T  S   +H  IH   + Y C  CGK F + +   +H RIH GEKPY C  C + F  +S L +H   H   +  Y
Sbjct:   20 HQRIHTGVKPYYCSDCGKIFTTQSALKIHQRI-HTGVKP--YYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKKHQRIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYY 143          

HSP 14 Score: 73.1738 bits (178), Expect = 3.252e-12
Identity = 47/142 (33.10%), Postives = 67/142 (47.18%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y+C  C + F     LN+H +IH    T  +   C  C + F  +     H + +   T  K Y C+ C K     + +N H +IH+ E    C  C K F ++S    H R HTGEKPY C  CG  F+K+   N+H + H
Sbjct:  842 YHCSDCGKSFNQQSTLNNHQRIH----TGEKPYHCSDCGKSFNQQSTLNNHQRIH---TGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFTKQSTLNNHQRIH 976          

HSP 15 Score: 72.7886 bits (177), Expect = 4.296e-12
Identity = 55/184 (29.89%), Postives = 79/184 (42.93%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y+C  C + F    NL  H +IH    T  +   C  C + F  +    KH + +   T  K Y C+ C K     + +N H +IH+ E    C  C K F ++S    H R HTGEKPY C  CG  F+++   N+H + H      Y  D G     +      +++   EK      CG S
Sbjct: 1066 YHCSDCGKSFNQQSNLKKHQRIH----TGEKPYHCSDCGKSFNQQSNLKKHQRIH---TGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKS 1242          

HSP 16 Score: 71.633 bits (174), Expect = 9.651e-12
Identity = 54/184 (29.35%), Postives = 80/184 (43.48%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y+C  C + F     LN+H +IH    T  +   C  C + F  +     H + +   T  K Y C+ C K     + +N H +IH+ E    C  C K F ++S    H R HTGEKPY C  CG  F+++   N+H + H      Y  D G     +      +++   EK  +   CG S
Sbjct: 1122 YHCSDCGKSFNQQSTLNNHQRIH----TGEKPYYCSDCGKSFNQQSTLNNHQRIH---TGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNYHQRIHTGEKPYHCSDCGKS 1298          

HSP 17 Score: 70.4774 bits (171), Expect = 2.150e-11
Identity = 53/184 (28.80%), Postives = 81/184 (44.02%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C  C + F     LN+H +IH    T  +   C  C + F  +     H + +   T  K Y C+ C K     + + +H +IH+ E    C  C K F ++S   +H R HTGEKPY C  CG  F+++   N+H + H   +     D G     +   K  +++   EK  +   CG S
Sbjct: 1234 YYCSDCGKSFNQQSTLNNHQRIH----TGEKPYYCSDCGKSFNQQSTLNYHQRIH---TGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKS 1410          

HSP 18 Score: 68.9366 bits (167), Expect = 6.542e-11
Identity = 53/184 (28.80%), Postives = 79/184 (42.93%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C  C + F     LN+H +IH    T  +   C  C + F  +     H + +   T  K Y C+ C K     + + +H +IH+ E    C  C K F ++S   +H R HTGEKPY C  CG  F+++   N+H + H      Y  D G     +      +++   EK      CG S
Sbjct: 1010 YYCSDCGKSFNQQSTLNNHQRIH----TGEKPYYCSDCGKSFTKQSTLNNHQRIH---TGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKS 1186          

HSP 19 Score: 67.0106 bits (162), Expect = 2.317e-10
Identity = 44/132 (33.33%), Postives = 63/132 (47.73%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKK 5475
            Y+C  C + F    NL  H +IH    T  +   C  C + F  +    KH + +   T  K Y C+ C K     + +N H +IH+ E    C  C K F ++S   +H R HTGEKPY C  CG  F+++
Sbjct: 1290 YHCSDCGKSFNQQSNLKKHQRIH----TGEKPYHCSDCGKSFNQQSNLKKHQRIH---TGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQ 1414          

HSP 20 Score: 65.0846 bits (157), Expect = 8.415e-10
Identity = 54/184 (29.35%), Postives = 77/184 (41.85%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C  C ++F T   L  H +IH    T  +   C  C +IF  +     H   +   T  K Y C+ C K+    + +  H +IH+ E    C  C K F ++S    H R HTG KPY C  CG  F+++ N   H + H      Y  D G     +   K  +++   EK      CG S
Sbjct:  562 YYCSDCGKIFTTQSALKIHQRIH----TGEKPYHCSDCGKIFTTQSALKIHQCIH---TGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKIHQRIHTGVKPYYCSDCGKSFNQQSNLKKHQRIHTGEKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKS 738          

HSP 21 Score: 64.6994 bits (156), Expect = 9.960e-10
Identity = 52/184 (28.26%), Postives = 78/184 (42.39%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C  C + F T   L  H +IH    T  +   C  C + F  +     H + +   T  K Y C+ C K+    + +  H +IH+ E    C  C K F ++S    H R HTGEKPY C  CG  F+++   N+H + H   +     D G     +      +++   EK  +   CG S
Sbjct:  730 YRCSDCGKSFTTQSALKIHQRIH----TGVKPYHCSDCGKSFNQQSTLKLHQRIH---TGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKIHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKS 906          

HSP 22 Score: 64.6994 bits (156), Expect = 1.219e-9
Identity = 117/572 (20.45%), Postives = 195/572 (34.09%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CD--GVSFNARTPLDS--KYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCN-----------------AEVKVAGRDYVKHLDVKHGL-------TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEI----RVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMR 3564
            HQ+I+   +   C  CG+ F   + + +H+  H G   + C      F    +  +H      E+   C    ++  +Q+    +      + P  C  C   F Q   L  H  I        C   G SFN ++ L++  +   GE      + C  CG +++K   L +H   H       C+ C         + +H R  +H  E        K   C  C   +  + N   HQ    G    P    +  +   ++ T  +N    + TG K + C  C                   E      D  K  + +  L       T E    C  C   F     L++H R   I +GE         + C  C    + +  + +   +H    P  Y C  C +    +     H   H   +  + C +C   F  ++ LK H     G K     CS C K F+    +    R+H  E+        P+ C  C + F  ++ L  HQ +H G     C  C K        + H+  H   + + C++C  +F  +  ++
Sbjct:  888 HQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFTKQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKP----YYCSDCGKSFTKQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQR--IHTGE--------KPYHCSDCGKSFNQQSNLKKHQRIHTGE--KPYHCSDCGKSFNQQST--LNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQRIHTGEKPYYCSDCGKSFNQQSTLNNHQR---IHTGE-------KPYYCSDCGKSFNQQSTLNNHQRIHTGEKP--YYCSDCGKSFNQQSTLNYHQRIHT-GEKPYHCSDCGKSFNQQSNLKKHQRIHTGEK--PYHCSDCGKSFNQQSNLKKHQRIHTGEK--------PYYCSDCGKSFNQQSTLNNHQRIHTGEKPYHCSDCGKSFNQQSNLKKHQRIHTGEKPYHCSDCGKSFNQQSTLK 1418          

HSP 23 Score: 62.003 bits (149), Expect = 7.404e-9
Identity = 51/182 (28.02%), Postives = 77/182 (42.31%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            Y+C  C ++F T   L  H +IH    T  +   C  C + F  +     H + +   T  K Y C+ C K     + + +H +IH+ E    C  C K F  +S    H R HTGEKPY+C  CG  F+ +     H + H   +     D G     +   K  +++   EK  +   CG
Sbjct:  618 YHCSDCGKIFTTQSALKIHQRIH----TGEKPYHCSDCGKSFNQQSTLKIHQRIH---TGVKPYYCSDCGKSFNQQSNLKKHQRIHTGEKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYHCSDCGKSFNQQSTLKLHQRIHTGEKPYHCSDCG 792          

HSP 24 Score: 62.003 bits (149), Expect = 8.545e-9
Identity = 53/182 (29.12%), Postives = 75/182 (41.21%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            Y C  C + F T   L  H +IH    T  +   C  C +IF  +     H + +   T  K Y C+ C K+    + +  H +IH+ E    C  C K F  +S    H R HTGEKPY+C  CG  F+ +     H + H      Y  D G     +   K  +++   EK      CG
Sbjct:  198 YRCSDCGKSFTTQSALKIHQRIH----TGVKPYYCSDCGKIFTTQSALKIHQRIH---TGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYYCSDCG 372          

HSP 25 Score: 61.6178 bits (148), Expect = 8.838e-9
Identity = 54/184 (29.35%), Postives = 76/184 (41.30%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            Y C  C ++F T   L  H +IH    T  +   C  C +IF  +     H + +   T  K Y C+ C K     + + +H +IH+ E    C  C K F  +S    H R HTGEKPY C  CG  F+ +     H + H      Y  D G     +   K  +++   EK      CG S
Sbjct:   30 YYCSDCGKIFTTQSALKIHQRIH----TGVKPYYCSDCGKIFTTQSALKIHQRIH---TGEKPYHCSDCGKSFNQQSTLKKHQRIHTGEKPYHCSDCGKIFTTQSALKIHQRIHTGEKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKS 206          

HSP 26 Score: 58.151 bits (139), Expect = 1.071e-7
Identity = 41/130 (31.54%), Postives = 58/130 (44.62%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFS 5469
            Y+C  C + F     L  H +IH    T  +   C  C +IF  +     H + +   T  K Y C+ C K+    + +  H +IH+      C  C K F  +S    H R HTGEKPY+C  CG  F+
Sbjct:   86 YHCSDCGKSFNQQSTLKKHQRIH----TGEKPYHCSDCGKIFTTQSALKIHQRIH---TGEKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYRCSDCGKSFT 208          

HSP 27 Score: 55.8398 bits (133), Expect = 6.338e-7
Identity = 42/130 (32.31%), Postives = 58/130 (44.62%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFS 5469
            Y C  C ++F T   L  H +IH    T  +   C  C +IF  +     H + +   T  K Y+C+ C K     + +  H +IH+      C  C K F  +S    H R HTGEKPY C  CG  F+
Sbjct:  254 YYCSDCGKIFTTQSALKIHQRIH----TGEKPYHCSDCGKIFTTQSALKIHQRIH---TGEKPYRCSDCGKSFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYYCSDCGKIFT 376          

HSP 28 Score: 55.0694 bits (131), Expect = 8.441e-7
Identity = 51/182 (28.02%), Postives = 74/182 (40.66%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            Y C  C ++F T   L  H +IH    T  +   C  C +IF  +     H + +   T  K Y C+ C K+    + +  H +IH+      C  C K F  +S    H R HTG KPY C  CG  F+ +     H + H      Y  D G     +   K  +++   EK  +   CG
Sbjct:  422 YYCSDCGKIFTTQSALKIHQRIH----TGVKPYYCSDCGKIFTTQSALKIHQRIH---TGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCG 596          

HSP 29 Score: 53.5286 bits (127), Expect = 3.090e-6
Identity = 39/123 (31.71%), Postives = 57/123 (46.34%), Query Frame = 1
Query: 5113 EVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFS 5469
            + F    +L  H +IH    T  +   C  C +IF  +     H + +   T  K Y C+ C K+    + +  H +IH+ E    C  C K F ++S   +H R HTGEKPY C  CG  F+
Sbjct:    9 KSFTKQSDLKKHQRIH----TGVKPYYCSDCGKIFTTQSALKIHQRIH---TGVKPYYCSDCGKIFTTQSALKIHQRIHTGEKPYHCSDCGKSFNQQSTLKKHQRIHTGEKPYHCSDCGKIFT 124          

HSP 30 Score: 51.9878 bits (123), Expect = 7.298e-6
Identity = 41/130 (31.54%), Postives = 57/130 (43.85%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFS 5469
            Y C  C ++F T   L  H +IH    T  +   C  C +IF  +     H + +   T  K Y C+ C K+    + +  H +IH+      C  C K F  +S    H R HTG KPY C  CG  F+
Sbjct:  366 YYCSDCGKIFTTQSALKIHQRIH----TGVKPYYCSDCGKIFTTQSALKIHQRIH---TGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFTTQSALKIHQRIHTGVKPYYCSDCGKIFT 488          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ENSAMXT00000050172.1 (zinc finger protein 883-like [Source:NCBI gene;Acc:103025136])

HSP 1 Score: 132.88 bits (333), Expect = 5.075e-31
Identity = 85/258 (32.95%), Postives = 126/258 (48.84%), Query Frame = 1
Query: 3076 LYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMM--QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            LY C  C          +IH+  H   +  F C  C   F    +L++H     G K    KC+ C K F +S ++  H L  H G   + PF C  C + FL  + L  H+ +H G    QC +C+K   +  +   H+  H + R F C+ C  +F +   ++ H+R  H   +P  Y+C  CGK  TQ   +++H  +H + + YQC  C K FT + Y  +H +IH GEKPYEC +CQ++FN  S L  H   H
Sbjct:  233 LYTCSECGRSYPTSSYLKIHMRIHT-GERPFKCTHCGKAFNQSGSLRIHQRIHTGEK--PYKCTQCHKTFISSGQLTTH-LRGHAG---IKPFRCSECGKSFLESSALTIHRRIHTGQKPYQCTVCEKCFTTSSSLANHQAMHKKKRPFPCSLCSLSFTTLGKLKIHLRT-HTGEKP--YKCLQCGKTFTQSGSLTVHQKLHASDQVYQCSQCDKTFTCTVYLKKHQKIHTGEKPYECKLCQKKFNLLSALKTHERTH 480          

HSP 2 Score: 114.775 bits (286), Expect = 2.583e-25
Identity = 130/491 (26.48%), Postives = 194/491 (39.51%), Query Frame = 1
Query: 2416 FICGICGLNYSKLDILCSHMNNHLSCNVCK-TRLGSIDEVSQHLRDH--LHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEE---NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQE-IRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHG--GMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDD 3849
            + C  CG +Y     L  HM  H      K T  G     S  LR H  +H  E        K   C  C+  + +      H     G+   P +  E  +   +     ++    + TG K + C  C  E        + +    H         C +C+  F T  +L  HLR     +GE         + C +C       G +     +HA     +Y+C  C +         ++L+KH++    +  + C  CQ  F   +ALK H  T  G K    +C  C K FS+S   IR  I+  H G     P  C  C +KF + + L+ HQ VH       C  C K    +   + H   H   + +QC+ CQ TF +   + RH  V H   +P  +EC  CGK   ++S   +H  +H N + Y C  C K F  S+    H R H GEKPY+C  C++ F +  +L  H   H K + +
Sbjct:  234 YTCSECGRSYPTSSYLKIHMRIHTGERPFKCTHCGKAFNQSGSLRIHQRIHTGE--------KPYKCTQCHKTFISSGQLTTHLRGHAGI--KPFRCSECGKSFLESSALTIHR--RIHTGQKPYQCTVC--EKCFTTSSSLANHQAMHKKKRPFP--CSLCSLSFTTLGKLKIHLR---THTGE-------KPYKCLQCGKTFTQSGSLTVHQKLHASDQ--VYQCSQCDKTFT----CTVYLKKHQKIHTGEKPYECKLCQKKFNLLSALKTHERTHTGEK--PYQCMTCGKCFSSSASLIRHRII--HTG---KQPHQCPTCGKKFSYPSLLKKHQRVHTQEKPYPCSHCDKAFAVLSGLKAHERTHTGEKPYQCSVCQKTFSNSSILARHQSV-HTGEKP--HECSTCGKSFPRLSNLRVHQRVHTNEKPYSCPQCDKTFAHSSSLKVHQRNHTGEKPYQCSNCEKSFTQLGHLQSHQRTHSKKKKE 682          

HSP 3 Score: 72.0182 bits (175), Expect = 5.046e-12
Identity = 46/153 (30.07%), Postives = 73/153 (47.71%), Query Frame = 1
Query: 5080 QKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDF 5526
            Q+  Y C  C++ F  L  L +H + H    T  +   C  C + F N  + A+H +S H  T  K ++C+ C K    ++ +  H ++H+ E   +C  CDK F   S    H R HTGEKPY+C  C   F++  +   H + H   + + 
Sbjct:  538 QEKPYPCSHCDKAFAVLSGLKAHERTH----TGEKPYQCSVCQKTFSNSSILARH-QSVH--TGEKPHECSTCGKSFPRLSNLRVHQRVHTNEKPYSCPQCDKTFAHSSSLKVHQRNHTGEKPYQCSNCEKSFTQLGHLQSHQRTHSKKKKEV 683          

HSP 4 Score: 71.2478 bits (173), Expect = 7.930e-12
Identity = 112/514 (21.79%), Postives = 173/514 (33.66%), Query Frame = 1
Query: 2041 SCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTS--------ECFICGICGLNYSKLDILCSHMNNH--------LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTR 3510
            +C  CGR +  S+ +  H   H G   FKC      F    S + H      E+   C    +T +   Q   ++       P +C +C   F ++  L +H  I  G      T  +  +    +L +          F C +C L+++ L  L  H+  H        L C    T+ GS+      +   LH ++ V          C  C+  +   V    HQ                                 + TG K + CK C  +  +     +K  +  H  T E    C  C   F +   L  H           I+ G Q    C  C     +  ++     VH    P  Y C HC +  A     + H E+    +  + C  CQ  F N + L  H     G K ++  CS C K F     +RVH            P+SC  C + F   + L+ HQ  H G    QC  C+K    +   + H+  H + +
Sbjct:  235 TCSECGRSYPTSSYLKIHMRIHTGERPFKCTHCGKAFNQSGSLRIHQRIHTGEKPYKCTQCHKTFISSGQLTTHLRGHAGIKPFRCSECGKSFLESSALTIHRRIHTGQKPYQCTVCEKCFTTSSSLANHQAMHKKKRPFPCSLCSLSFTTLGKLKIHLRTHTGEKPYKCLQCGKTFTQSGSLT-----VHQKLHASDQV--------YQCSQCDKTFTCTVYLKKHQK--------------------------------IHTGEKPYECKLCQKKFNLL--SALKTHERTH--TGEKPYQCMTCGKCFSSSASLIRH---------RIIHTGKQP-HQCPTCGKKFSYPSLLKKHQRVHTQEKP--YPCSHCDKAFAVLSGLKAH-ERTHTGEKPYQCSVCQKTFSNSSILARHQSVHTGEKPHE--CSTCGKSFPRLSNLRVHQRVH----TNEKPYSCPQCDKTFAHSSSLKVHQRNHTGEKPYQCSNCEKSFTQLGHLQSHQRTHSKKK 680          

HSP 5 Score: 69.707 bits (169), Expect = 2.572e-11
Identity = 47/142 (33.10%), Postives = 67/142 (47.18%), Query Frame = 1
Query: 5056 SNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFS 5469
            +N++   K+K  + C  C+  F TL  L  H++ H    T  +   C  C + F        H K +      + YQC+ C K      ++ +H KIH+ E    C++C KKF   S    H R HTGEKPY+C  CG  FS
Sbjct:  362 ANHQAMHKKKRPFPCSLCSLSFTTLGKLKIHLRTH----TGEKPYKCLQCGKTFTQSGSLTVHQKLH---ASDQVYQCSQCDKTFTCTVYLKKHQKIHTGEKPYECKLCQKKFNLLSALKTHERTHTGEKPYQCMTCGKCFS 496          

HSP 6 Score: 69.707 bits (169), Expect = 2.707e-11
Identity = 48/143 (33.57%), Postives = 66/143 (46.15%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHSEPSI-ACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            Y C  C + F T  +L +H  +H K        PC  CS  F        H++++   T  K Y+C  C K       +  H K+H+   +  C  CDK F    Y  +H + HTGEKPY+CK+C     KK+N    LK HE
Sbjct:  346 YQCTVCEKCFTTSSSLANHQAMHKK----KRPFPCSLCSLSFTTLGKLKIHLRTH---TGEKPYKCLQCGKTFTQSGSLTVHQKLHASDQVYQCSQCDKTFTCTVYLKKHQKIHTGEKPYECKLC----QKKFNLLSALKTHE 477          

HSP 7 Score: 68.5514 bits (166), Expect = 5.587e-11
Identity = 47/155 (30.32%), Postives = 71/155 (45.81%), Query Frame = 1
Query: 5053 ESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFIN---EHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            +++ RT+  +K  Y C+ C + F +  +L  H  IH    T  +   C  C + F    L  KH + +   T+ K Y C+ C K  A ++    H + H+ E    C +C K F   S    H   HTGEKP++C  CG  F +  N   H + H
Sbjct:  474 KTHERTHTGEK-PYQCMTCGKCFSSSASLIRHRIIH----TGKQPHQCPTCGKKFSYPSLLKKHQRVH---TQEKPYPCSHCDKAFAVLSGLKAHERTHTGEKPYQCSVCQKTFSNSSILARHQSVHTGEKPHECSTCGKSFPRLSNLRVHQRVH 620          

HSP 8 Score: 64.6994 bits (156), Expect = 8.906e-10
Identity = 43/144 (29.86%), Postives = 64/144 (44.44%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHSEP-SIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            Y C +C++ F +   L +H++ H       +   C  C + F        H + +   T  K YQCT+C+K     + +  H  +H +     C +C   F        HLR HTGEKPYKC  CG  F++  +   H K H S
Sbjct:  290 YKCTQCHKTFISSGQLTTHLRGH----AGIKPFRCSECGKSFLESSALTIHRRIH---TGQKPYQCTVCEKCFTTSSSLANHQAMHKKKRPFPCSLCSLSFTTLGKLKIHLRTHTGEKPYKCLQCGKTFTQSGSLTVHQKLHAS 426          

HSP 9 Score: 62.003 bits (149), Expect = 5.555e-9
Identity = 43/149 (28.86%), Postives = 63/149 (42.28%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            K  Y C +C   + T   L  H++IH    T      C HC + F        H + +   T  K Y+CT C K       +  H++ H+      C  C K F + S    H R HTG+KPY+C +C   F+   +  +H   H+  R
Sbjct:  231 KTLYTCSECGRSYPTSSYLKIHMRIH----TGERPFKCTHCGKAFNQSGSLRIHQRIH---TGEKPYKCTQCHKTFISSGQLTTHLRGHAGIKPFRCSECGKSFLESSALTIHRRIHTGQKPYQCTVCEKCFTTSSSLANHQAMHKKKR 372          
BLAST of Zinc finger protein vs. Ensembl Cavefish
Match: ENSAMXT00000053638.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000086.1:69498:75018:-1 gene:ENSAMXG00000037923.1 transcript:ENSAMXT00000053638.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 1.467e-30
Identity = 146/636 (22.96%), Postives = 235/636 (36.95%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFI--------DCXXX-XXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEAL--------TSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            HQ+I+   +   C  CG+ F A   +  H+  H G+  + C      FT   S K+H             DC +  +     +T + ++       C  C K    F     L++H  I  GV     +    +++   AL          + + C  CG ++++   L +H   H       C+ C T       +  H R H             K   C  C   +  + +   HQ    GV   P    +      ++ + + ++   + TG+K + C  C       G   + H  +  G+       C  C   F     L  H R         I+ G++  +  D  T F     +  H   +H    P  Y C  C      +   + H   H   +  + C +C   F  + ALK+H     GVK     CS C   F+    ++ H    H G   + P+ C  C   F  +  L+ HQ +H G+    C  C        + + H+  H   + + C++C  +F  + +++ H R+ H  ++P  Y C  CG   T+   +  H  IH   + Y C  CGKRF        H RIH G KPY C  C +RFN +  L +H   H
Sbjct:  194 HQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGK---RFNAQGALKIHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHT----------GVKPYYCSDCGTSFTRQTSLKTHQRIHTGV--KPYYCSDCGTSFTRQTSLKTHQR--IHTGVKPYYCSDCGKRFNAQGALKI-HQRIHTGVKPYY---CSDCGTSFTRQTSLKTHQR---------IHTGVKPYYCSDCGTSFTRQTSLKTHQ-RIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVK-PYYCSDCGKRFNAQGALKIHQRIHTGVK--PYYCSDCGTSFTRQTSLKTH-QRIHTG---VKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRI-HTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCFDCGKRFNAQGALKIHQRIH 786          

HSP 2 Score: 129.413 bits (324), Expect = 1.646e-29
Identity = 140/630 (22.22%), Postives = 233/630 (36.98%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEAL--------TSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDT---LCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            HQ+I+   +  +C  C + F    ++  H++ H G   + C      FT   S K+H                     ++       C  C K    F     L++H  I  GV     +    +++   AL          + + C  CG ++++   L +H   H       C+ C  R  +       L+ H   +  V      K   C  C   +  +     HQ    GV   P    +      ++ + + ++   + TG+K + C  C       G  + +   +K    +        C  C   F     L  H R         I+ G++  + C  C    + +G +     +H    P  Y C  C      +   + H   H   +  + C +C T F  + +LK H     GVK     CS C   F+    ++ H    H G   + P+ C  C   F  +  L+ HQ +H G+    C  C K   +  A ++H+  H   + + C++C  +F  + +++ H R+ H  ++P  Y C  CG   T+   +  H  IH   + Y C  CG  FT+      H RIH G KPY C  C +RFN +  L +H   H
Sbjct:   28 HQRIHTGVKPYNCSDCKKSFSRQTSLKRHQVTHTGEKPYYCSDCGTSFTRQTSLKTHQR-------------------IHTGVKPYYCSDCGK---RFNAQGALKIHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNTS------LKTHQRIHTGV------KPYYCSDCGKRFNAQGALKIHQRIHTGV--KPYYCSDCGTSFTRQTSLKTHQR--IHTGVKPYYCSDC-------GTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQR---------IHTGVKPYY-CSDCGKRFNAQGALKIHQRIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVK-PYYCSDCGTSFTRQTSLKTHQRIHTGVK--PYYCSDCGTSFTRQTSLKTH-QRIHTG---VKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRI-HTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIH 590          

HSP 3 Score: 128.642 bits (322), Expect = 2.480e-29
Identity = 140/627 (22.33%), Postives = 233/627 (37.16%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEAL--------TSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            HQ+I+   +   C  CG  F    ++  H+  H G+  + C      FT   S K+H       +                         C  C   F +   L+ H  I  GV     +    +++   AL          + + C  CG ++++   L +H   H       C+ C T       +  H R H             K   C  C   +  + +   HQ    GV   P    +  +    +   ++++   + TG+K + C  C       G  + +   +K    +        C+D        +   R+  +++ + I+ G++  +  D  T F     +  H   +H    P  Y C  C      +   + H   H   +  + C +C T F  + +LK H     GVK     CS C K F+    +++H    H G   + P+ CF C ++F  +  L+ HQ +H G+    C  C        + + H+  H   + + C++C   F ++ A+  H R+ H  ++P  Y C  CG   T+   +  H  IH   + Y C  CGKRF        H RIH G KPY C  C +RFN +  L +H   H
Sbjct:  362 HQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYY----------------------CSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHT----------GVKPYYCSDCGTSFTRQTSLKTHQRIHTGV--KPYYCSDCGKRFNAQGALKIHQR--IHTGVKPYYCSDC-------GTSFTRQTSLKTHQRIHTGVKPYYCSDC------GTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQ-RIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVK-PYYCSDCGTSFTRQTSLKTHQRIHTGVK--PYYCSDCGKRFNAQGALKIH-QRIHTG---VKPYYCFDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRI-HTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCFDCGKRFNAQGALKIHQRIH 926          

HSP 4 Score: 126.331 bits (316), Expect = 1.203e-28
Identity = 141/633 (22.27%), Postives = 233/633 (36.81%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGV----------SFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            HQ+I+   +   C  CG  F    ++  H+  H G+  + C      FT   S K+H                     ++       C  C K    F     L++H  I  GV          SF  +T L +       +    + C  CG ++++   L +H   H       C+ C T       +  H R H             K   C  C   +  +     HQ    GV   P    +      ++ + + ++   + TG+K + C  C       G  + +   +K    +        C+D        +   R+  +++ + I+ G++  +  D  T F     +  H   +H    P  Y C  C      +   + H   H   +  + C +C   F  + ALK+H     GVK     C  C K F+    +++H    H G   + P+ C  C   F  +  L+ HQ +H G+    C  C K   +  A  +H+  H   + + C++C  +F  + +++ H R+ H  ++P  Y C  CGK       + +H  IH   + Y C  CGKRF        H RIH G KPY C  C   F ++++L  H   H   R
Sbjct:  390 HQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQR-------------------IHTGVKPYYCSDCGK---RFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHT----------GVKPYYCSDCGKRFNAQGALKIHQRIHTGV--KPYYCSDCGTSFTRQTSLKTHQR--IHTGVKPYYCSDC-------GTSFTRQTSLKTHQRIHTGVKPYYCSDC------GTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQ-RIHTGVKP--YYCSDCGTSFTRQTSLKTHQRIHTGVK-PYYCSDCGKRFNAQGALKIHQRIHTGVK--PYYCFDCGKRFNAQGALKIH-QRIHTG---VKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRI-HTGVKP--YYCSDCGKRFNAQGALKIHQRIHTGVKPYYCFDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTDKR 958          

HSP 5 Score: 56.225 bits (134), Expect = 3.468e-7
Identity = 49/185 (26.49%), Postives = 71/185 (38.38%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
             Y C  C   F    +L +H +IH    T  +   C  C   F  +     H + +   T  K Y C+ C K       +  H +IH+      C  C K+F  +     H R HTG KPY C  CG  F+++ +   H + H      Y  D G     +   K  +++    K      CGTS
Sbjct:  231 PYYCSDCGTSFTRQTSLKTHQRIH----TGVKPYYCSDCGTSFTRQTSLKTHQRIH---TGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTS 408          

HSP 6 Score: 55.4546 bits (132), Expect = 7.362e-7
Identity = 40/145 (27.59%), Postives = 58/145 (40.00%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
             YNC  C + F    +L  H   H    T  +   C  C   F  +     H + +   T  K Y C+ C K       +  H +IH+      C  C K+F  +   + H R HTG KPY C  CG  F+++ +   H + H  
Sbjct:   37 PYNCSDCKKSFSRQTSLKRHQVTH----TGEKPYYCSDCGTSFTRQTSLKTHQRIH---TGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTG 174          

HSP 7 Score: 54.6842 bits (130), Expect = 1.162e-6
Identity = 48/185 (25.95%), Postives = 70/185 (37.84%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
             Y C  C   F    +L +H +IH    T  +   C  C   F  +     H + +   T  K Y C+ C         +  H +IH+      C  C K+F  +     H R HTG KPY C  CG  F+++ +   H + H      Y  D G     +   K  +++    K      CGTS
Sbjct:  371 PYYCSDCGTSFTRQTSLKTHQRIH----TGVKPYYCSDCGTSFTRQTSLKTHQRIH---TGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTS 548          

HSP 8 Score: 54.6842 bits (130), Expect = 1.162e-6
Identity = 48/185 (25.95%), Postives = 70/185 (37.84%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
             Y C  C   F    +L +H +IH    T  +   C  C   F  +     H + +   T  K Y C+ C         +  H +IH+      C  C K+F  +     H R HTG KPY C  CG  F+++ +   H + H      Y  D G     +   K  +++    K      CGTS
Sbjct:  483 PYYCSDCGTSFTRQTSLKTHQRIH----TGVKPYYCSDCGTSFTRQTSLKTHQRIH---TGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTS 660          

HSP 9 Score: 52.7582 bits (125), Expect = 3.961e-6
Identity = 47/185 (25.41%), Postives = 71/185 (38.38%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES----YRDDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
             Y C  C   F    +L +H +IH    T  +   C  C + F  +     H + +   T  K Y C+ C         +  H +IH+      C  C   F +++    H R HTG KPY C  CG  F+++ +   H + H      Y  D G     +   K  +++    K      CGTS
Sbjct:  539 PYYCSDCGTSFTRQTSLKTHQRIH----TGVKPYYCSDCGKRFNAQGALKIHQRIH---TGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTS 716          

HSP 10 Score: 52.373 bits (124), Expect = 5.105e-6
Identity = 39/145 (26.90%), Postives = 59/145 (40.69%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
             Y C  C + F    N    +KIH +  T  +   C  C + F  +     H + +   T  K Y C+ C         +  H +IH+      C  C K+F  +   + H R HTG KPY C  CG  F+++ +   H + H  
Sbjct:  735 PYYCSDCGKRF----NAQGALKIHQRIHTGVKPYYCFDCGKRFNAQGALKIHQRIH---TGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALIIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTG 872          

HSP 11 Score: 52.373 bits (124), Expect = 5.326e-6
Identity = 40/143 (27.97%), Postives = 58/143 (40.56%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTIC-KKVVAFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
             Y C  C + F     L  H +IH    T  +   C  C   F  +     H + +   T  K Y C+ C K+    +  H +IH+      C  C K+F  +     H R HTG KPY C  CG  F+++ +   H + H  
Sbjct:  121 PYYCSDCGKRFNAQGALIIHQRIH----TGVKPYYCSDCGTSFTRQTSLKTHQRIH---TGVKPYYCSDCGKRFNTSLKTHQRIHTGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTG 256          

HSP 12 Score: 51.9878 bits (123), Expect = 8.551e-6
Identity = 42/150 (28.00%), Postives = 59/150 (39.33%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDF 5526
             Y C  C + F     L  H +IH    T  +   C  C   F  +     H + +   T  K Y C+ C K       +  H +IH+      C  C K+F  +     H R HTG KPY C  CG  F+++ +   H + H   R  F
Sbjct:  819 PYYCSDCGKRFNAQGALIIHQRIH----TGVKPYYCSDCGTSFTRQTSLKTHQRIH---TGVKPYYCSDCGKRFNAQGALKIHQRIHTGVKPYYCFDCGKRFNAQGALKIHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTDKRAYF 961          

HSP 13 Score: 51.6026 bits (122), Expect = 9.545e-6
Identity = 38/145 (26.21%), Postives = 57/145 (39.31%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
             Y C  C   F    +L +H +IH    T  +   C  C   F  +     H + +   T  K Y C+ C         +  H +IH+      C  C   F +++    H R HTG KPY C  CG  F+++ +   H + H  
Sbjct:  595 PYYCSDCGTSFTRQTSLKTHQRIH----TGVKPYYCSDCGTSFTRQTSLKTHQRIH---TGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTGVKPYYCSDCGTSFTRQTSLKTHQRIHTG 732          
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Match: prdm5 (PR domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040708-1])

HSP 1 Score: 107.071 bits (266), Expect = 1.156e-24
Identity = 78/269 (29.00%), Postives = 124/269 (46.10%), Query Frame = 1
Query: 3136 LEKHEE---NQLTFTC--DECQTYFKNEAALKLHLETFH-GVKQNDLKCSICEKDFSNS----QEIRVHILEEHEGC-----------------VELYPFSCFMCQEKFLFENELQAHQEVHG--GMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNARYQ-CEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            LE+H E       F C  + C   FK++  LK H +  H G  +    C+IC K FS+S    +  +VH + + + C                  E  PFSC +C + F   +++ +H+ +H       C LC K       Y+ H+  H   R FQC EC+A FR+  +++RH +         +Y+C +C K     S+   H   H   + + C YCG++F  +     H+R H GE+PY+C  C + F+K   L +HI  H + +
Sbjct:   84 LEQHREACRRDARFVCKAERCGKRFKSKDTLKKHKQNVHLGSSRKRPACNICNKKFSSSDILMEHRKVHEIFDCQDCDKKFISANQLRRHMITHSEKRPFSCEVCGKSFKRLDQVASHKVIHSVDKPYTCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQRHHK---------KYKCDLCDKAFVTPSVLKSHKKTHTGEKEKICPYCGQKFASNGTLRVHIRSHTGERPYQCQYCDKAFSKNDGLKMHIRTHTREK 343          

HSP 2 Score: 85.8853 bits (211), Expect = 1.039e-17
Identity = 79/300 (26.33%), Postives = 125/300 (41.67%), Query Frame = 1
Query: 2890 CADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHI 3777
            C   F++ + L  H +  H+ S     A       C+ C        ++     VH      +++C  C ++       R H+  H E +  F+C+ C   FK    +  H +  H V +    C +C K F++    + H         E  PF C  C+  F     LQ H + +    +CDLC K   +    + H+  H   +   C  C   F S   +R HIR  H    P  Y+CQ C K  ++   + MH+  H   + YQC  C K F++    +EH+R H GEKP++C +
Sbjct:  104 CGKRFKSKDTLKKHKQNVHLGSSRKRPA-------CNICNKKFSSSDILMEHRKVHE-----IFDCQDCDKKFISANQLRRHMITHSEKR-PFSCEVCGKSFKRLDQVASH-KVIHSVDK-PYTCKLCGKGFAHRNVYKNHKKTH----SEERPFQCEECKALFRTPFSLQRHHKKY----KCDLCDKAFVTPSVLKSHKKTHTGEKEKICPYCGQKFASNGTLRVHIR-SHTGERP--YQCQYCDKAFSKNDGLKMHIRTHTREKPYQCSECNKAFSQKRGLDEHMRTHTGEKPFQCDV 377          

HSP 3 Score: 64.3142 bits (155), Expect = 1.034e-10
Identity = 43/125 (34.40%), Postives = 64/125 (51.20%), Query Frame = 1
Query: 5089 EYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKI 5451
            +Y C  C++ F T   L SH K H  +    EKI C +C Q F +      H++S+   T  + YQC  C K  +    +  H++ H+ E    C  C+K F +K    EH+R HTGEKP++C +
Sbjct:  260 KYKCDLCDKAFVTPSVLKSHKKTHTGE---KEKI-CPYCGQKFASNGTLRVHIRSH---TGERPYQCQYCDKAFSKNDGLKMHIRTHTREKPYQCSECNKAFSQKRGLDEHMRTHTGEKPFQCDV 377          

HSP 4 Score: 62.003 bits (149), Expect = 6.318e-10
Identity = 46/172 (26.74%), Postives = 80/172 (46.51%), Query Frame = 1
Query: 5002 RDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            +D  K  I+ N +  H  +++     +K  ++C  C + F  L  + SH  IH    +V++   CK C + F ++ ++  H K++   +E + +QC  CK +        + H +    C++CDK F   S    H + HTGEK   C  CG +F+       H++ H   R
Sbjct:  158 QDCDKKFISANQLRRHMITHS-----EKRPFSCEVCGKSFKRLDQVASHKVIH----SVDKPYTCKLCGKGFAHRNVYKNHKKTH---SEERPFQCEECKALFRTPFSLQRHHKK--YKCDLCDKAFVTPSVLKSHKKTHTGEKEKICPYCGQKFASNGTLRVHIRSHTGER 315          

HSP 5 Score: 59.6918 bits (143), Expect = 3.455e-9
Identity = 43/153 (28.10%), Postives = 70/153 (45.75%), Query Frame = 1
Query: 5059 NNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            N++    ++  + C +C  +F T  +L  H K +  DL          C + F    +   H K++   T  K+  C  C +  A    +  H++ H+ E    C+ CDK F K      H+R HT EKPY+C  C   FS+K   ++H++ H
Sbjct:  228 NHKKTHSEERPFQCEECKALFRTPFSLQRHHKKYKCDL----------CDKAFVTPSVLKSHKKTH---TGEKEKICPYCGQKFASNGTLRVHIRSHTGERPYQCQYCDKAFSKNDGLKMHIRTHTREKPYQCSECNKAFSQKRGLDEHMRTH 367          

HSP 6 Score: 58.151 bits (139), Expect = 1.027e-8
Identity = 49/170 (28.82%), Postives = 77/170 (45.29%), Query Frame = 1
Query: 5023 ITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIP-CKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHSEP-SIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            ++E S+  H+E+  R  +         +C + F +   L  H +  N  L  + K P C  C++ F +  +  +H K  H +     + C  C K     N+   HM  HSE    +CE+C K FK+      H   H+ +KPY CK+CG  F+ +  Y +H K H   R
Sbjct:   79 VSECSLEQHREACRRDAR---FVCKAERCGKRFKSKDTLKKHKQ--NVHLGSSRKRPACNICNKKFSSSDILMEHRK-VHEI-----FDCQDCDKKFISANQLRRHMITHSEKRPFSCEVCGKSFKRLDQVASHKVIHSVDKPYTCKLCGKGFAHRNVYKNHKKTHSEER 237          

HSP 7 Score: 53.9138 bits (128), Expect = 2.399e-7
Identity = 88/401 (21.95%), Postives = 143/401 (35.66%), Query Frame = 1
Query: 2275 QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGE------------ALTSEC--------------FICGI--CGLNYSKLDILCSHMNN-HL-------SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELS---YMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSC 3360
            +C  C   FP    L+ H+  C          ++    PGE            +  SEC              F+C    CG  +   D L  H  N HL       +CN+C  +  S D + +H + H             +I  C  C+  + +      +Q   H + H   K   S E +  +  KR+++++    + +  K ++CK C      A R+  K+    H  + E    C  C  +F TP  L  H ++                + CD C        V+      H      +  CP+C ++ A     R+H+  H   +  + C  C   F     LK+H+ T    ++   +CS C K FS  + +  H +  H G     PF C
Sbjct:   34 RCRSCGKRFPVKQALQRHVLQC----------MEKAVLPGEQPGGFQCGVCSASFVSECSLEQHREACRRDARFVCKAERCGKRFKSKDTLKKHKQNVHLGSSRKRPACNICNKKFSSSDILMEHRKVH-------------EIFDCQDCDKKFIS-----ANQLRRHMITHSE-KRPFSCE-VCGKSFKRLDQVASHKVIHSVDKPYTCKLCGK--GFAHRNVYKNHKKTH--SEERPFQCEECKALFRTPFSLQRHHKK----------------YKCDLCDKAFVTPSVLKSHKKTHTGEKEKI--CPYCGQKFASNGTLRVHIRSH-TGERPYQCQYCDKAFSKNDGLKMHIRTH--TREKPYQCSECNKAFSQKRGLDEH-MRTHTG---EKPFQC 375          
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002487.1 (pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1 gene:ENSPMAG00000002270.1 transcript:ENSPMAT00000002487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 1.892e-23
Identity = 109/457 (23.85%), Postives = 180/457 (39.39%), Query Frame = 1
Query: 2491 CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            C  C     S   + QHL+ HL  +         K  IC  C   +  K     H       +  P   ++  +   K    +++ L++  TG + ++C+ C    + +    +K     H  T E   +C  C   F     L +H +   I +GE         + C +C     +   +      H    P  + C  C    A +   + H   H   +  + C+ C   F     LK H +T   +K+    C +C K FS+ + + VH +  H G   + P+ C  C  KF     L+AH+ +H G     C +C K        + H   H   + F C  C   +  K  ++ H  + H   +P  + C+ CGK  +Q S    H L H   + + C+ CG+RF++++    H  +H GEK + C  C +RF+  S+L  H   H   R
Sbjct:   16 CEQCGKTFSSRRTLGQHLKAHLRTHTG------EKPFICQDCGKRFSLKSTLKTHSLTH--SLEKPFVCNDCGKGFSKASYMKVHRLTH--TGERPYACQDCGQ--RFSQPSSLKTHQFTH--TGERPFICTDCGKRFLQASTLKEHHK---IHTGE-------RPYVCKECGKSFSYSSAMTVHQKTHTGEKP--FICKDCGRGFAQKPHLKTHQRIHT-GEKPYACNICGKSFSLNYNLKAHQKTH--LKERPYMCELCGKRFSDKRTLVVH-MRTHTG---VKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNH-EIVHSGEKP--FLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQQMHSSER 436          

HSP 2 Score: 102.449 bits (254), Expect = 1.561e-22
Identity = 122/490 (24.90%), Postives = 190/490 (38.78%), Query Frame = 1
Query: 2416 FICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHP---PIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVK--HLDVKHGL-TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHE 3834
            F+C  CG  +SK   +  H   H      +C  C  R      +  H   H          G+R  +  D    F             EH  +H    P    E  +         +++ ++  TG K F CK C       GR + +  HL     + T E    C IC   F     L  H ++ H++   Y+       FS DK T   H R         H    P  Y C HC  + +  +  + H   H   +  F C  C   F  ++ LK H E  H V++  + C  C K +S    ++ H +  H G     PF C  C + F   + L+ H+  H G     C  C +      + + H++ H   + F C +C   F    ++++H ++ H +  P  + C+ CGK     + + +H   H   + + C  CG+ F++  +   H R H GEKPYEC  C + F+   NL VH   H+
Sbjct:   74 FVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHT---------GERPFICTDCGKRFLQAST------LKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTH--TGEKPFICKDC-------GRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAH-QKTHLKERPYMCELCGKRFS-DKRTLVVHMR--------THTGVKP--YICTHCGNKFSQGQHLKAHKRIHT-GERPFICKICGKGFALKSTLKTH-EFTHSVEKPFI-CKHCGKGYSLKSTLKNHEIV-HSG---EKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQQM-HSSERP--FICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVHKKTHK 517          

HSP 3 Score: 101.293 bits (251), Expect = 4.297e-22
Identity = 84/290 (28.97%), Postives = 122/290 (42.07%), Query Frame = 1
Query: 3076 LYECPHCPERMADRRLWRIHLEKH---EENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEG--------CVELY-----------------PFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVT---QISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            +Y C  C +  + RR    HL+ H      +  F C +C   F  ++ LK H  T H + +    C+ C K FS +  ++VH L  H G        C + +                 PF C  C ++FL  + L+ H ++H G     C  C K      A  +H+  H   + F C +C   F  K  ++ H R+ H   +P  Y C ICGK  +    +  H   H   R Y CE CGKRF+       H+R H G KPY C  C  +F++  +L  H   H   R
Sbjct:   13 MYMCEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLT-HSL-EKPFVCNDCGKGFSKASYMKVHRLT-HTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQRI-HTGEKP--YACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGER 296          

HSP 4 Score: 76.2554 bits (186), Expect = 3.835e-14
Identity = 57/178 (32.02%), Postives = 85/178 (47.75%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNL-TETKKYQCTICKKVVAF---INEHMKIH-SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYL-QIKQRGKPIKKVFNTEKIVNSVQ 5607
            Y C +C + F    + +S + +H K  T  +   CK C + F  K     H+K++  + T  K Y C IC K  +    +  H K H  E    CE+C K+F  K   V H+R HTG KPY C  CGN+FS+      HLK H+        ++ +I  +G  +K    T +  +SV+
Sbjct:  158 YVCKECGKSF----SYSSAMTVHQKTHTGEKPFICKDCGRGFAQK----PHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQ----GQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVE 323          

HSP 5 Score: 69.3218 bits (168), Expect = 5.098e-12
Identity = 107/487 (21.97%), Postives = 179/487 (36.76%), Query Frame = 1
Query: 1993 IWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKT---DESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG 3426
            + RL H    G+ R  +C  CG+ F   +++  H+  H G   F C      F    + K HH+                   ++       C +C K + Y   +  + +H                 K   GE      FIC  CG  +++   L +H   H      +CN+C         +  H + HL          K +  +C++C   +  K     H    H  V P I T   ++ ++  + +  KR++      TG + F CK C     +  +  +K  +  H  +VE   +C+ C   +     L +H         E +++G +  F C +C   F     +  H  + H    P  + C  C  R +     + H   H   + TF C +C   F   ++LK H +      +    C  C K FS    ++VH  + H G     PF+C +C   F  +  L++HQ  H G
Sbjct:   91 VHRLTH---TGE-RPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHK-------------------IHTGERPYVCKECGKSFSY---SSAMTVH----------------QKTHTGEKP----FICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHL----------KERPYMCELCGKRFSDKRTLVVH-MRTHTGVKPYICTHCGNKFSQGQHLKAHKRIH------TGERPFICKICGKGFAL--KSTLKTHEFTH--SVEKPFICKHCGKGYSLKSTLKNH---------EIVHSG-EKPFLCKECGKGFSQGSSLKNHKLT-HDGEQP--FICQECGRRFSQTSSLKTHQLLH-TGEKTFLCPDCGKRFSFPSSLKQHQQMH--SSERPFICKECGKSFSYYSNLKVH-QKTHTG---DKPFTCTLCGRGFSQKPHLKSHQRTHTG 490          

HSP 6 Score: 68.5514 bits (166), Expect = 8.126e-12
Identity = 55/195 (28.21%), Postives = 83/195 (42.56%), Query Frame = 1
Query: 4939 DLDQEWSIEESDMEHSMW-NISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNL-TETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            D  + +S++ +   HS+  ++ +  V N   +          +R     +  Y C  C + F    +L +H   H    T      C  C + F    L A  +K +H + T  + Y C  C K  ++   +  H K H+ E    C+ C + F +K +   H R HTGEKPY C ICG  FS  YN   H K H
Sbjct:   50 DCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTH----TGERPFICTDCGKRF----LQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTH 236          

HSP 7 Score: 65.855 bits (159), Expect = 5.467e-11
Identity = 38/119 (31.93%), Postives = 62/119 (52.10%), Query Frame = 1
Query: 3508 RIFQCTECQATFRSKLAMRRHIRV---DHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            +++ C +C  TF S+  + +H++     H   +P  + CQ CGK   + + +  H L H   + + C  CGK F+K++Y   H   H GE+PY C  C +RF++ S+L  H   H   R
Sbjct:   12 KMYMCEQCGKTFSSRRTLGQHLKAHLRTHTGEKP--FICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGER 128          

HSP 8 Score: 61.6178 bits (148), Expect = 1.333e-9
Identity = 44/147 (29.93%), Postives = 67/147 (45.58%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIH-----SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y C +C + F + R L  H+K H +  T  +   C+ C + F  K     H  + H+L   K + C  C K  +  + +MK+H      E   AC+ C ++F + S    H   HTGE+P+ C  CG  F +     +H K H   R
Sbjct:   14 YMCEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLT-HSL--EKPFVCNDCGKGFSKAS-YMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIHTGER 156          

HSP 9 Score: 57.7658 bits (138), Expect = 1.979e-8
Identity = 48/165 (29.09%), Postives = 69/165 (41.82%), Query Frame = 1
Query: 5155 IHNKDLTVNEKI-PCKHCSQIFQNKILFAKHMKSY-HNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            + N+  T  EK+  C+ C + F ++    +H+K++    T  K + C  C K  +    +  H   HS E    C  C K F K SY   H   HTGE+PY C+ CG  FS+  +   H   H   R     D G         K   K+   E+     +CG S
Sbjct:    2 LKNQSATNAEKMYMCEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKS 166          

HSP 10 Score: 57.3806 bits (137), Expect = 2.789e-8
Identity = 40/142 (28.17%), Postives = 65/142 (45.77%), Query Frame = 1
Query: 5098 CVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKK-YQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            C +C   F    +L +H  +H  + T      C  C + F     F   +K +  +  +++ + C  C K  ++   +  H K H+ +    C +C + F +K +   H R HTGEKPY+C+ CG  FS   N   H K H+
Sbjct:  384 CQECGRRFSQTSSLKTHQLLHTGEKT----FLCPDCGKRFS----FPSSLKQHQQMHSSERPFICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVHKKTHK 517          

HSP 11 Score: 54.299 bits (129), Expect = 2.594e-7
Identity = 98/478 (20.50%), Postives = 161/478 (33.68%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLSCN--VCKTRLGSIDEVSQHLRDH--LHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVK-HGLT--VELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVH 3420
            H KI+   R   C  CG+ F  S+ +  H+  H G   F C      F      K+H                     ++       C  C K +                  +++N +    +       L    ++C +CG  +S    L  HM  H      +C T  G+     QHL+ H  +H  E        +  IC IC   +  K     H++     V  P       +    + T + +E+  + +G K F CK C       G+ + +   +K H LT   E   +C+ C   F     L  H         + ++ G ++                                 CP C +R +     + H + H  ++  F C EC   F   + LK+H +T  G K     C++C + FS    ++ H    H G     P+ C  C + F     L+ H++ H
Sbjct:  148 HHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQR-------------------IHTGEKPYACNICGKSFS-----------------LNYNLKAHQKT------HLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYIC-THCGNKFSQGQHLKAHKRIHTGE--------RPFICKICGKGFALKSTLKTHEFTH--SVEKPFICKHCGKGYSLKSTLKNHEI--VHSGEKPFLCKEC-------GKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTH---------QLLHTGEKTFL-------------------------------CPDCGKRFSFPSSLKQHQQMH-SSERPFICKECGKSFSYYSNLKVHQKTHTGDK--PFTCTLCGRGFSQKPHLKSH-QRTHTG---EKPYECQDCGKYFSLNCNLKVHKKTH 516          
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Match: GZF1 (GDNF inducible zinc finger protein 1 [Source:HGNC Symbol;Acc:HGNC:15808])

HSP 1 Score: 105.531 bits (262), Expect = 2.622e-23
Identity = 80/271 (29.52%), Postives = 113/271 (41.70%), Query Frame = 1
Query: 3058 ADSNPC---LYECPHCPERMADRRLWRIH-LEKHE-ENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            +D+  C   + EC +C +     + +  H L+ H  E  + + C EC   F N   L+ HL   H  +     C IC K F   +++R H ++ HEG  E +                             C  C K   S  A  LH   H   R + CTEC A F    +++ H R  H   +P  + C+ CG   TQ  M   H  IH   R + CE CGK F    Y   H RIH G KP+ C++C R F ++++L  H   H   R
Sbjct:  308 SDAGQCAGKVIECTNCDKEFQYEKSYMKHALQAHGMEPDIVYCCRECGQTFTNRCNLRAHLRHVHN-EDRQFVCGICGKRFKRKKDVRRHTIQVHEGGAERH----------------------------TCPECGKGLSSRTALRLHERTHTGDRPYHCTECAARFSQVSSLKVHQRT-HTGEKP--FVCEDCGARFTQNHMLIYHKRIHTGERPFMCETCGKSFASKEYLKHHNRIHSGSKPFLCNVCGRAFAQRNSLYQHAKIHTGER 546          

HSP 2 Score: 74.7146 bits (182), Expect = 1.092e-13
Identity = 79/334 (23.65%), Postives = 127/334 (38.02%), Query Frame = 1
Query: 2773 KKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYE 3768
            K   C  C+ E +   + Y+KH    HG+  ++   CR C   F     L  HLR  H +  +++  GI     C K   F   + V  H+  VH +     + CP C + ++ R   R+H   H  ++  + C EC   F   ++LK+H  T  G K                                  PF C  C  +F   + L  H+ +H G     C+ C K   S +  + H   H  ++ F C  C   F  + ++ +H ++ H    P  Y C +CGK  TQ++                G+ FT  +    H  +H    P++
Sbjct:  316 KVIECTNCDKEFQYE-KSYMKHALQAHGMEPDIVYCCRECGQTFTNRCNLRAHLRHVHNEDRQFV-CGI-----CGK--RFKRKKDVRRHTIQVH-EGGAERHTCPECGKGLSSRTALRLHERTHTGDR-PYHCTECAARFSQVSSLKVHQRTHTGEK----------------------------------PFVCEDCGARFTQNHMLIYHKRIHTGERPFMCETCGKSFASKEYLKHHNRIHSGSKPFLCNVCGRAFAQRNSLYQHAKI-HTGERP--YCCDMCGKQFTQLN----------------GRTFTDKSTLRRHTLVHDKNAPWQ 585          

HSP 3 Score: 65.0846 bits (157), Expect = 1.344e-10
Identity = 42/153 (27.45%), Postives = 69/153 (45.10%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTET--KKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFS----KKYNYNDHLKRHESYRD 5520
            Y+C +C   F  + +L    K+H +  T  +   C+ C   F        HM  YH    T  + + C  C K  A   ++  H +IHS      C +C + F +++   +H + HTGE+PY C +CG +F+    + +     L+RH    D
Sbjct:  436 YHCTECAARFSQVSSL----KVHQRTHTGEKPFVCEDCGARFTQN-----HMLIYHKRIHTGERPFMCETCGKSFASKEYLKHHNRIHSGSKPFLCNVCGRAFAQRNSLYQHAKIHTGERPYCCDMCGKQFTQLNGRTFTDKSTLRRHTLVHD 579          

HSP 4 Score: 59.6918 bits (143), Expect = 5.045e-9
Identity = 41/148 (27.70%), Postives = 61/148 (41.22%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHM-----KIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + C +C +   +   L  H + H  D   +    C  C+  F        H +++   T  K + C  C     F   HM     +IH+ E    CE C K F  K Y   H R H+G KP+ C +CG  F+++ +   H K H   R
Sbjct:  408 HTCPECGKGLSSRTALRLHERTHTGDRPYH----CTECAARFSQVSSLKVHQRTH---TGEKPFVCEDCG--ARFTQNHMLIYHKRIHTGERPFMCETCGKSFASKEYLKHHNRIHSGSKPFLCNVCGRAFAQRNSLYQHAKIHTGER 546          

HSP 5 Score: 49.6766 bits (117), Expect = 7.568e-6
Identity = 31/110 (28.18%), Postives = 50/110 (45.45%), Query Frame = 1
Query: 5194 CKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEH-MKIHSEPSI--ACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            C+ C Q F N+     H++  HN  E +++ C IC K       +  H +++H   +    C  C K    ++    H R HTG++PY C  C   FS+  +   H + H
Sbjct:  351 CRECGQTFTNRCNLRAHLRHVHN--EDRQFVCGICGKRFKRKKDVRRHTIQVHEGGAERHTCPECGKGLSSRTALRLHERTHTGDRPYHCTECAARFSQVSSLKVHQRTH 458          
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006878.1 (pep scaffold:Pmarinus_7.0:GL476706:187714:192918:-1 gene:ENSPMAG00000006198.1 transcript:ENSPMAT00000006878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 1.210e-22
Identity = 66/232 (28.45%), Postives = 111/232 (47.84%), Query Frame = 1
Query: 3166 FTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAH-QEVHGGM---MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQI-----CGKIVTQISMHMLIH-KNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
              C  C    + E  L+ HL T H   +  L C  C K FS  +E+ +H   + E  ++     CF C++ F     LQ H + VH      + CD+C K   ++   + H + H     + C  C  +F+  ++++ H  + H  L P  Y+C++     C     Q+  HM +H  +  + C++CGK F+   Y++EH+++H GEKP+ C  C +RF  + N+  H   H
Sbjct:  108 LPCSTCGRVLRGETRLRRHLATGH---RRSLACERCPKRFSREEELGLHRQTDCERSIQ-----CFTCEKSFKKLWYLQQHMKTVHSPAERNVACDICGKKFYTLAQVKKHLVAHREDMPYTCETCGKSFKRSMSLKVHS-MKHSGLRP--YKCKLESCTECFMYRYQLRNHMSVHVGHKEFMCQWCGKDFSMKQYFDEHLKVHTGEKPFACDACGKRFTSRPNMKRHRRTH 328          

HSP 2 Score: 90.1225 bits (222), Expect = 3.659e-19
Identity = 65/250 (26.00%), Postives = 108/250 (43.20%), Query Frame = 1
Query: 3085 CPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHI 3822
            C  CP+R +  R   + L +  + + +  C  C+  FK    L+ H++T H   + ++ C IC K F    +++ H++   E      P++C  C + F     L+ H   H G                     ++ ++ ++  CTEC   F  +  +R H+ V   ++  + + CQ CGK  +       H+ +H   + + C+ CGKRFT       H R H GEKPY C  C  RF   + L  H 
Sbjct:  137 CERCPKRFS--REEELGLHRQTDCERSIQCFTCEKSFKKLWYLQQHMKTVHSPAERNVACDICGKKFYTLAQVKKHLVAHRED----MPYTCETCGKSFKRSMSLKVHSMKHSG---------------------LRPYKCKLESCTEC---FMYRYQLRNHMSV---HVGHKEFMCQWCGKDFSMKQYFDEHLKVHTGEKPFACDACGKRFTSRPNMKRHRRTHTGEKPYACEGCGLRFRFSNMLKAHA 353          

HSP 3 Score: 70.4774 bits (171), Expect = 1.108e-12
Identity = 42/139 (30.22%), Postives = 62/139 (44.60%), Query Frame = 1
Query: 5098 CVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLT--ETKKYQCTICKKVVAFINEHMKIH-SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            C  C + F TL  +  H+  H +D+       C+ C + F+  +    H   +  L   + K   CT C      +  HM +H       C+ C K F  K Y+ EHL+ HTGEKP+ C  CG  F+ + N   H + H
Sbjct:  194 CDICGKKFYTLAQVKKHLVAHREDMPYT----CETCGKSFKRSMSLKVHSMKHSGLRPYKCKLESCTECFMYRYQLRNHMSVHVGHKEFMCQWCGKDFSMKQYFDEHLKVHTGEKPFACDACGKRFTSRPNMKRHRRTH 328          

HSP 4 Score: 62.3882 bits (150), Expect = 4.159e-10
Identity = 54/224 (24.11%), Postives = 99/224 (44.20%), Query Frame = 1
Query: 4861 RRSARKSDLNSNETTSLKRKI-----DEEFSDLDQEWSIEESDMEHSMWNISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            +R +R+ +L  +  T  +R I     ++ F  L   W +++  M+       R++  +   +    L +   +    ++ + Y C  C + F    +L  H   H+       K+  + C++ F  +     HM  +      K++ C  C K   +  + +EH+K+H+ E   AC+ C K+F  +     H R HTGEKPY C+ CG  F     +++ LK H
Sbjct:  142 KRFSREEELGLHRQTDCERSIQCFTCEKSFKKL---WYLQQ-HMKTVHSPAERNVACDICGKKFYTLAQVKKHLVAHREDMPYTCETCGKSFKRSMSLKVHSMKHSGLRPYKCKL--ESCTECFMYRYQLRNHMSVH---VGHKEFMCQWCGKDFSMKQYFDEHLKVHTGEKPFACDACGKRFTSRPNMKRHRRTHTGEKPYACEGCGLRF----RFSNMLKAH 352          

HSP 5 Score: 55.4546 bits (132), Expect = 7.364e-8
Identity = 35/142 (24.65%), Postives = 62/142 (43.66%), Query Frame = 1
Query: 5179 NEKIPCKHCSQIFQNKILFAKHMKSYHNLTET-----------------------KKYQCTICKKV---VAFINEHMK-IHS--EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            N ++PC  C ++ + +    +H+ + H  +                         +  QC  C+K    + ++ +HMK +HS  E ++AC+IC KKF   +   +HL  H  + PY C+ CG  F +  +   H  +H   R
Sbjct:  105 NRRLPCSTCGRVLRGETRLRRHLATGHRRSLACERCPKRFSREEELGLHRQTDCERSIQCFTCEKSFKKLWYLQQHMKTVHSPAERNVACDICGKKFYTLAQVKKHLVAHREDMPYTCETCGKSFKRSMSLKVHSMKHSGLR 246          
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001428.1 (pep scaffold:Pmarinus_7.0:GL481113:143068:144258:1 gene:ENSPMAG00000001294.1 transcript:ENSPMAT00000001428.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 3.007e-22
Identity = 95/377 (25.20%), Postives = 152/377 (40.32%), Query Frame = 1
Query: 2812 VAGRDYVKHLDVKHGL---TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG------------------------------MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            V  + +V+  D+K+ +   T E    C +C + F T   L +H+    I +GE         + C  C    +    +A   ++HA   P  + CP C +  +     + H+  H        C  C   F+ E  L+ H+    G  +   +CS+C K FS S  ++ H++  H G     P  C +C + F   + LQ H  +H G                                +C +CQK        + H M H   R  +C+ C   F+   A++ H++  H    P  ++C +C K   Q   +  HML H   R Y+C  C K F  S     H++ H GEKPY+C  C++ F   + L  H+  H
Sbjct:    8 VCSKSFVRPSDLKNHVMSHTGEKPYKCYMCENAFVTASNLKNHMS---IHNGE-------KPYRCSVCGKGFNRSSTLATHATIHATEKP--HICPVCGKGFSRPFALKCHVVIHS-GDCPHKCALCGKEFRKEMQLQDHMRNHTG--EWSHRCSVCGKGFSRSFVLKTHMMT-HTG---ERPHKCPVCGKGFGRLSTLQNHATMHTGEKVHKCLVCGKGFSRSVQLKRHMRNHTGEWRHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSHMKT-HTGERP--HKCSLCEKDFKQCTGLKSHMLTHTGERAYKCSVCEKDFIHSTSLKSHMKTHSGEKPYKCSACKKDFRHSTTLKNHMKTH 362          

HSP 2 Score: 87.0409 bits (214), Expect = 5.071e-18
Identity = 57/197 (28.93%), Postives = 91/197 (46.19%), Query Frame = 1
Query: 3259 KCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNA-RYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            KCS+C K F    +++ H++  H G     P+ C+MC+  F+  + L+ H  +H G    +C +C K          H   H   +   C  C   F    A++ H+ V H    P  ++C +CGK      Q+  HM  H     ++C  CGK F++S     H+  H GE+P++C +C + F + S L  H   H
Sbjct:    5 KCSVCSKSFVRPSDLKNHVM-SHTG---EKPYKCYMCENAFVTASNLKNHMSIHNGEKPYRCSVCGKGFNRSSTLATHATIHATEKPHICPVCGKGFSRPFALKCHV-VIHSGDCP--HKCALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSRSFVLKTHMMTHTGERPHKCPVCGKGFGRLSTLQNHATMH 194          

HSP 3 Score: 68.1662 bits (165), Expect = 6.506e-12
Identity = 50/199 (25.13%), Postives = 90/199 (45.23%), Query Frame = 1
Query: 4939 DLDQEWSIEESDMEHSM-WNISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKI-PCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            +  +E  +++    H+  W+    +   G +  S +L       T ++    + C  C + FG L  L +H  +H       EK+  C  C + F   +   +HM+   N T   +++C++C+K     +E   HM  H+ E    C +C K FK+ +    H++ HTGE+P+KC +C  +F +      H+  H   R
Sbjct:  124 EFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSR-SFVLKTHMMTHTGER---PHKCPVCGKGFGRLSTLQNHATMH-----TGEKVHKCLVCGKGFSRSVQLKRHMR---NHTGEWRHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSHMKTHTGERPHKCSLCEKDFKQCTGLKSHMLTHTGER 310          

HSP 4 Score: 64.3142 bits (155), Expect = 9.449e-11
Identity = 45/146 (30.82%), Postives = 69/146 (47.26%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y C  C   F T  NL +H+ IHN +    +   C  C + F      A H   +   TE K + C +C K  +    +  H+ IHS +    C +C K+F+K+    +H+R HTGE  ++C +CG  FS+ +    H+  H   R
Sbjct:   32 YKCYMCENAFVTASNLKNHMSIHNGE----KPYRCSVCGKGFNRSSTLATHATIH--ATE-KPHICPVCGKGFSRPFALKCHVVIHSGDCPHKCALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSRSFVLKTHMMTHTGER 170          

HSP 5 Score: 62.3882 bits (150), Expect = 4.038e-10
Identity = 45/187 (24.06%), Postives = 81/187 (43.32%), Query Frame = 1
Query: 4957 SIEESDMEHSMWNISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            +++     H+   + + +V       S+ L +   N T +     + C  C + F     L +H+  H    T      C  C + F+       HMK++   T  + ++C++C+K       +  HM  H+ E +  C +C+K F   +    H++ H+GEKPYKC  C  +F       +H+K H
Sbjct:  186 TLQNHATMHTGEKVHKCLVCGKGFSRSVQLKRHMRNHTGE---WRHRCSVCQKGFIRPSELKNHMMTH----TGERPHKCSVCGKAFKQYTALKSHMKTH---TGERPHKCSLCEKDFKQCTGLKSHMLTHTGERAYKCSVCEKDFIHSTSLKSHMKTHSGEKPYKCSACKKDFRHSTTLKNHMKTH 362          

HSP 6 Score: 57.3806 bits (137), Expect = 1.567e-8
Identity = 95/477 (19.92%), Postives = 160/477 (33.54%), Query Frame = 1
Query: 2032 RDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNEL---SYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGL---TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG 3426
            R   C  C + F   +++ +H + H G   +KC+  +  F    + K+H                       +S    + P +C  C   F ++  L  H  I                      T +  IC +CG  +S+   L  H+  H       C +C        ++  H+R+H       +G    +   C +C   +        H     G    P K      P+  +   R++ L   + M TG K   C  C       G+ + + + +K  +   T E    C +C   F  P  L +H+                                        H    P  ++C  C +        + H++ H   +    C  C+  FK    LK H+ T  G  +   KCS+CEKDF +S  ++ H ++ H G     P+ C  C++ F     L+ H + H G
Sbjct:    2 RPHKCSVCSKSFVRPSDLKNHVMSHTGEKPYKCYMCENAFVTASNLKNH-----------------------MSIHNGEKPYRCSVCGKGFNRSSTLATHATI--------------------HATEKPHICPVCGKGFSRPFALKCHVVIHSGDCPHKCALCGKEFRKEMQLQDHMRNH-------TGEWSHR---CSVCGKGFSRSFVLKTHMMTHTGER--PHKC-----PVCGKGFGRLSTLQNHATMHTGEKVHKCLVC-------GKGFSRSVQLKRHMRNHTGEWRHRCSVCQKGFIRPSELKNHMM--------------------------------------THTGERP--HKCSVCGKAFKQYTALKSHMKTH-TGERPHKCSLCEKDFKQCTGLKSHMLTHTG--ERAYKCSVCEKDFIHSTSLKSH-MKTHSG---EKPYKCSACKKDFRHSTTLKNHMKTHTG 364          

HSP 7 Score: 52.373 bits (124), Expect = 6.317e-7
Identity = 26/79 (32.91%), Postives = 40/79 (50.63%), Query Frame = 1
Query: 3607 YECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            ++C +C K   + S    H++ H   + Y+C  C   F  ++    H+ IH GEKPY C +C + FN+ S L  H   H
Sbjct:    4 HKCSVCSKSFVRPSDLKNHVMSHTGEKPYKCYMCENAFVTASNLKNHMSIHNGEKPYRCSVCGKGFNRSSTLATHATIH 82          

HSP 8 Score: 52.373 bits (124), Expect = 6.657e-7
Identity = 36/120 (30.00%), Postives = 54/120 (45.00%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPY 5439
            + C  C + F     L SH+K H    T      C  C + F+       HM ++   T  + Y+C++C+K       +  HMK HS E    C  C K F+  +    H++ HTGEKP+
Sbjct:  256 HKCSVCGKAFKQYTALKSHMKTH----TGERPHKCSLCEKDFKQCTGLKSHMLTH---TGERAYKCSVCEKDFIHSTSLKSHMKTHSGEKPYKCSACKKDFRHSTTLKNHMKTHTGEKPH 368          

HSP 9 Score: 50.8322 bits (120), Expect = 1.931e-6
Identity = 32/105 (30.48%), Postives = 47/105 (44.76%), Query Frame = 1
Query: 5194 CKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIH-SEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHL 5496
            C  CS+ F        H+ S+   T  K Y+C +C+      + +  HM IH  E    C +C K F + S    H   H  EKP+ C +CG  FS+ +    H+
Sbjct:    6 CSVCSKSFVRPSDLKNHVMSH---TGEKPYKCYMCENAFVTASNLKNHMSIHNGEKPYRCSVCGKGFNRSSTLATHATIHATEKPHICPVCGKGFSRPFALKCHV 107          
BLAST of Zinc finger protein vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 74.3294 bits (181), Expect = 1.235e-13
Identity = 49/146 (33.56%), Postives = 73/146 (50.00%), Query Frame = 1
Query: 3427 MMQCDLCQKVCKSMKAYELHRMKHFRTRI---FQCT--ECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEK 3837
            + Q D C K   S +    H      TR    +QC   +C  TF  +  + RH++V H   +P  Y+C+ C +  +    +  H   H   + Y+C  C K+F  S+    H+R H GEKP +C IC +RFN+ SNL+ HI  H+K
Sbjct:  706 ICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKV-HSKYKP--YKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQK 848          

HSP 2 Score: 72.4034 bits (176), Expect = 5.180e-13
Identity = 45/139 (32.37%), Postives = 73/139 (52.52%), Query Frame = 1
Query: 5107 CNEVFGTLRNLNSHVK-IHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            CN+ F + + LN H++ +H        +     C + F  +    +H+K +   ++ K Y+C  CK+  +    + +H + HS E    C IC+KKF   S    H+R HTGEKP +CKICG  F++  N + H+K H+
Sbjct:  712 CNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVH---SKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQ 847          

HSP 3 Score: 58.9214 bits (141), Expect = 8.006e-9
Identity = 50/189 (26.46%), Postives = 83/189 (43.92%), Query Frame = 1
Query: 3271 CEKDFSNSQEIRVHILEEH--EGCVELYPFSCFM--CQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLN 3813
            C K FS++QE+  H+   H   G  E   + C    C   F    +L  H +VH                           + + ++C  C+  F S+  + +H R  H   +P  Y+C IC K   I + + +H+  H   +  QC+ CGKRF +S+  ++H++ H  +K Y+C  C + F+    LN
Sbjct:  712 CNKSFSSAQELNDHLEAVHLTRGKSE---YQCLWHDCHRTFPQRQKLIRHLKVHS--------------------------KYKPYKCKTCKRCFSSEETLVQHTRT-HSGEKP--YKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTH--QKKYKCSDCSKSFDDLGKLN 866          
BLAST of Zinc finger protein vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 71.633 bits (174), Expect = 1.067e-12
Identity = 32/84 (38.10%), Postives = 52/84 (61.90%), Query Frame = 1
Query: 3601 ERYECQICGKIVTQISMHMLIHKNA-----RYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEK 3837
            +++EC  C ++ +Q + H+ +H  +      + C+YCGKRFT+      H R+H GEKPY C IC ++F++K NL  H+  H+K
Sbjct:  591 KKHECPYCHRLFSQ-ATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQK 673          

HSP 2 Score: 62.003 bits (149), Expect = 9.529e-10
Identity = 32/92 (34.78%), Postives = 46/92 (50.00%), Query Frame = 1
Query: 5248 KSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIA-----CEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            K   N    KK++C  C ++ +    H+++H    I      C+ C K+F +      H R HTGEKPY C IC  +FS+K N   HL  H+
Sbjct:  582 KGTQNTRAVKKHECPYCHRLFSQAT-HLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQ 672          

HSP 3 Score: 50.0618 bits (118), Expect = 4.011e-6
Identity = 32/109 (29.36%), Postives = 50/109 (45.87%), Query Frame = 1
Query: 5194 CKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKI--CGNEFSKKYNYNDHLKR 5502
            C +C ++F        H++S+      K + C  C K       +  H ++H+ E   +C+ICDKKF +K     HL  H   KP+ CK+  C   F++  N   H  R
Sbjct:  595 CPYCHRLFSQATHLEVHVRSHIGY---KPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNR 700          
BLAST of Zinc finger protein vs. Ensembl Yeast
Match: PZF1 (Transcription factor IIIA (TFIIIA); essential DNA binding protein required for transcription of 5S rRNA by RNA polymerase III; not involved in transcription of other RNAP III genes; nine conserved zinc fingers; may also bind 5S rRNA [Source:SGD;Acc:S000006390])

HSP 1 Score: 58.5362 bits (140), Expect = 5.435e-9
Identity = 56/221 (25.34%), Postives = 96/221 (43.44%), Query Frame = 1
Query: 2890 CADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDE--CQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFM--CQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKH---FRTRIFQCTEC 3531
            C   F  P  L++H    H         G+++ F CDKC      +  +      H+D+ P  ++C +C + +  R+  + H   H +   +F C E  C   F     L+ H+ + H  K   L C  C K F     +R HI + H+  VE  P+ C    C ++F   ++LQ+H +     ++C +C K C      ++H + H     T+ ++C  C
Sbjct:   56 CDKAFTRPSILTEHQLSVH--------QGLRA-FQCDKCAKSFVKKSHLERHLYTHSDTKP--FQCSYCGKGVTTRQQLKRHEVTHTK---SFICPEEGCNLRFYKHPQLRAHILSVHLHK---LTCPHCNKSFQRPYRLRNHISKHHDPEVE-NPYQCTFAGCCKEFRIWSQLQSHIKNDHPKLKCPICSKPCVGENGLQMHMIIHDDSLVTKNWKCHIC 258          
BLAST of Zinc finger protein vs. Ensembl Yeast
Match: MSN2 (Stress-responsive transcriptional activator; activated in stochastic pulses of nuclear localization in response to various stress conditions; binds DNA at stress response elements of responsive genes; relative distribution to nucleus increases upon DNA replication stress [Source:SGD;Acc:S000004640])

HSP 1 Score: 56.6102 bits (135), Expect = 3.032e-8
Identity = 24/57 (42.11%), Postives = 36/57 (63.16%), Query Frame = 1
Query: 3679 YQCEYCGKRFTKSAYYNEHVR-IHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRD 3846
            + C  C K F +S +   HVR +H  E+P+ CHIC ++F++  NL+ HI  H+KH D
Sbjct:  647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKKHGD 703          

HSP 2 Score: 50.447 bits (119), Expect = 2.858e-6
Identity = 21/55 (38.18%), Postives = 33/55 (60.00%), Query Frame = 1
Query: 5359 CEICDKKFKKKSYYVEHLR-YHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD 5520
            C IC K FK+  +   H+R  H+ E+P+ C IC  +FS+  N + H+K H+ + D
Sbjct:  649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKKHGD 703          
BLAST of Zinc finger protein vs. Ensembl Yeast
Match: COM2 (Transcription factor that binds IME1 Upstream Activation Signal (UAS)ru; COM2 transcription is regulated by Haa1p, Sok2p and Zap1p transcriptional activators; may bind the IME1 promoter under all growth conditions to negatively regulate its transcription in the absence of a positive regulator that binds more effectively; repressor activity may depend on phosphorylation by PKA; C. albicans homolog (MNL1) plays a role in adaptation to stress [Source:SGD;Acc:S000000932])

HSP 1 Score: 53.5286 bits (127), Expect = 2.304e-7
Identity = 23/54 (42.59%), Postives = 32/54 (59.26%), Query Frame = 1
Query: 5353 IACEICDKKFKKKSYYVEHLR-YHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
              CE CD++FK++ +   H+R  H  EKP+ C IC   FS+  N N H+K H S
Sbjct:  389 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKTHAS 442          

HSP 2 Score: 52.7582 bits (125), Expect = 4.144e-7
Identity = 22/53 (41.51%), Postives = 34/53 (64.15%), Query Frame = 1
Query: 3676 RYQCEYCGKRFTKSAYYNEHVR-IHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            ++ CE+C +RF +  +   HVR +H  EKP+ CHIC + F++  NLN H+  H
Sbjct:  388 QFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKTH 440          
BLAST of Zinc finger protein vs. Ensembl Nematostella
Match: EDO31838 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWT3])

HSP 1 Score: 134.806 bits (338), Expect = 5.126e-33
Identity = 114/404 (28.22%), Postives = 175/404 (43.32%), Query Frame = 1
Query: 2656 QWNEHGVVHP---PIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR----YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            Q  EH V+H    P K DE  +      T+  N    + +G K + C  C      +G+   +HL +    T E    C  C   F     L  HLR   I +GE         + CD C       G +     +H+   P  Y+C  C +   +    + HL  H   +  + CDEC   F     LK HL    G K  +  C  C K F+ S  ++ H L+ H G     P+ C  C + F     L+ H  +H G    +CD C K    ++  + H M H   + ++C EC   F     ++RH+ + H   +P  Y+C +CGK  T+   ++ H++IH   +    ++C+ CGK F +S +   H++IH G+KPYEC  C + F +   L  H+  H
Sbjct:   23 QLKEHLVIHSGKKPYKCDECGKCF----TQHANTHLRIHSGKKPYKCDECGKCFSESGK-LKRHLMIH---TGEKPHKCDDCGKRFTRSGDLKTHLR---IHTGE-------KPYECDDCGKRFTLSGNMKTHLRIHSGKKP--YKCDECGKCFTESGNLKTHLMIHS-GEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYE--CDDCGKRFTLSGNMKKH-LKIHSG---KKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMI-HSGQKP--YKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLRIH 396          

HSP 2 Score: 125.946 bits (315), Expect = 4.555e-30
Identity = 119/434 (27.42%), Postives = 180/434 (41.47%), Query Frame = 1
Query: 2557 HKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQ---CTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            H N ++     +K   CD C   +        H     G    P K D+  +     R+  +     + TG K + C  C     ++G +   HL +  G   +    C  C   F     L  HL    I SGE         + CD+C       G +     +H    P  YEC  C +R       + HL+ H   +  + CDEC   F   A LK HL    G K    KC  C K F+  + ++ H++  H G     P+ C  C + F     L+ H  +H G    +CD+C K      A   H M H   + ++   C EC   F     ++RH+++ H   +P  YEC  C K  T+   +  H+ IH   + Y+C+ CGK F++S     H+ IH G+KPY+C +C + F++  NL  H+  H
Sbjct:   49 HANTHLRIHSGKKPYKCDECGKCFSESGKLKRHLMIHTG--EKPHKCDDCGKRF--TRSGDLKTHLRIHTGEKPYECDDCGKRFTLSG-NMKTHLRIHSG---KKPYKCDECGKCFTESGNLKTHLM---IHSGE-------KPYKCDECGKCFTQSGDLKRHLRIHTGEKP--YECDDCGKRFTLSGNMKKHLKIHS-GKKPYKCDECGKSFTEHAYLKTHLIIHSGKK--PYKCDECGKCFTELETLKTHLMI-HSG---EKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLKI-HTGQKP--YECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIH 452          

HSP 3 Score: 122.479 bits (306), Expect = 7.480e-29
Identity = 102/367 (27.79%), Postives = 157/367 (42.78%), Query Frame = 1
Query: 2764 TGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMM-----QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEK 3837
            +G K + C  C      +G +   HL +  G   E    C  C   F     L  HLR   I +GE         + CD C       G +     +H+   P  Y+C  C +   +    + HL  H   +  + CDEC   F     LK HL    G K    KC  C K F+ S  ++ H++  H G     P+ C +C + F     L  H  +H G       +CD C K        + H   H   + ++C EC   F     ++ H+R+ H   +P  Y+C +CGK  ++   +  H++IH   + Y+C+ CGK F++S    +H+ IH G+KPY+C  C + F    NL  H++ H +
Sbjct:  142 SGKKPYKCDECGKCFTESG-NLKTHLMIHSG---EKPYKCDECGKCFTQSGDLKRHLR---IHTGE-------KPYECDDCGKRFTLSGNMKKHLKIHSGKKP--YKCDECGKSFTEHAYLKTHLIIHS-GKKPYKCDECGKCFTELETLKTHLMIHSGEK--PYKCDECGKCFTQSGNLKRHLMI-HSG---QKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLRI-HSGQKP--YKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCFILYRNLKTHLSIHSR 482          

HSP 4 Score: 107.842 bits (268), Expect = 4.209e-24
Identity = 77/232 (33.19%), Postives = 108/232 (46.55%), Query Frame = 1
Query: 3154 NQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMM--QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
             Q  + CDEC   F   A LK HL    G K    KC  C K F+      + I   H G     P+ C  C + F    +L+ H  +H G    +CD C K        + H   H   + ++C +C   F     M+ H+R+ H   +P  Y+C  CGK  T+   +  H++IH   + Y+C+ CGK FT+S     H+RIH GEKPYEC  C +RF    N+  H+  H
Sbjct:    5 GQKRYNCDECGKCFTRHAQLKEHLVIHSGKK--PYKCDECGKCFTQHANTHLRI---HSG---KKPYKCDECGKCFSESGKLKRHLMIHTGEKPHKCDDCGKRFTRSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKTHLRI-HSGKKP--YKCDECGKCFTESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIH 225          

HSP 5 Score: 78.9518 bits (193), Expect = 6.862e-15
Identity = 49/145 (33.79%), Postives = 74/145 (51.03%), Query Frame = 1
Query: 3415 VHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            +H G  +  CD C K        + H + H   + ++C EC   F        H+R+ H   +P  Y+C  CGK  ++   +  H++IH   + ++C+ CGKRFT+S     H+RIH GEKPYEC  C +RF    N+  H+  H
Sbjct:    2 IHSGQKRYNCDECGKCFTRHAQLKEHLVIHSGKKPYKCDECGKCFTQHANT--HLRI-HSGKKP--YKCDECGKCFSESGKLKRHLMIHTGEKPHKCDDCGKRFTRSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKTHLRIH 141          

HSP 6 Score: 72.4034 bits (176), Expect = 9.338e-13
Identity = 113/485 (23.30%), Postives = 179/485 (36.91%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHP---PIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVH 3420
            H +I+   +   C  CG+ F  S  +  H + H G    KC      FT     K+H      E+  +C+   +          ++       P +CD+C   F ++  L+ HL I      +   P               + C  CG  +++   L  H+  H       C+ C  R      + +HL+ H       SG   +K   CD C   + T+  Y       H ++H    P K DE  +   +  T + + +  + +G K + C  C      +G +  +HL +  G   +    C +C   F     L+ HL    I SG+           CD+C    +  G +     +H    P  YEC  C +        + HL  H   Q  + CD C   F     LK HL    G  Q   KC +C K FS S  ++ H++  H G     P+ C  C + F+    L+ H  +H
Sbjct:   53 HLRIHSGKKPYKCDECGKCFSESGKLKRHLMIHTGEKPHKCDDCGKRFTRSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKTHLRIHSGKKPYKCDECGKCFTESGNLKTHLMI-----HSGEKP---------------YKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIH-------SG---KKPYKCDECGKSF-TEHAY----LKTHLIIHSGKKPYKCDECGKCFTELETLKTHLM--IHSGEKPYKCDECGKCFTQSG-NLKRHLMIHSG---QKPYKCDVCGKCFTRSGALTTHLM---IHSGQK----PYKPHKCDECGKCFNQSGHLKRHLKIHTGQKP--YECGECSKCFTRSERLKTHLRIH-SGQKPYKCDVCGKCFSESRNLKRHLMIHSG--QKPYKCDVCGKCFSESGNLKKHLM-IHSG---QKPYKCDECGKCFILYRNLKTHLSIH 480          

HSP 7 Score: 65.0846 bits (157), Expect = 1.971e-10
Identity = 44/146 (30.14%), Postives = 65/146 (44.52%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y C  C + F     L +H+ IH+          C  C + F       +H+K +   T  K Y+C  C K       +  H++IHS +    C++C K F +      HL  H+G+KPYKC +CG  FS+  N   HL  H   +
Sbjct:  315 YKCDVCGKCFTRSGALTTHLMIHSGQKPYKPH-KCDECGKCFNQSGHLKRHLKIH---TGQKPYECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHSGQK 456          

HSP 8 Score: 64.6994 bits (156), Expect = 2.244e-10
Identity = 53/187 (28.34%), Postives = 80/187 (42.78%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCGTS 5619
            K  Y C +C + F     L  H+ IH    T  +   C  C + F        H++ +   T  K Y+C  C K   +   +  H++IHS +    C+ C K F +      HL  H+GEKPYKC  CG  F++  +   HL+ H   +    DD G    +    K   K+ + +K     +CG S
Sbjct:   60 KKPYKCDECGKCFSESGKLKRHLMIH----TGEKPHKCDDCGKRFTRSGDLKTHLRIH---TGEKPYECDDCGKRFTLSGNMKTHLRIHSGKKPYKCDECGKCFTESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECGKS 239          

HSP 9 Score: 64.6994 bits (156), Expect = 2.490e-10
Identity = 45/147 (30.61%), Postives = 70/147 (47.62%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            K  Y C +C + F    NL +H+ IH+ +    +   C  C + F       +H++ +   T  K Y+C  C K   +   + +H+KIHS +    C+ C K F + +Y   HL  H+G+KPYKC  CG  F++      HL  H  
Sbjct:  144 KKPYKCDECGKCFTESGNLKTHLMIHSGE----KPYKCDECGKCFTQSGDLKRHLRIH---TGEKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETLKTHLMIHSG 283          

HSP 10 Score: 63.5438 bits (153), Expect = 5.860e-10
Identity = 53/206 (25.73%), Postives = 87/206 (42.23%), Query Frame = 1
Query: 4918 KIDEEFSDLDQEWSIEESDMEHSMWN------ISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            K DE      Q  +++   M HS           +   ++G     +++H      + +K    + C +C + F    +L  H+KIH    T  +   C  CS+ F        H++ +   +  K Y+C +C K  +    +  H+ IHS +    C++C K F +     +HL  H+G+KPYKC  CG  F    N   HL  H
Sbjct:  288 KCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIH------SGQKPYKPHKCDECGKCFNQSGHLKRHLKIH----TGQKPYECGECSKCFTRSERLKTHLRIH---SGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCFILYRNLKTHLSIH 480          

HSP 11 Score: 61.6178 bits (148), Expect = 1.848e-9
Identity = 45/147 (30.61%), Postives = 67/147 (45.58%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKK-YQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            YNC +C + F     L  H+ IH    +  +   C  C + F       +H  ++  +   KK Y+C  C K  +    +  H+ IH+ E    C+ C K+F +      HLR HTGEKPY+C  CG  F+   N   HL+ H   +
Sbjct:    9 YNCDECGKCFTRHAQLKEHLVIH----SGKKPYKCDECGKCF------TQHANTHLRIHSGKKPYKCDECGKCFSESGKLKRHLMIHTGEKPHKCDDCGKRFTRSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKTHLRIHSGKK 145          

HSP 12 Score: 60.077 bits (144), Expect = 6.240e-9
Identity = 41/152 (26.97%), Postives = 67/152 (44.08%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHSEPSI----ACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            K  Y C +C + F  L  L +H+ IH+ +    +   C  C + F       +H+  +   +  K Y+C +C K       +  H+ IHS         C+ C K F +  +   HL+ HTG+KPY+C  C   F++      HL+ H   +
Sbjct:  256 KKPYKCDECGKCFTELETLKTHLMIHSGE----KPYKCDECGKCFTQSGNLKRHLMIH---SGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLRIHSGQK 400          

HSP 13 Score: 59.6918 bits (143), Expect = 7.675e-9
Identity = 40/143 (27.97%), Postives = 60/143 (41.96%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y C  C + F    N+  H+KIH    +  +   C  C + F        H+  +      K  +C  C   +  +  H+ IHS E    C+ C K F +      HL  H+G+KPYKC +CG  F++      HL  H   +
Sbjct:  203 YECDDCGKRFTLSGNMKKHLKIH----SGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQK 341          
BLAST of Zinc finger protein vs. Ensembl Nematostella
Match: EDO26879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAT8])

HSP 1 Score: 124.405 bits (311), Expect = 4.729e-30
Identity = 96/324 (29.63%), Postives = 149/324 (45.99%), Query Frame = 1
Query: 2881 CRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            C +C   F          R+ H+++   +++G Q  + CD+C   F     + AH   +H+   P  Y+C  C +        + HL  H   +  + CD+C   F    A+K HL    G K    KC  C   FS S  ++ H++  H G     P+ C  C + F    +L+ H  +H G    +CD C K      A + H   H   + ++C EC   F     ++RH+ V H   +P  ++C  CGK  TQ   +  H+ IH   + Y+C+ CGKRFT S    +HV+IH G+KPY+C  C + F + + L  H+  H
Sbjct:   89 CEVCGKCF---------TRKTHLKTHLMVHSG-QKPYKCDECGKCFTQHAHLKAHLV-IHSGKKP--YKCDECGKCFTLSGDLKTHLVIHS-GEKPYECDDCGKCFTQSGAMKRHLRIHTGKKP--YKCDECGNCFSESAHLKAHLVI-HSG---EKPYKCDDCGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESGKLKRHL-VIHTGEKP--HKCDDCGKRFTQSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKKHVKIHSGKKPYKCDECGKSFTEHAYLKTHLIIH 389          

HSP 2 Score: 122.094 bits (305), Expect = 2.926e-29
Identity = 92/309 (29.77%), Postives = 137/309 (44.34%), Query Frame = 1
Query: 2995 CDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHIL-------EEHEGCVELY-----------------PFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            CD+C       G +     +H    P  YEC  C +    +   + HL  H   Q  + CDEC   F   A LK HL    G K    KC  C K F+ S +++ H++        E + C + +                 P+ C  C   F     L+AH  +H G    +CD C K        + H + H   + ++C +C   F    AM+RH+R+ H   +P  Y+C  CG   ++   +  H++IH   + ++C+ CGKRFT+S     H+RIH GEKPYEC  C +RF    N+  H+  H
Sbjct:   61 CDECGKCFTQSGTLKTHLRIHTKVKP--YECEVCGKCFTRKTHLKTHLMVHS-GQKPYKCDECGKCFTQHAHLKAHLVIHSGKKP--YKCDECGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESAHLKAHLVIHSGEKPYKCDDCGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRI-HTGKKP--YKCDECGNCFSESGKLKRHLVIHTGEKPHKCDDCGKRFTQSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKKHVKIH 361          

HSP 3 Score: 111.309 bits (277), Expect = 1.297e-25
Identity = 97/341 (28.45%), Postives = 147/341 (43.11%), Query Frame = 1
Query: 2803 EVKVAGRDYVKHLDVKHGLTV---ELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVT---QISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNK 3798
            E +V G+ + +   +K  L V   +    C  C   F     L  HL    I SG       +  + CD+C       G +     +H+   P  YEC  C +        + HL  H   +  + CDEC   F   A LK HL    G K    KC  C K F+ S +++ H++  H G     P+ C  C + F     ++ H  +H G    +CD C          + H + H   +  +C +C   F     ++ H+R+ H   +P  YEC  CGK  T    +  H+ IH   + Y+C+ CGK FT+ AY   H+ IH G+KPY+C+ C + F +
Sbjct:   88 ECEVCGKCFTRKTHLKTHLMVHSGQKPYKCDECGKCFTQHAHLKAHLV---IHSG-------KKPYKCDECGKCFTLSGDLKTHLVIHSGEKP--YECDDCGKCFTQSGAMKRHLRIHT-GKKPYKCDECGNCFSESAHLKAHLVIHSGEKP--YKCDDCGKCFTLSGDLKTHLVI-HSG---EKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESGKLKRHLVIHTGEKPHKCDDCGKRFTQSGDLKTHLRI-HTGEKP--YECDDCGKRFTLSGNMKKHVKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCYECGKCFTQ 406          

HSP 4 Score: 78.5666 bits (192), Expect = 7.571e-15
Identity = 49/150 (32.67%), Postives = 73/150 (48.67%), Query Frame = 1
Query: 3433 QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR----DDYGN 3858
            +CD C K        + H   H + + ++C  C   F  K  ++ H+ V H   +P  Y+C  CGK  TQ   +  H++IH   + Y+C+ CGK FT S     H+ IH GEKPYEC  C + F +   +  H+  H   +    D+ GN
Sbjct:   60 KCDECGKCFTQSGTLKTHLRIHTKVKPYECEVCGKCFTRKTHLKTHLMV-HSGQKP--YKCDECGKCFTQHAHLKAHLVIHSGKKPYKCDECGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGN 206          

HSP 5 Score: 77.7962 bits (190), Expect = 1.121e-14
Identity = 98/389 (25.19%), Postives = 154/389 (39.59%), Query Frame = 1
Query: 2491 CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS 3648
            C  C T+ G++     HLR H           K K   C++C   +  K +   H     G    P K DE  +   +    + + +  + +G K + C  C     ++G D   HL +  G   E    C  C   F     +  HLR   I +G       +  + CD+C   F     + AH   +H+   P  Y+C  C +        + HL  H   +  + CD+C   F    A+K HL    G K    KC  C   FS S +++ H++  H G     P  C  C ++F    +L+ H  +H G    +CD C K        + H   H   + ++C EC  +F     ++ H+ + H   +P  Y+C  CGK  TQ+ 
Sbjct:   64 CGKCFTQSGTL---KTHLRIHT----------KVKPYECEVCGKCFTRKTHLKTHLMVHSG--QKPYKCDECGKCFTQHAHLKAHLV--IHSGKKPYKCDECGKCFTLSG-DLKTHLVIHSG---EKPYECDDCGKCFTQSGAMKRHLR---IHTG-------KKPYKCDECGNCFSESAHLKAHLV-IHSGEKP--YKCDDCGKCFTLSGDLKTHLVIHS-GEKPYECDDCGKCFTQSGAMKRHLRIHTGKKP--YKCDECGNCFSESGKLKRHLVI-HTG---EKPHKCDDCGKRFTQSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKKHVKIHSGKKPYKCDECGKSFTEHAYLKTHLII-HSGKKP--YKCYECGKCFTQLG 408          

HSP 6 Score: 77.411 bits (189), Expect = 1.426e-14
Identity = 39/122 (31.97%), Postives = 68/122 (55.74%), Query Frame = 1
Query: 3478 ELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            E+ +  +   +  +C EC   F     ++ H+R+ H  ++P  YEC++CGK  T+   +  H+++H   + Y+C+ CGK FT+ A+   H+ IH G+KPY+C  C + F    +L  H+  H
Sbjct:   47 EVSKALNLSDKPHKCDECGKCFTQSGTLKTHLRI-HTKVKP--YECEVCGKCFTRKTHLKTHLMVHSGQKPYKCDECGKCFTQHAHLKAHLVIHSGKKPYKCDECGKCFTLSGDLKTHLVIH 165          

HSP 7 Score: 73.559 bits (179), Expect = 2.976e-13
Identity = 101/436 (23.17%), Postives = 154/436 (35.32%), Query Frame = 1
Query: 2242 LNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATF 3543
            LN+S     C +C KC   F Q+  L+ HL I             +K  P        + C +CG  +++   L +H+  H        +    DE  +    H H   ++     +K   CD C   +    +        H V+H                           +G K + C  C      +G    +HL +  G   +    C  C + F     L  HL    I SGE         + CD C       G +     +H+   P  YEC  C +        + HL  H   +  + CDEC   F     LK HL    G K +  KC  C K F+ S +++ H L  H G     P+ C  C ++F     ++ H ++H G    +CD C K        + H + H   + ++C EC   F
Sbjct:   52 LNLSDKPHKCDECGKC---FTQSGTLKTHLRI------------HTKVKP--------YECEVCGKCFTRKTHLKTHLMVHSG-----QKPYKCDECGKCFTQHAHLKAHLVIHSGKKPYKCDECGKCFTLSGD-----LKTHLVIH---------------------------SGEKPYECDDCGKCFTQSGA-MKRHLRIHTG---KKPYKCDECGNCFSESAHLKAHLV---IHSGE-------KPYKCDDCGKCFTLSGDLKTHLVIHSGEKP--YECDDCGKCFTQSGAMKRHLRIH-TGKKPYKCDECGNCFSESGKLKRHLVIHTGEKPH--KCDDCGKRFTQSGDLKTH-LRIHTG---EKPYECDDCGKRFTLSGNMKKHVKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCYECGKCF 404          

HSP 8 Score: 66.6254 bits (161), Expect = 4.594e-11
Identity = 59/242 (24.38%), Postives = 94/242 (38.84%), Query Frame = 1
Query: 4918 KIDEEFSDL-----DQEWSIEESDMEHSMWNISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            K++ E  DL     +   ++  SD  H      +   ++G  +  + +H +            Y C  C + F    +L +H+ +H    +  +   C  C + F        H+  +      K  +C  C  +   +  H+ IHS E    C+ C K F +      HLR HTG+KPYKC  CGN FS+  +   HL  H   +    DD G    +    K    + + EK      CG
Sbjct:   33 KVEPELFDLKGITEEVSKALNLSDKPHKCDECGKCFTQSGTLKTHLRIHTKVK---------PYECEVCGKCFTRKTHLKTHLMVH----SGQKPYKCDECGKCFTQHAHLKAHLVIHSGKKPYKCDECGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESAHLKAHLVIHSGEKPYKCDDCGKCFTLSGDLKTHLVIHSGEKPYECDDCG 261          

HSP 9 Score: 65.855 bits (159), Expect = 8.646e-11
Identity = 41/143 (28.67%), Postives = 64/143 (44.76%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y C  C + F    +L +H+ IH+ +    +   C  C + F       +H++ +      K  +C  C      +  H+ IH+ E    C+ C K+F +      HLR HTGEKPY+C  CG  F+   N   H+K H   +
Sbjct:  227 YKCDDCGKCFTLSGDLKTHLVIHSGE----KPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESGKLKRHLVIHTGEKPHKCDDCGKRFTQSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKKHVKIHSGKK 365          

HSP 10 Score: 60.4622 bits (145), Expect = 4.443e-9
Identity = 44/155 (28.39%), Postives = 68/155 (43.87%), Query Frame = 1
Query: 5083 KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGN 5532
            K  Y C +C + F    +L +H+ IH+ +    +   C  C + F       +H++ +      K  +C  C    A +  H+ IHS E    C+ C K F        HL  H+GEKPY+C  CG  F++      HL+ H   +    D+ GN
Sbjct:  140 KKPYKCDECGKCFTLSGDLKTHLVIHSGE----KPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESAHLKAHLVIHSGEKPYKCDDCGKCFTLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGN 290          

HSP 11 Score: 58.9214 bits (141), Expect = 1.130e-8
Identity = 49/183 (26.78%), Postives = 78/183 (42.62%), Query Frame = 1
Query: 4936 SDLDQEWSIEESDMEHSMWNISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSK 5472
             DL     I   +  +   +  +   ++G  +  + +H      T KK    Y C +C   F     L  H+ IH    T  +   C  C + F        H++ +   T  K Y+C  C K   +   + +H+KIHS +    C+ C K F + +Y   HL  H+G+KPYKC  CG  F++
Sbjct:  240 GDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIH------TGKK---PYKCDECGNCFSESGKLKRHLVIH----TGEKPHKCDDCGKRFTQSGDLKTHLRIH---TGEKPYECDDCGKRFTLSGNMKKHVKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCYECGKCFTQ 406          

HSP 12 Score: 55.8398 bits (133), Expect = 9.871e-8
Identity = 39/146 (26.71%), Postives = 63/146 (43.15%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y C  C + F     +  H++IH    T  +   C  C   F       +H+  +   T  K ++C  C K       +  H++IH+ E    C+ C K+F       +H++ H+G+KPYKC  CG  F++      HL  H   +
Sbjct:  255 YECDDCGKCFTQSGAMKRHLRIH----TGKKPYKCDECGNCFSESGKLKRHLVIH---TGEKPHKCDDCGKRFTQSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKKHVKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKK 393          

HSP 13 Score: 54.6842 bits (130), Expect = 2.545e-7
Identity = 28/82 (34.15%), Postives = 46/82 (56.10%), Query Frame = 1
Query: 3586 LNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            + +EPE ++     K +T+     L   +  ++C+ CGK FT+S     H+RIH   KPYEC +C + F +K++L  H+  H
Sbjct:   32 IKVEPELFDL----KGITEEVSKALNLSDKPHKCDECGKCFTQSGTLKTHLRIHTKVKPYECEVCGKCFTRKTHLKTHLMVH 109          
BLAST of Zinc finger protein vs. Ensembl Nematostella
Match: EDO41358 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4P8])

HSP 1 Score: 120.168 bits (300), Expect = 8.020e-29
Identity = 77/232 (33.19%), Postives = 115/232 (49.57%), Query Frame = 1
Query: 3160 LTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISM---HMLIH---KNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            + F C+ C   F   A+ + H    HG  Q   KC++C K FS+     +H L  H G     P+ C  C ++F   + L+ H  VH G     CD+CQK  K     + HR  H   + F+C  C + F      R H    H+N   + + C +C K  ++ S+   H +IH   K  +++C+ C K F   ++  +HVRIH GE+P++CHIC R F + S+L  HIN H
Sbjct:    1 MPFMCERCDEEFDGMASWRQHCRNLHG-DQKYYKCNVCGKLFSHPSSRNIH-LRLHSG---EKPYECTTCGKRFRVSSHLKDHIRVHTGERPYVCDICQKGFKQSSDLKKHRRTHTLDKPFKCPFCASAF-----TRSHHCRGHINSADKPHRCPVCKKCFSRASLLKQHSVIHQGNKRFKFKCDVCDKMFRTRSHLRDHVRIHTGERPFKCHICSRAFKQSSDLKKHINLH 222          

HSP 2 Score: 85.8853 bits (211), Expect = 2.089e-17
Identity = 85/334 (25.45%), Postives = 128/334 (38.32%), Query Frame = 1
Query: 2881 CRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDH--LNLEPER--YECQICGKIVTQ---ISMHMLIHKNAR--------YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            C  C   F     L DH+R   + +GE         + CD C         +      H    P  ++CP C          R H+   ++      C +C   F   + LK H     G K+   KC +C+K F     +R H+   H G     PF C +C   F   ++L+ H  +H G  Q  C+ C    +   A   HR+ H     F C +C   F+   A+R+H R  H  ++ +P R  + C  C K  ++      H   HK  R          C  C  + +      +H+ IH G KPY+C  C + F    +L  H+  H
Sbjct:   62 CTTCGKRFRVSSHLKDHIR---VHTGE-------RPYVCDICQKGFKQSSDLKKHRRTHTLDKP--FKCPFCASAFTRSHHCRGHINSADKPHRCPVCKKC---FSRASLLKQHSVIHQGNKRFKFKCDVCDKMFRTRSHLRDHV-RIHTG---ERPFKCHICSRAFKQSSDLKKHINLHTGANQFKCEECNLEFRRADALRKHRLGHSDESTFGCEQCGRVFQHISALRQH-RTMHSGISTKPMRSIFRCNYCFKTFSKEESYRSHCEEHKQQREGISHGSLLNCTICCTQLSCEGDLRDHMNIHTGNKPYKCFACGKEFCIAIHLQEHLKIH 375          

HSP 3 Score: 84.3445 bits (207), Expect = 7.771e-17
Identity = 86/346 (24.86%), Postives = 143/346 (41.33%), Query Frame = 1
Query: 2878 LCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG----MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICG---KIVTQISMHMLIHKN-ARYQCEYCGKRFTKSAYYNEHVRIHKG--EKP----YECHICQRRFNKKSNLNVHINFHEKHRD--DYGNYL 3864
            +C  C + F+       H R  H         G Q  + C+ C   F H      H   +H+   P  YEC  C +R       + H+  H   +  + CD CQ  FK  + LK H  T         KC  C   F+ S   R HI    +      P  C +C++ F   + L+ H  +H G      +CD+C K+ ++      H   H   R F+C  C   F+    +++HI   +L+    +++C+ C    +    +  H L H + + + CE CG+ F   +   +H  +H G   KP    + C+ C + F+K+ +   H   H++ R+   +G+ L
Sbjct:    4 MCERCDEEFDGMASWRQHCRNLH---------GDQKYYKCNVCGKLFSHPSSRNIH-LRLHSGEKP--YECTTCGKRFRVSSHLKDHIRVHT-GERPYVCDICQKGFKQSSDLKKHRRTH--TLDKPFKCPFCASAFTRSHHCRGHINSADK------PHRCPVCKKCFSRASLLKQHSVIHQGNKRFKFKCDVCDKMFRTRSHLRDHVRIHTGERPFKCHICSRAFKQSSDLKKHI---NLHTGANQFKCEECNLEFRRADALRKHRLGHSDESTFGCEQCGRVFQHISALRQHRTMHSGISTKPMRSIFRCNYCFKTFSKEESYRSHCEEHKQQREGISHGSLL 325          

HSP 4 Score: 66.2402 bits (160), Expect = 5.458e-11
Identity = 41/144 (28.47%), Postives = 70/144 (48.61%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHSEPS---IACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            Y C  C + F    +L  H + H    T+++   C  C+  F      + H + + N  + K ++C +CKK     + + +H  IH         C++CDK F+ +S+  +H+R HTGE+P+KC IC   F +  +   H+  H
Sbjct:   88 YVCDICQKGFKQSSDLKKHRRTH----TLDKPFKCPFCASAFTR----SHHCRGHINSAD-KPHRCPVCKKCFSRASLLKQHSVIHQGNKRFKFKCDVCDKMFRTRSHLRDHVRIHTGERPFKCHICSRAFKQSSDLKKHINLH 222          

HSP 5 Score: 63.5438 bits (153), Expect = 4.016e-10
Identity = 86/381 (22.57%), Postives = 135/381 (35.43%), Query Frame = 1
Query: 2416 FICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHL--HKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLK----CSICEKDFSNSQEIRVHILE---EHEG------------CVELY----------------PFSCFMCQEKFLFENELQAHQEVHGGMM 3432
            + C +CG  +S       H+  H       C  C  R      VS HL+DH+  H  E        +  +CDIC   +    +   H+      +  P K    A       T+  +   ++ +  K   C  C      A    +K   V H         C +C  +F T   L DH+R   I +GE         F C  C+        +    ++H  +N   ++C  C          R H   H + + TF C++C   F++ +AL+ H     G+    ++    C+ C K FS  +  R H  E   + EG            C +L                 P+ CF C ++F     LQ H ++H  MM
Sbjct:   32 YKCNVCGKLFSHPSSRNIHLRLHSGEKPYECTTCGKRF----RVSSHLKDHIRVHTGE--------RPYVCDICQKGFKQSSDLKKHRRTH--TLDKPFKCPFCASAF----TRSHHCRGHINSADKPHRCPVCKKCFSRA--SLLKQHSVIHQGNKRFKFKCDVCDKMFRTRSHLRDHVR---IHTGE-------RPFKCHICSRAFKQSSDLKKHINLHTGANQ--FKCEECNLEFRRADALRKHRLGHSD-ESTFGCEQCGRVFQHISALRQHRTMHSGISTKPMRSIFRCNYCFKTFSKEESYRSHCEEHKQQREGISHGSLLNCTICCTQLSCEGDLRDHMNIHTGNKPYKCFACGKEFCIAIHLQEHLKIHADMM 379          

HSP 6 Score: 62.7734 bits (151), Expect = 6.131e-10
Identity = 39/142 (27.46%), Postives = 75/142 (52.82%), Query Frame = 1
Query: 5086 LEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKI-PCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHL 5496
            + + C +C+E F  + +   H +    +L  ++K   C  C ++F +      H++ +   +  K Y+CT C K   V + + +H+++H+ E    C+IC K FK+ S   +H R HT +KP+KC  C + F++ ++   H+
Sbjct:    1 MPFMCERCDEEFDGMASWRQHCR----NLHGDQKYYKCNVCGKLFSHPSSRNIHLRLH---SGEKPYECTTCGKRFRVSSHLKDHIRVHTGERPYVCDICQKGFKQSSDLKKHRRTHTLDKPFKCPFCASAFTRSHHCRGHI 135          

HSP 7 Score: 62.7734 bits (151), Expect = 7.376e-10
Identity = 50/169 (29.59%), Postives = 80/169 (47.34%), Query Frame = 1
Query: 3349 PFSCFMCQEKFLFENELQAH-QEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQIS---MHMLIHK-NARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHE 3834
            PF C  C E+F      + H + +HG     +C++C K+     +  +H   H   + ++CT C   FR    ++ HIRV H    P  Y C IC K   Q S    H   H  +  ++C +C   FT+S +   H  I+  +KP+ C +C++ F++ S L  H   H+
Sbjct:    2 PFMCERCDEEFDGMASWRQHCRNLHGDQKYYKCNVCGKLFSHPSSRNIHLRLHSGEKPYECTTCGKRFRVSSHLKDHIRV-HTGERP--YVCDICQKGFKQSSDLKKHRRTHTLDKPFKCPFCASAFTRSHHCRGH--INSADKPHRCPVCKKCFSRASLLKQHSVIHQ 165          

HSP 8 Score: 62.3882 bits (150), Expect = 9.606e-10
Identity = 34/108 (31.48%), Postives = 57/108 (52.78%), Query Frame = 1
Query: 5194 CKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFI---NEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            C+ C + F     + +H ++ H   + K Y+C +C K+ +     N H+++HS E    C  C K+F+  S+  +H+R HTGE+PY C IC   F +  +   H + H
Sbjct:    5 CERCDEEFDGMASWRQHCRNLHG--DQKYYKCNVCGKLFSHPSSRNIHLRLHSGEKPYECTTCGKRFRVSSHLKDHIRVHTGERPYVCDICQKGFKQSSDLKKHRRTH 110          

HSP 9 Score: 56.6102 bits (135), Expect = 5.435e-8
Identity = 45/178 (25.28%), Postives = 81/178 (45.51%), Query Frame = 1
Query: 5008 IVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTG--EKP----YKCKICGNEFSKKYNYNDHLKRHESYRD 5520
            + K   +  S++      ++ NK+   ++ C  C+++F T  +L  HV+IH    T      C  CS+ F+      KH+  +    + K  +C +  +    + +H   HS E +  CE C + F+  S   +H   H+G   KP    ++C  C   FSK+ +Y  H + H+  R+
Sbjct:  146 VCKKCFSRASLLKQHSVIHQGNKR--FKFKCDVCDKMFRTRSHLRDHVRIH----TGERPFKCHICSRAFKQSSDLKKHINLHTGANQFKCEECNLEFRRADALRKHRLGHSDESTFGCEQCGRVFQHISALRQHRTMHSGISTKPMRSIFRCNYCFKTFSKEESYRSHCEEHKQQRE 317          

HSP 10 Score: 52.7582 bits (125), Expect = 9.680e-7
Identity = 44/181 (24.31%), Postives = 80/181 (44.20%), Query Frame = 1
Query: 5005 DIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNY 5535
            DI + G  ++S +   + + RT+   K  + C  C   F    +   H+       + ++   C  C + F    L  +H    H   +  K++C +C K+    + + +H++IH+ E    C IC + FK+ S   +H+  HTG   +KC+ C  EF +     D L++H     D   +
Sbjct:   91 DICQKGFKQSSDL---KKHRRTHTLDK-PFKCPFCASAFTRSHHCRGHIN------SADKPHRCPVCKKCFSRASLLKQH-SVIHQGNKRFKFKCDVCDKMFRTRSHLRDHVRIHTGERPFKCHICSRAFKQSSDLKKHINLHTGANQFKCEECNLEFRRA----DALRKHRLGHSDESTF 256          

HSP 11 Score: 50.0618 bits (118), Expect = 6.173e-6
Identity = 48/185 (25.95%), Postives = 76/185 (41.08%), Query Frame = 1
Query: 4999 SRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKK----YQCTICKKVVAFINEHMKIHSEPS------------IACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            SR   ++   +  I LH  +N         ++ C +CN  F     L  H   H+ + T      C+ C ++FQ+     +H ++ H+   TK     ++C  C K  +   E  + H E              + C IC  +   +    +H+  HTG KPYKC  CG EF    +  +HLK H
Sbjct:  206 SRAFKQSSDLKKHINLHTGAN---------QFKCEECNLEFRRADALRKHRLGHSDESTFG----CEQCGRVFQHISALRQH-RTMHSGISTKPMRSIFRCNYCFKTFS-KEESYRSHCEEHKQQREGISHGSLLNCTICCTQLSCEGDLRDHMNIHTGNKPYKCFACGKEFCIAIHLQEHLKIH 375          
BLAST of Zinc finger protein vs. Ensembl Nematostella
Match: EDO30148 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1L9])

HSP 1 Score: 116.701 bits (291), Expect = 1.535e-28
Identity = 87/285 (30.53%), Postives = 131/285 (45.96%), Query Frame = 1
Query: 2995 CDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVT---QISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            CD+C       G +     +H    P  ++C  C +    R   + HL  H   Q  + CDEC   FK    LK HL T H  +Q   KC  C K F++   ++ H L  H G     P+ C  C + F  +  L+AH  +H G    +CD+C K        + H   H   + ++C EC   F     ++ H+R+ H   +P  Y+C  CGK  T    +  H++IH   + Y+C  CGK F++  Y   H+ IH G+KPY+C  C + F +  +L  H+  H
Sbjct:    4 CDECGKCFAQSGTLKRHVRIHTGHKP--HKCDECGKCFTQRGNLKTHLIIHL-GQKPYECDECGKCFKQSRTLKTHL-TIH-TEQKPHKCDECGKCFTHLGALKTH-LRIHTG---QKPYECDACGKCFTRKTHLKAHLMMHSGQKPFKCDVCDKGFTRHAGLKSHLRIHSGQKPYKCDECGKCFNQSGTLKSHLRI-HSGQKP--YKCDECGKCFTVKSNLKTHLMIHSGKKPYKCYECGKCFSRHRYLKTHLMIHSGQKPYKCDECGKCFTRSGSLKTHVKTH 276          

HSP 2 Score: 98.2117 bits (243), Expect = 3.766e-22
Identity = 68/227 (29.96%), Postives = 106/227 (46.70%), Query Frame = 1
Query: 3172 CDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMM--QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHE 3834
            CDEC   F     LK H+    G K +  KC  C K F+    ++ H++      +   P+ C  C + F     L+ H  +H      +CD C K    + A + H   H   + ++C  C   F  K  ++ H+ + H   +P  ++C +C K  T+   +  H+ IH   + Y+C+ CGK F +S     H+RIH G+KPY+C  C + F  KSNL  H+  H 
Sbjct:    4 CDECGKCFAQSGTLKRHVRIHTGHKPH--KCDECGKCFTQRGNLKTHLIIH----LGQKPYECDECGKCFKQSRTLKTHLTIHTEQKPHKCDECGKCFTHLGALKTHLRIHTGQKPYECDACGKCFTRKTHLKAHLMM-HSGQKP--FKCDVCDKGFTRHAGLKSHLRIHSGQKPYKCDECGKCFNQSGTLKSHLRIHSGQKPYKCDECGKCFTVKSNLKTHLMIHS 221          

HSP 3 Score: 75.485 bits (184), Expect = 1.859e-14
Identity = 58/240 (24.17%), Postives = 96/240 (40.00%), Query Frame = 1
Query: 4918 KIDEEFSDLDQEWSIEESDMEHSMWNISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR----DDFGNYLQIKQRGKPIKKVFNTEKIVNSVQCG 5613
            K   +   L +   I      H      +   + G  +  +I+H              Y C +C + F   R L +H+ IH    T  +   C  C + F +      H++ +   T  K Y+C  C K       +  H+ +HS +    C++CDK F + +    HLR H+G+KPYKC  CG  F++      HL+ H   +    D+ G    +K   K    + + +K     +CG
Sbjct:    9 KCFAQSGTLKRHVRIHTGHKPHKCDECGKCFTQRGNLKTHLIIHLGQK---------PYECDECGKCFKQSRTLKTHLTIH----TEQKPHKCDECGKCFTHLGALKTHLRIH---TGQKPYECDACGKCFTRKTHLKAHLMMHSGQKPFKCDVCDKGFTRHAGLKSHLRIHSGQKPYKCDECGKCFNQSGTLKSHLRIHSGQKPYKCDECGKCFTVKSNLKTHLMIHSGKKPYKCYECG 232          

HSP 4 Score: 75.0998 bits (183), Expect = 2.098e-14
Identity = 46/138 (33.33%), Postives = 69/138 (50.00%), Query Frame = 1
Query: 3433 QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHE 3834
            +CD C K        + H   H   +  +C EC   F  +  ++ H+ + HL  +P  YEC  CGK   Q   +  H+ IH   + ++C+ CGK FT       H+RIH G+KPYEC  C + F +K++L  H+  H 
Sbjct:    3 KCDECGKCFAQSGTLKRHVRIHTGHKPHKCDECGKCFTQRGNLKTHL-IIHLGQKP--YECDECGKCFKQSRTLKTHLTIHTEQKPHKCDECGKCFTHLGALKTHLRIHTGQKPYECDACGKCFTRKTHLKAHLMMHS 137          

HSP 5 Score: 60.077 bits (144), Expect = 2.071e-9
Identity = 40/139 (28.78%), Postives = 63/139 (45.32%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C  C++ F     L SH++IH+      +   C  C + F        H++ +      K  +C  C  V + +  H+ IHS +    C  C K F +  Y   HL  H+G+KPYKC  CG  F++  +   H+K H
Sbjct:  142 FKCDVCDKGFTRHAGLKSHLRIHSG----QKPYKCDECGKCFNQSGTLKSHLRIHSGQKPYKCDECGKCFTVKSNLKTHLMIHSGKKPYKCYECGKCFSRHRYLKTHLMIHSGQKPYKCDECGKCFTRSGSLKTHVKTH 276          

HSP 6 Score: 59.6918 bits (143), Expect = 2.902e-9
Identity = 41/141 (29.08%), Postives = 62/141 (43.97%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSI-ACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            + C +C + F     L  HV+IH    T ++   C  C + F  +     H+  +      +  +C  C K    +  H+ IH+E     C+ C K F        HLR HTG+KPY+C  CG  F++K +   HL  H  
Sbjct:    2 HKCDECGKCFAQSGTLKRHVRIH----TGHKPHKCDECGKCFTQRGNLKTHLIIHLGQKPYECDECGKCFKQSRTLKTHLTIHTEQKPHKCDECGKCFTHLGALKTHLRIHTGQKPYECDACGKCFTRKTHLKAHLMMHSG 138          

HSP 7 Score: 55.8398 bits (133), Expect = 5.890e-8
Identity = 42/144 (29.17%), Postives = 63/144 (43.75%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            Y C  C + F    +L +H+ +H+      +   C  C + F        H++ +   +  K Y+C  C K       +  H++IHS +    C+ C K F  KS    HL  H+G+KPYKC  CG  FS+      HL  H  
Sbjct:  114 YECDACGKCFTRKTHLKAHLMMHSG----QKPFKCDVCDKGFTRHAGLKSHLRIH---SGQKPYKCDECGKCFNQSGTLKSHLRIHSGQKPYKCDECGKCFTVKSNLKTHLMIHSGKKPYKCYECGKCFSRHRYLKTHLMIHSG 250          

HSP 8 Score: 51.6026 bits (122), Expect = 1.141e-6
Identity = 28/79 (35.44%), Postives = 42/79 (53.16%), Query Frame = 1
Query: 3607 YECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            ++C  CGK   Q   +  H+ IH   + ++C+ CGK FT+      H+ IH G+KPYEC  C + F +   L  H+  H
Sbjct:    2 HKCDECGKCFAQSGTLKRHVRIHTGHKPHKCDECGKCFTQRGNLKTHLIIHLGQKPYECDECGKCFKQSRTLKTHLTIH 80          
BLAST of Zinc finger protein vs. Ensembl Nematostella
Match: EDO48839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIQ4])

HSP 1 Score: 120.939 bits (302), Expect = 4.616e-28
Identity = 127/519 (24.47%), Postives = 195/519 (37.57%), Query Frame = 1
Query: 2416 FICGICGLNYSKLDILCSHMNNH-------------LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGK-RKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLREN-----------------------HIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMM--QCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVT---QISMHMLIHKN-ARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            F+C  C  ++     L  H+ +H              +C  C      I+++  H R  +         GK  +   C  C+  + TK     H    H  V P   T  + +   K     +++     TG K +SCK+C      +    + H  +    T E    C++C   F +   L  H R +                       H++S + I       +SC +C +       +      H    P  Y C  C +  +       H + H  N    +C  C   F     +  H+ T  G  +   KC+ C+K FS    + VHI           P+ C  C + F   ++L  H   H      +CD+C K  +      +H+  H   +  +CT+C+  F +K  + RH R  H   +P  Y C+IC K       +++HM IH N  R+ C YC K F       +HVRIH GEKPY+C  C + F  K N  VH   H K R
Sbjct:    1 FLCNRCDSSFKHFTALEKHIISHDGNVTIFNRRRGTRTCLKCNRSFKKIEKMKDHWRRCVPVQAAFDSSGKTERPWGCVYCSKKFKTKAKVAEHTRRTHLKVKPFSCTYCNKKCASK---SDLDKHERTHTGEKPYSCKYCGRMFGESS-SLIMHQRIH---TNEKPYKCKLCPKAFTSHSSLVMHNRHHSGDKPYKCEICGRAFSVSSNRARHMRSHKNIKP-----YSCSQCEWSFTTSSDLKRHLKTHTGEKP--YRCEECDKAFSSSCGLSTHKKIHF-NIKPHSCTVCHKRFATTGQVTSHMRTHTG--EQPFKCTYCDKAFSIKGNLTVHIRRH----TNERPYVCTTCGKSFTVISQLVMHNRSHTDERPYKCDICGKKFRQQGGLSIHKKIHTEEKPHECTQCEKAFITKAKLDRHFRT-HSGEKP--YRCEICEKSFRDKDSLNIHMRIHNNDKRHSCSYCPKLFYTKTELRQHVRIHTGEKPYKCPYCDKAFAVKGNCTVHARTHTKER 495          

HSP 2 Score: 103.99 bits (258), Expect = 1.370e-22
Identity = 119/499 (23.85%), Postives = 192/499 (38.48%), Query Frame = 1
Query: 2416 FICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMAT--GMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIK 3873
            F C  C    +    L  H   H      SC  C    G    +  H R  +H NE        K   C +C   + +  +   H  N H     P K +          +   N   +M +   +K +SC  C      +  D  +HL    G   E    C  C   F +   LS H +         I+  I+   SC  C       G V      H    P  ++C +C +  + +    +H+ +H  N+  + C  C   F   + L +H  +     +   KC IC K F     + +H         E  P  C  C++ F+ + +L  H   H G    +C++C+K  +   +  +H   H   +   C+ C   F +K  +R+H+R+ H   +P  Y+C  C K   +    ++H   H   R Y+C  CG+ F+  +   EH+R H G K + C IC++ F ++  L  H   H K + ++GN L  K
Sbjct:  105 FSCTYCNKKCASKSDLDKHERTHTGEKPYSCKYCGRMFGESSSLIMHQR--IHTNE--------KPYKCKLCPKAFTSHSSLVMH--NRHHSGDKPYKCEICGRAF----SVSSNRARHMRSHKNIKPYSCSQCEWSFTTSS-DLKRHLKTHTG---EKPYRCEECDKAFSSSCGLSTHKK---------IHFNIKP-HSCTVCHKRFATTGQVTSHMRTHTGEQP--FKCTYCDKAFSIKGNLTVHIRRHT-NERPYVCTTCGKSFTVISQLVMHNRSH--TDERPYKCDICGKKFRQQGGLSIHKKIH----TEEKPHECTQCEKAFITKAKLDRHFRTHSGEKPYRCEICEKSFRDKDSLNIHMRIHNNDKRHSCSYCPKLFYTKTELRQHVRI-HTGEKP--YKCPYCDKAFAVKGNCTVHARTHTKERPYKCTNCGRAFSCRSGLREHMRTHGGVKEFICSICEKAFLRRGCLKKHEKLHVK-QGNHGNCLSSK 560          

HSP 3 Score: 78.1814 bits (191), Expect = 1.929e-14
Identity = 129/572 (22.55%), Postives = 209/572 (36.54%), Query Frame = 1
Query: 1963 LPLQISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIR-HVGLIRFK---CHKHQMVFTDMKSYKSHH--EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMA--TGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGM--MQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK 3630
            +P+Q + FDS  +          R   CV+C ++FK  A V +H  R H+ +  F    C+K     +D+  ++  H  E+   C+       E +  +++     ++ P +C  C   F     L +H         N     D  Y            C ICG  +S       HM +H      SC+ C+    +  ++ +HL+ H             K   C+ C+  + +         + H  +H  IK   S    +KR        S+M   TG + F C +C+    + G   V H+  +H  T E   +C  C   F    +L  H R                                       H D  P  Y+C  C ++   +    IH + H E +    C +C+  F  +A L  H  T  G K    +C ICEK F +   + +H+   +         SC  C + F  + EL+ H  +H G    +C  C K         +H   H + R ++CT C   F  +  +R H+R  H  +  + + C IC K
Sbjct:   60 VPVQAA-FDSSGKTE--------RPWGCVYCSKKFKTKAKVAEHTRRTHLKVKPFSCTYCNKKCASKSDLDKHERTHTGEKPYSCKYCGRMFGESSSLIMHQRIHTNEKPYKCKLCPKAFTSHSSLVMH---------NRHHSGDKPYK-----------CEICGRAFSVSSNRARHMRSHKNIKPYSCSQCEWSFTTSSDLKRHLKTHT----------GEKPYRCEECDKAFSSSCG-----LSTHKKIHFNIK-PHSCTVCHKRFATTGQVTSHMRTHTGEQPFKCTYCDKAFSIKGNLTV-HIR-RH--TNERPYVCTTCGKSFTVISQLVMHNRS--------------------------------------HTDERP--YKCDICGKKFRQQGGLSIHKKIHTEEK-PHECTQCEKAFITKAKLDRHFRTHSGEK--PYRCEICEKSFRDKDSLNIHMRIHNND----KRHSCSYCPKLFYTKTELRQHVRIHTGEKPYKCPYCDKAFAVKGNCTVHARTHTKERPYKCTNCGRAFSCRSGLREHMRT-HGGV--KEFICSICEK 532          

HSP 4 Score: 70.8626 bits (172), Expect = 3.601e-12
Identity = 56/181 (30.94%), Postives = 79/181 (43.65%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH---ESYRDDFGNYLQIKQRGKPI-KKVFNTEKIVNSVQC 5610
            Y+C +C   F T  +L  H+K H    T  +   C+ C + F +    + H K + N+   K + CT+C K  A    +  HM+ H+ E    C  CDK F  K     H+R HT E+PY C  CG  F+       H + H     Y+ D       +Q G  I KK+   EK     QC
Sbjct:  217 YSCSQCEWSFTTSSDLKRHLKTH----TGEKPYRCEECDKAFSSSCGLSTHKKIHFNI---KPHSCTVCHKRFATTGQVTSHMRTHTGEQPFKCTYCDKAFSIKGNLTVHIRRHTNERPYVCTTCGKSFTVISQLVMHNRSHTDERPYKCDICGKKFRQQGGLSIHKKIHTEEKPHECTQC 390          

HSP 5 Score: 68.1662 bits (165), Expect = 2.577e-11
Identity = 43/147 (29.25%), Postives = 74/147 (50.34%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD 5520
            + C +C + F T   L+ H + H+ +    +   C+ C + F++K     HM+ ++N    K++ C+ C K+      + +H++IH+ E    C  CDK F  K     H R HT E+PYKC  CG  FS +    +H++ H   ++
Sbjct:  385 HECTQCEKAFITKAKLDRHFRTHSGE----KPYRCEICEKSFRDKDSLNIHMRIHNN---DKRHSCSYCPKLFYTKTELRQHVRIHTGEKPYKCPYCDKAFAVKGNCTVHARTHTKERPYKCTNCGRAFSCRSGLREHMRTHGGVKE 524          

HSP 6 Score: 67.781 bits (164), Expect = 2.667e-11
Identity = 49/146 (33.56%), Postives = 70/146 (47.95%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y C  C + F     L+ H KIH    T  +   C  C + F  K    +H +++   +  K Y+C IC+K       +N HM+IH+ +   +C  C K F  K+   +H+R HTGEKPYKC  C   F+ K N   H + H   R
Sbjct:  357 YKCDICGKKFRQQGGLSIHKKIH----TEEKPHECTQCEKAFITKAKLDRHFRTH---SGEKPYRCEICEKSFRDKDSLNIHMRIHNNDKRHSCSYCPKLFYTKTELRQHVRIHTGEKPYKCPYCDKAFAVKGNCTVHARTHTKER 495          

HSP 7 Score: 67.0106 bits (162), Expect = 4.503e-11
Identity = 46/152 (30.26%), Postives = 77/152 (50.66%), Query Frame = 1
Query: 5068 TNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            ++ K +  + CV C++ F T   +  H +     L V +   C +C++   +K    KH +++   T  K Y C  C ++    +    H +IH+ E    C++C K F   S  V H R+H+G+KPYKC+ICG  FS   N   H++ H++
Sbjct:   68 SSGKTERPWGCVYCSKKFKTKAKVAEHTR--RTHLKV-KPFSCTYCNKKCASKSDLDKHERTH---TGEKPYSCKYCGRMFGESSSLIMHQRIHTNEKPYKCKLCPKAFTSHSSLVMHNRHHSGDKPYKCEICGRAFSVSSNRARHMRSHKN 213          

HSP 8 Score: 67.0106 bits (162), Expect = 4.581e-11
Identity = 50/169 (29.59%), Postives = 78/169 (46.15%), Query Frame = 1
Query: 5023 ITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
             + +S+++H    NR +   K  Y C  C   F    N   H++ H K++   +   C  C   F       +H+K++   T  K Y+C  C K  +    ++ H KIH      +C +C K+F        H+R HTGE+P+KC  C   FS K N   H++RH + R
Sbjct:  171 TSHSSLVMH----NRHHSGDK-PYKCEICGRAFSVSSNRARHMRSH-KNI---KPYSCSQCEWSFTTSSDLKRHLKTH---TGEKPYRCEECDKAFSSSCGLSTHKKIHFNIKPHSCTVCHKRFATTGQVTSHMRTHTGEQPFKCTYCDKAFSIKGNLTVHIRRHTNER 327          

HSP 9 Score: 59.6918 bits (143), Expect = 9.729e-9
Identity = 50/165 (30.30%), Postives = 76/165 (46.06%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIK 5547
            RT+  +K  Y C  C + F    +LN H++IHN D    ++  C +C ++F  K    +H++ +   T  K Y+C  C K  A       H + H+ E    C  C + F  +S   EH+R H G K + C IC   F ++     H K H   + + GN L  K
Sbjct:  405 RTHSGEK-PYRCEICEKSFRDKDSLNIHMRIHNND----KRHSCSYCPKLFYTKTELRQHVRIH---TGEKPYKCPYCDKAFAVKGNCTVHARTHTKERPYKCTNCGRAFSCRSGLREHMRTHGGVKEFICSICEKAFLRRGCLKKHEKLHVK-QGNHGNCLSSK 560          

HSP 10 Score: 58.9214 bits (141), Expect = 1.640e-8
Identity = 110/498 (22.09%), Postives = 164/498 (32.93%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFP----QADILRLHLDI----CDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQ--CDLCQKV 3456
            H++ +   +  SC +CGR F  S+++  H+  H     +KC      FT   S   H                      N   S     +C+ C   F     +A  +R H +I    C    ++  T  D K         + + C  C   +S    L +H   H      SC VC  R  +  +V+ H+R H  +              C  C+  +  K N   H                      +R T   NE  Y+        C  C     V  +  V H       T E    C IC   F     LS H ++ H +   +     +  F   K     HFR         H+   P  Y C  C +   D+    IH+  H  N    +C  C   F  +  L+ H+    G K    KC  C+K F+      VH         +  P+ C  C   F   + L+ H   HGG+ +  C +C+K 
Sbjct:  123 HERTHTGEKPYSCKYCGRMFGESSSLIMHQRIHTNEKPYKCKLCPKAFTSHSSLVMH----------------------NRHHSGDKPYKCEICGRAFSVSSNRARHMRSHKNIKPYSCSQCEWSFTTSSDLKRHLKTHTGEKPYRCEECDKAFSSSCGLSTHKKIHFNIKPHSCTVCHKRFATTGQVTSHMRTHTGEQP----------FKCTYCDKAFSIKGNLTVH---------------------IRRHT---NERPYV--------CTTCGKSFTVISQ-LVMH---NRSHTDERPYKCDICGKKFRQQGGLSIH-KKIHTEEKPHECTQCEKAFI-TKAKLDRHFR--------THSGEKP--YRCEICEKSFRDKDSLNIHMRIH-NNDKRHSCSYCPKLFYTKTELRQHVRIHTGEK--PYKCPYCDKAFAVKGNCTVHARTH----TKERPYKCTNCGRAFSCRSGLREHMRTHGGVKEFICSICEKA 533          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000035130.1 (pep primary_assembly:ASM223467v1:17:11263917:11382711:-1 gene:ENSORLG00000007097.2 transcript:ENSORLT00000035130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.622 bits (418), Expect = 1.848e-41
Identity = 165/673 (24.52%), Postives = 262/673 (38.93%), Query Frame = 1
Query: 1912 QEQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKINGDCRDDSCVF----CGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEP----LYKRRTKRMNELSY---MATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKI---VTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            QE +D  L      +      I   DS+       +  DC     +F    CG+ F   +N+  H   H G   F C   +  FT       H      E+ + C+   +  ++     +++     + P  C  C   F ++ IL +H+                +   GE      F C  CG +++   +L  H+  H      SC +C         ++ H+R H          G+R  L C +C   + T  +   H     G    P   +    P    + K+     N L+Y     TG + +SCK C     +  +D   H+    G   E    C +C   F T   L  H+R +            + +F CD C   F H   + +H  +  A     L+ C  C +     R    H+  H + +  ++C  C+  F   + L +H+ T  G  +    C IC K F +S  + +H +  H G     PF+C +CQ+ F+    L  H   H G     C +C+K      +  +H   H   R F C  C  +F +   ++ H+R+ H    P  Y C IC K     ++++ HM IH   R Y C+ C K FT+S+    H+RIH GE+PY CHIC++ F     L +H+  H   R
Sbjct:   70 QENMDSKLEPSESPVLKANPHIQCSDSVT------VQLDCPSHKSLFWCGPCGKVFTRRSNLKTHMRIHTGDRPFTCKVCEKQFTKSSILNVHMRTHTGEKAVSCDVCGKGFMQSANLQVHMRTHTGERPFTCKVCEKSFTKSSILNVHM----------------RTHTGEKP----FSCEFCGQSFTTRSVLKVHIKTHTGETPFSCQICTKIFTYARNLTYHMRTHT---------GERPFL-CQVCEKGFITSSHLKVHMRIHTG--ERPFNCEVCERPYSCDICKKTFIHANSLTYHMRTHTGERPYSCKLCQKGF-MQSKDLKVHMRTHTG---ERPFTCEVCGKSFTTGSDLKVHIRTH----------TAKKLFPCDICKKTFIHVNSLTSHMRTHTAKK---LFSCDICKKVFVSSRNLTYHMRTHTDER-PYSCKVCKKCFTQHSCLNVHMRTHTG--ERPYSCDICRKTFIHSNNLTLH-MRTHTG---ERPFTCELCQKGFMHSRALNVHMRNHTGEKPYSCKVCEKHFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKIHMRI-HTGERP--YSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTGERPYSCHICKKVFIHSGGLTLHMRTHTGER 677          

HSP 2 Score: 87.4261 bits (215), Expect = 9.242e-17
Identity = 123/546 (22.53%), Postives = 196/546 (35.90%), Query Frame = 1
Query: 1987 DSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP----------QCDKCYDYFPQADILRLHLDI--------CDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKH--LDVKHGL-TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQC 3522
             SI  ++ +   G+ +  SC FCG+ F   + +  H   H G   F C     +FT  ++   H      E    C+   +  +  +   +++     + P           CD C   F  A+ L  H+          C           D K           F C +CG +++    L  H+  H +     C++CK     ++ ++ H+R H  K          K+  CDIC   + +  N  YH             TDE                       + +SCK C        + + +H  L+V     T E    C IC   F     L+ H+R     +GE         F+C+ C   F H R +  H  + H    P  Y C  C +    +    +H+  H   +  FTC+ C   F   + LK+H+    G  +    C IC+K F ++  +  H +  H G     P+SC +CQ+ F   + L  H  +H G     C +C+KV        LH   H   R + C
Sbjct:  206 SSILNVHMRTHTGE-KPFSCEFCGQSFTTRSVLKVHIKTHTGETPFSCQICTKIFTYARNLTYHMRTHTGERPFLCQVCEKGFITSSHLKVHMRIHTGERPFNCEVCERPYSCDICKKTFIHANSLTYHMRTHTGERPYSCKLCQKGFMQSKDLKVHMRTHTGERPFTCEVCGKSFTTGSDLKVHIRTHTAKKLFPCDICKKTFIHVNSLTSHMRTHTAK----------KLFSCDICKKVFVSSRNLTYHMRTH---------TDE-----------------------RPYSCKVCK-------KCFTQHSCLNVHMRTHTGERPYSCDICRKTFIHSNNLTLHMR---THTGE-------RPFTCELCQKGFMHSRALNVHMRN-HTGEKP--YSCKVCEKHFTQKSSLNVHMRIHT-GERPFTCEVCGKSFTTGSDLKIHMRIHTG--ERPYSCDICKKTFIHASRLTYH-MRIHTG---ERPYSCKVCQKCFTQSSCLIVHMRIHTGERPYSCHICKKVFIHSGGLTLHMRTHTGERPYSC 681          

HSP 3 Score: 85.8853 bits (211), Expect = 2.861e-16
Identity = 54/158 (34.18%), Postives = 80/158 (50.63%), Query Frame = 1
Query: 5056 SNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            S+ RT+  +KL ++C  C +VF + RNL  H++ H  +        CK C + F        HM+++   T  + Y C IC+K     N    HM+ H+ E    CE+C K F        H+R HTGEKPY CK+C   F++K + N H++ H   R
Sbjct:  416 SHMRTHTAKKL-FSCDICKKVFVSSRNLTYHMRTHTDE----RPYSCKVCKKCFTQHSCLNVHMRTH---TGERPYSCDICRKTFIHSNNLTLHMRTHTGERPFTCELCQKGFMHSRALNVHMRNHTGEKPYSCKVCEKHFTQKSSLNVHMRIHTGER 565          

HSP 4 Score: 80.4925 bits (197), Expect = 1.085e-14
Identity = 47/142 (33.10%), Postives = 70/142 (49.30%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C  C +VF    NL +H++IH  D        CK C + F    +   HM+++   T  K   C +C K     A +  HM+ H+ E    C++C+K F K S    H+R HTGEKP+ C+ CG  F+ +     H+K H
Sbjct:  110 FWCGPCGKVFTRRSNLKTHMRIHTGD----RPFTCKVCEKQFTKSSILNVHMRTH---TGEKAVSCDVCGKGFMQSANLQVHMRTHTGERPFTCKVCEKSFTKSSILNVHMRTHTGEKPFSCEFCGQSFTTRSVLKVHIKTH 244          

HSP 5 Score: 73.9442 bits (180), Expect = 1.351e-12
Identity = 50/160 (31.25%), Postives = 74/160 (46.25%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR------DDFGNYLQ 5541
            Y+C  C + F    +LN H++IH    T      C+ C + F        HM+ +   T  + Y C ICKK     + +  HM+IH+ E   +C++C K F + S  + H+R HTGE+PY C IC   F        H++ H   R         G +LQ
Sbjct:  539 YSCKVCEKHFTQKSSLNVHMRIH----TGERPFTCEVCGKSFTTGSDLKIHMRIH---TGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTGERPYSCHICKKVFIHSGGLTLHMRTHTGERPYSCKLSSSGPFLQ 691          

HSP 6 Score: 71.633 bits (174), Expect = 5.910e-12
Identity = 55/213 (25.82%), Postives = 97/213 (45.54%), Query Frame = 1
Query: 5008 IVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS----------EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD----------DFGNYLQIKQRGKPIKKVF 5577
            + +   T++SI+     + RT+  +K  ++C  C + F T   L  H+K H  +   +    C+ C++IF        HM+++   T  + + C +C+K     + +  HM+IH+          E   +C+IC K F   +    H+R HTGE+PY CK+C   F +  +   H++ H   R             G+ L++  R    KK+F
Sbjct:  198 VCEKSFTKSSIL---NVHMRTHTGEK-PFSCEFCGQSFTTRSVLKVHIKTHTGETPFS----CQICTKIFTYARNLTYHMRTH---TGERPFLCQVCEKGFITSSHLKVHMRIHTGERPFNCEVCERPYSCDICKKTFIHANSLTYHMRTHTGERPYSCKLCQKGFMQSKDLKVHMRTHTGERPFTCEVCGKSFTTGSDLKVHIRTHTAKKLF 399          

HSP 7 Score: 70.4774 bits (171), Expect = 1.472e-11
Identity = 52/202 (25.74%), Postives = 86/202 (42.57%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDF----------GNYLQIKQRGKPIKKVFNTEKIVNSVQCGTSDYPDLELIWANS 5655
            + C  C + F     LN H++ H    T  + + C  C + F        HM+++   T  + + C +C+K     + +N HM+ H+ E   +CE C + F  +S    H++ HTGE P+ C+IC   F+   N   H++ H   R              ++L++  R    ++ FN E       C   D      I ANS
Sbjct:  138 FTCKVCEKQFTKSSILNVHMRTH----TGEKAVSCDVCGKGFMQSANLQVHMRTH---TGERPFTCKVCEKSFTKSSILNVHMRTHTGEKPFSCEFCGQSFTTRSVLKVHIKTHTGETPFSCQICTKIFTYARNLTYHMRTHTGERPFLCQVCEKGFITSSHLKVHMRIHTGERPFNCEVCERPYSC---DICKKTFIHANS 329          

HSP 8 Score: 56.6102 bits (135), Expect = 2.458e-7
Identity = 29/83 (34.94%), Postives = 44/83 (53.01%), Query Frame = 1
Query: 5281 YQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + C  C KV    + +  HM+IH+ +    C++C+K+F K S    H+R HTGEK   C +CG  F +  N   H++ H   R
Sbjct:  110 FWCGPCGKVFTRRSNLKTHMRIHTGDRPFTCKVCEKQFTKSSILNVHMRTHTGEKAVSCDVCGKGFMQSANLQVHMRTHTGER 192          

HSP 9 Score: 54.6842 bits (130), Expect = 1.107e-6
Identity = 38/146 (26.03%), Postives = 62/146 (42.47%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHSEPSI-ACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C  C + F    +L  H++ H    T      CK C + F        HM+++   T  + + C +C K       +  H++ H+   +  C+IC K F   +    H+R HT +K + C IC   F    N   H++ H   R
Sbjct:  315 YSCDICKKTFIHANSLTYHMRTH----TGERPYSCKLCQKGFMQSKDLKVHMRTH---TGERPFTCEVCGKSFTTGSDLKVHIRTHTAKKLFPCDICKKTFIHVNSLTSHMRTHTAKKLFSCDICKKVFVSSRNLTYHMRTHTDER 453          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000045028.1 (pep primary_assembly:ASM223467v1:17:11266576:11351617:-1 gene:ENSORLG00000007097.2 transcript:ENSORLT00000045028.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 2.352e-40
Identity = 175/675 (25.93%), Postives = 275/675 (40.74%), Query Frame = 1
Query: 1966 PLQISLFDSIWRL-YHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSY---MATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQ--------------NDL-------------KCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            P    +  S+  L YH +I+   R  +C  CG+ F   +++  H   H G   F C      F +  +   H      E    C+   ++  + +   +++ +   + P  C  C   F Q+  L++H+                +   GE      FIC +CG N+ +   L +H+  H      SC++CK    S+  ++ H++ H          G+R    C +C   +    +   H     G    P   D     + K+     + L+Y   + TG + +SCK C  +        + H+ +  G   E    C IC  +F     L+ H+R     +GE         +SC  C   F H R +  H T  H D  P  Y C  C +         +H+  H  ++  FTC+ C   F   + LK+H+   H  K+              N L              C IC+K F +S+ +  HI   H G     P+SC +C++ F   + L  H  +H G     CD+C+K         LH   H   R F C  CQ  F    A++ H+R +H    P  Y C++C K  TQ   +++HM IH   R + CE CGK FT  +    H+R H GE+PY C +C++ F +KS+LNVH+  H   R
Sbjct:  253 PFSCKVLISLRNLTYHMRIHTGERPFTCEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPYSCKLCQKGFLQSKDLKVHM----------------RTHTGERP----FICEVCGKNFLQSTKLKAHIRTHTATKLFSCDICKKVFVSLRNLTYHMKTHT---------GERP-YSCKVCQKCFIQPSHLNIHMRLHTG--ERPYSCD-----ICKKTFIHASRLTYHMRIHTGERPYSCKVCQ-KCFTQSSCLIVHMRIHTG---ERPYSCHICKKVFIHSGGLTLHMR---THTGE-------RPYSCKLCQKGFMHSRALKVH-TRTHTDERP--YSCKVCKKHFTQNSSLNVHMRIHT-SERPFTCEVCGKSFTTGSDLKVHIR-IHTAKKLFPCDICEKTFIHVNSLTSHMRTHTAKKLFSCDICKKVFVSSRNLTYHI-RTHTG---ERPYSCKVCKKCFTQRSCLNVHMRIHTGERPYSCDICRKTFIHSNNLTLHMRTHTGERPFTCELCQRGFMHSRALKVHMR-NHTGERP--YSCKVCEKHFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKIHMRNHTGERPYSCKVCKKHFTQKSSLNVHMRIHTGER 864          

HSP 2 Score: 139.428 bits (350), Expect = 1.068e-32
Identity = 138/536 (25.75%), Postives = 205/536 (38.25%), Query Frame = 1
Query: 2371 LDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLY-----KRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKI---VTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR--------DDYGNYLEIKPRGRGHPDYDP 3906
            L  +   GE L    F C IC   +     L  HM  H      +C VC+        ++ H+R H          G+R    CDIC   +                +H  ++T     P       K  T   +   ++ T    FSCK     V ++ R+   H+ +  G   E    C +C   F     L  H+R   I +GE         FSCD C       G +      H    P                               ++C  CQ  F   + L +H+ +  G  +    C +C+K F  S++++VH +  H G     PF C +C + FL   +L+AH   H    +  CD+C+KV  S++    H   H   R + C  CQ  F     +  H+R+ H    P  Y C IC K     ++++ HM IH   R Y C+ C K FT+S+    H+RIH GE+PY CHIC++ F     L +H+  H   R          + +   +K   R H D  P
Sbjct:  138 LHMRTQTGEKL----FSCDICSKGFINSGALTCHMRTHTGERPFTCKVCQKSFTQSSYLNIHMRSHT---------GERP-YSCDICKKTF----------------IHVHMRTHTGERPFTCEVCGKSFTTGSDLKVHIRTHTNPFSCK-----VLISLRNLTYHMRIHTG---ERPFTCEVCGKSFTKGSDLKMHIR---IHTGE-------RPFSCDICNKGFINSGALTCHMRTHTGERP-------------------------------YSCKVCQKSFTQSSYLNIHMRSHTG--ERPYSCKLCQKGFLQSKDLKVH-MRTHTG---ERPFICEVCGKNFLQSTKLKAHIRTHTATKLFSCDICKKVFVSLRNLTYHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRL-HTGERP--YSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTGERPYSCHICKKVFIHSGGLTLHMRTHTGERPYSCKLCQKGFMHSRALKVHTRTHTDERP 585          

HSP 3 Score: 134.035 bits (336), Expect = 6.255e-31
Identity = 154/660 (23.33%), Postives = 252/660 (38.18%), Query Frame = 1
Query: 2041 SCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSK---YDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHK------------------NENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC--TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHIL----EEHEGC--------------------VELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            SC  C + F  S  +  H   H G   F C   Q  FT       H          S    ++T   +++     + P  C+ C   F     L++H+       F+ +  +  +   Y          F C +CG +++K   L  H+  H      SC++C     +   ++ H+R H  +                  N ++      +   C +C   +    +   H     G    P   +   +   +    + +  ++ AT  K FSC  C  +V V+ R+   H+    G   E    C++C   F  P  L+ H+R   + +GE         +SCD C  TF    R  + +   +H    P  Y C  C +         +H+  H   +  ++C  C+  F +   L LH+ T  G  +    C +C+K F +S+ ++VH      E    C                        PF+C +C + F   ++L+ H  +H    +  CD+C+K    + +   H   H   ++F C  C+  F S   +  HIR  H    P  Y C++C K  TQ   +++HM IH   R Y C+ C K F  S     H+R H GE+P+ C +CQR F     L VH+  H   R
Sbjct:  150 SCDICSKGFINSGALTCHMRTHTGERPFTCKVCQKSFTQSSYLNIHMRSHTGERPYSCDICKKTFIHVHMRTHTGERPFTCEVCGKSFTTGSDLKVHIRT-HTNPFSCKVLISLRNLTYHMRIHTGERPFTCEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPYSCKLCQKGFLQSKDLKVHMRTHTG--ERPFICEVCGKNFLQSTKLKAHIRTHTAT--KLFSCDICK-KVFVSLRNLTYHMKTHTG---ERPYSCKVCQKCFIQPSHLNIHMR---LHTGE-------RPYSCDICKKTFIHASR--LTYHMRIHTGERP--YSCKVCQKCFTQSSCLIVHMRIH-TGERPYSCHICKKVFIHSGGLTLHMRTHTG--ERPYSCKLCQKGFMHSRALKVHTRTHTDERPYSCKVCKKHFTQNSSLNVHMRIHTSERPFTCEVCGKSFTTGSDLKVHIRIHTAKKLFPCDICEKTFIHVNSLTSHMRTHTAKKLFSCDICKKVFVSSRNLTYHIRT-HTGERP--YSCKVCKKCFTQRSCLNVHMRIHTGERPYSCDICRKTFIHSNNLTLHMRTHTGERPFTCELCQRGFMHSRALKVHMRNHTGER 780          

HSP 4 Score: 100.523 bits (249), Expect = 1.117e-20
Identity = 118/545 (21.65%), Postives = 204/545 (37.43%), Query Frame = 1
Query: 2005 YHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKR-------MNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRV 3579
            YH +I+   R  SC  C + F  S+ +  H   H G   + CH  + VF        H      E    C+   +  +      ++      + P  C  C  +F Q   L +H+ I       +  P               F C +CG +++    L  H+  H +     C++C+     ++ ++ H+R H  K          K+  CDIC   + +  N  YH           I+T     P   +  K+       +N    + TG + +SC  C     +   +   H+    G   E    C +C   F     L  H+R NH     Y     +  F+  K +   H R        +H    P  + C  C +        +IH+  H   +  ++C  C+ +F  +++L +H+    G  +    C +C K F+   +++ HI   H    +L+P  C +C++ F+    L  H  +H G   + C +C+K   +    ++H   H   R F    CQ  FR   A++ H+R 
Sbjct:  491 YHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTGERPYSCHICKKVFIHSGGLTLHMRTHTGERPYSCKLCQKGFMHSRALKVHTRTHTDERPYSCKVCKKHFTQNSSLNVHMRI-----HTSERP---------------FTCEVCGKSFTTGSDLKVHIRIHTAKKLFPCDICEKTFIHVNSLTSHMRTHTAK----------KLFSCDICKKVFVSSRNLTYH-----------IRTHTGERPYSCKVCKKCFTQRSCLNVHMRIHTGERPYSCDICRKTF-IHSNNLTLHMRTHTG---ERPFTCELCQRGFMHSRALKVHMR-NHTGERPYSCKVCEKHFT-QKSSLNVHMR--------IHTGERP--FTCEVCGKSFTTGSDLKIHMRNHT-GERPYSCKVCKKHFTQKSSLNVHMRIHTG--ERPFTCEVCGKSFTTGSDLKAHI-RTHTA-KKLFP--CDICKKVFVSLRNLTCHMRIHTGERPLTCKVCEKSFTNGSDLKIHMRTHTGERPFTVKLCQKGFRQSSALKVHMRT 971          

HSP 5 Score: 84.3445 bits (207), Expect = 1.090e-15
Identity = 59/189 (31.22%), Postives = 80/189 (42.33%), Query Frame = 1
Query: 3352 FSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHV----------------------RIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            FSC +C++ F     ++ H     G  +  CD+C K   +  A   H   H   R F C  CQ +F     +  H+R  H    P  Y C IC K  T I +HM  H   R + CE CGK FT  +    H+                      RIH GE+P+ C +C + F K S+L +HI  H   R
Sbjct:  121 FSCKVCKKDFTKRKNVKLHMRTQTGEKLFSCDICSKGFINSGALTCHMRTHTGERPFTCKVCQKSFTQSSYLNIHMR-SHTGERP--YSCDICKK--TFIHVHMRTHTGERPFTCEVCGKSFTTGSDLKVHIRTHTNPFSCKVLISLRNLTYHMRIHTGERPFTCEVCGKSFTKGSDLKMHIRIHTGER 304          

HSP 6 Score: 80.4925 bits (197), Expect = 1.483e-14
Identity = 54/155 (34.84%), Postives = 77/155 (49.68%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            RT+   KL ++C  C +VF +LRNL  H+K H    T      CK C + F        HM+ +   T  + Y C ICKK     + +  HM+IH+ E   +C++C K F + S  + H+R HTGE+PY C IC   F        H++ H   R
Sbjct:  410 RTHTATKL-FSCDICKKVFVSLRNLTYHMKTH----TGERPYSCKVCQKCFIQPSHLNIHMRLH---TGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTGERPYSCHICKKVFIHSGGLTLHMRTHTGER 556          

HSP 7 Score: 79.337 bits (194), Expect = 3.346e-14
Identity = 49/146 (33.56%), Postives = 73/146 (50.00%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C  C + F    NL  H++ H    T      C+ C + F +      HM+   N T  + Y C +C+K     + +N HM+IH+ E    CE+C K F   S    H+R HTGE+PY CK+C   F++K + N H++ H   R
Sbjct:  726 YSCDICRKTFIHSNNLTLHMRTH----TGERPFTCELCQRGFMHSRALKVHMR---NHTGERPYSCKVCEKHFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKIHMRNHTGERPYSCKVCKKHFTQKSSLNVHMRIHTGER 864          

HSP 8 Score: 76.6406 bits (187), Expect = 2.086e-13
Identity = 47/146 (32.19%), Postives = 72/146 (49.32%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + C  C + F T  +L  H++IH    T  +  PC  C + F +      HM+++   T  K + C ICKKV      +  H++ H+ E   +C++C K F ++S    H+R HTGE+PY C IC   F    N   H++ H   R
Sbjct:  614 FTCEVCGKSFTTGSDLKVHIRIH----TAKKLFPCDICEKTFIHVNSLTSHMRTH---TAKKLFSCDICKKVFVSSRNLTYHIRTHTGERPYSCKVCKKCFTQRSCLNVHMRIHTGERPYSCDICRKTFIHSNNLTLHMRTHTGER 752          

HSP 9 Score: 72.0182 bits (175), Expect = 5.918e-12
Identity = 53/176 (30.11%), Postives = 78/176 (44.32%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD----------DFGNYLQIKQRGKPIKKVF 5577
            Y+C  C + F     L  H++IH    T      CK C + F        HM+ +   T  + Y C ICKKV      +  HM+ H+ E   +C++C K F        H R HT E+PY CK+C   F++  + N H++ H S R             G+ L++  R    KK+F
Sbjct:  474 YSCDICKKTFIHASRLTYHMRIH----TGERPYSCKVCQKCFTQSSCLIVHMRIH---TGERPYSCHICKKVFIHSGGLTLHMRTHTGERPYSCKLCQKGFMHSRALKVHTRTHTDERPYSCKVCKKHFTQNSSLNVHMRIHTSERPFTCEVCGKSFTTGSDLKVHIRIHTAKKLF 642          

HSP 10 Score: 72.0182 bits (175), Expect = 6.551e-12
Identity = 46/141 (32.62%), Postives = 70/141 (49.65%), Query Frame = 1
Query: 5113 EVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE-----HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            +V  +LRNL  H++IH    T      C+ C + F        H++ +   T  + + C IC K   FIN      HM+ H+ E   +C++C K F + SY   H+R HTGE+PY CK+C   F +  +   H++ H   R
Sbjct:  257 KVLISLRNLTYHMRIH----TGERPFTCEVCGKSFTKGSDLKMHIRIH---TGERPFSCDICNK--GFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPYSCKLCQKGFLQSKDLKVHMRTHTGER 388          

HSP 11 Score: 71.633 bits (174), Expect = 6.776e-12
Identity = 45/146 (30.82%), Postives = 71/146 (48.63%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHSEPSI-ACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C  C + F    +LN H++IH    T      C+ C + F        H++ +   T  K + C IC+K    +N    HM+ H+   + +C+IC K F        H+R HTGE+PY CK+C   F+++   N H++ H   R
Sbjct:  586 YSCKVCKKHFTQNSSLNVHMRIH----TSERPFTCEVCGKSFTTGSDLKVHIRIH---TAKKLFPCDICEKTFIHVNSLTSHMRTHTAKKLFSCDICKKVFVSSRNLTYHIRTHTGERPYSCKVCKKCFTQRSCLNVHMRIHTGER 724          

HSP 12 Score: 71.2478 bits (173), Expect = 1.070e-11
Identity = 41/146 (28.08%), Postives = 73/146 (50.00%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + C  C + F    +L  H++IH    T      C  C++ F N      HM+++   T  + Y C +C+K     +++N HM+ H+ E   +C++C K F +      H+R HTGE+P+ C++CG  F +      H++ H + +
Sbjct:  278 FTCEVCGKSFTKGSDLKMHIRIH----TGERPFSCDICNKGFINSGALTCHMRTH---TGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPYSCKLCQKGFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTHTATK 416          

HSP 13 Score: 70.8626 bits (172), Expect = 1.165e-11
Identity = 50/204 (24.51%), Postives = 101/204 (49.51%), Query Frame = 1
Query: 4921 IDEEFSDLDQEWSIEESDMEHSMWNISRDIVKNG-ITENSIILHKESNNRTNKKQ----KLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            +D +   ++ + ++  S +      +  D   +  + E+S +L + S++    ++    K  ++C  C + F   +N    VK+H +  T  +   C  CS+ F N      HM+++   T  + + C +C+K     +++N HM+ H+ E   +C+IC     KK++   H+R HTGE+P+ C++CG  F+   +   H++ H
Sbjct:   59 MDSKPEPIENQLTVTASLLSSDAVTVQLDSPSDSHVKESSAVLCQHSDSIHTPERPFSCKKHFSCKVCKKDFTKRKN----VKLHMRTQTGEKLFSCDICSKGFINSGALTCHMRTH---TGERPFTCKVCQKSFTQSSYLNIHMRSHTGERPYSCDIC-----KKTFIHVHMRTHTGERPFTCEVCGKSFTTGSDLKVHIRTH 250          

HSP 14 Score: 70.4774 bits (171), Expect = 1.794e-11
Identity = 45/149 (30.20%), Postives = 72/149 (48.32%), Query Frame = 1
Query: 5071 NKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            N   +  Y+C  C + F    +LN H++IH    T      C+ C + F        H++++   T  K + C ICKKV   +     HM+IH+ E  + C++C+K F   S    H+R HTGE+P+  K+C   F +      H++ H
Sbjct:  831 NHTGERPYSCKVCKKHFTQKSSLNVHMRIH----TGERPFTCEVCGKSFTTGSDLKAHIRTH---TAKKLFPCDICKKVFVSLRNLTCHMRIHTGERPLTCKVCEKSFTNGSDLKIHMRTHTGERPFTVKLCQKGFRQSSALKVHMRTH 972          

HSP 15 Score: 70.0922 bits (170), Expect = 2.539e-11
Identity = 52/174 (29.89%), Postives = 76/174 (43.68%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHS-EPSIACEICDKKFKKKS----------------------YYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            RT   +KL ++C  C++ F     L  H++ H    T      CK C + F        HM+S+   T  + Y C ICKK   FI+ HM+ H+ E    CE+C K F   S                          H+R HTGE+P+ C++CG  F+K  +   H++ H   R
Sbjct:  141 RTQTGEKL-FSCDICSKGFINSGALTCHMRTH----TGERPFTCKVCQKSFTQSSYLNIHMRSH---TGERPYSCDICKKT--FIHVHMRTHTGERPFTCEVCGKSFTTGSDLKVHIRTHTNPFSCKVLISLRNLTYHMRIHTGERPFTCEVCGKSFTKGSDLKMHIRIHTGER 304          

HSP 16 Score: 69.3218 bits (168), Expect = 3.685e-11
Identity = 45/155 (29.03%), Postives = 77/155 (49.68%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            R +  +KL + C  C + F  + +L SH++ H    T  +   C  C ++F +      H++++   T  + Y C +CKK     + +N HM+IH+ E   +C+IC K F   +    H+R HTGE+P+ C++C   F        H++ H   R
Sbjct:  634 RIHTAKKL-FPCDICEKTFIHVNSLTSHMRTH----TAKKLFSCDICKKVFVSSRNLTYHIRTH---TGERPYSCKVCKKCFTQRSCLNVHMRIHTGERPYSCDICRKTFIHSNNLTLHMRTHTGERPFTCELCQRGFMHSRALKVHMRNHTGER 780          

HSP 17 Score: 69.3218 bits (168), Expect = 4.044e-11
Identity = 49/170 (28.82%), Postives = 82/170 (48.24%), Query Frame = 1
Query: 5014 KNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            K  I  N++ LH     RT+  ++  + C  C   F   R L    K+H ++ T      CK C + F  K     HM+ +   T  + + C +C K     ++   HM+ H+ E   +C++C K F +KS    H+R HTGE+P+ C++CG  F+   +   H++ H +
Sbjct:  733 KTFIHSNNLTLHM----RTHTGER-PFTCELCQRGFMHSRAL----KVHMRNHTGERPYSCKVCEKHFTQKSSLNVHMRIH---TGERPFTCEVCGKSFTTGSDLKIHMRNHTGERPYSCKVCKKHFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKAHIRTHTA 890          

HSP 18 Score: 63.1586 bits (152), Expect = 2.808e-9
Identity = 50/181 (27.62%), Postives = 74/181 (40.88%), Query Frame = 1
Query: 5071 NKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKK----------------------KSYYVE------HLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            N   +  Y+C  C + F    +LN H++IH    T      C+ C + F        HM+   N T  + Y C +CKK     + +N HM+IH+ E    CE+C K F                        K  +V       H+R HTGE+P  CK+C   F+   +   H++ H   R
Sbjct:  775 NHTGERPYSCKVCEKHFTQKSSLNVHMRIH----TGERPFTCEVCGKSFTTGSDLKIHMR---NHTGERPYSCKVCKKHFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKAHIRTHTAKKLFPCDICKKVFVSLRNLTCHMRIHTGERPLTCKVCEKSFTNGSDLKIHMRTHTGER 948          

HSP 19 Score: 60.4622 bits (145), Expect = 2.194e-8
Identity = 44/148 (29.73%), Postives = 64/148 (43.24%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE-----HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            ++C  CN+ F     L  H++ H    T      CK C + F        HM+S+   T  + Y C +C+K   F+       HM+ H+ E    CE+C K F + +    H+R HT  K + C IC   F    N   H+K H   R
Sbjct:  306 FSCDICNKGFINSGALTCHMRTH----TGERPYSCKVCQKSFTQSSYLNIHMRSH---TGERPYSCKLCQK--GFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTHTATKLFSCDICKKVFVSLRNLTYHMKTHTGER 444          

HSP 20 Score: 58.151 bits (139), Expect = 9.399e-8
Identity = 30/93 (32.26%), Postives = 47/93 (50.54%), Query Frame = 1
Query: 3598 PER-------YECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            PER       + C++C K  T+   + +HM      + + C+ C K F  S     H+R H GE+P+ C +CQ+ F + S LN+H+  H   R
Sbjct:  111 PERPFSCKKHFSCKVCKKDFTKRKNVKLHMRTQTGEKLFSCDICSKGFINSGALTCHMRTHTGERPFTCKVCQKSFTQSSYLNIHMRSHTGER 203          

HSP 21 Score: 55.4546 bits (132), Expect = 6.144e-7
Identity = 32/112 (28.57%), Postives = 53/112 (47.32%), Query Frame = 1
Query: 5206 SQIFQNKILFAKHMKSYHN----LTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            S + ++  +  +H  S H      +  K + C +CKK       +  HM+  + E   +C+IC K F        H+R HTGE+P+ CK+C   F++    N H++ H   R
Sbjct:   92 SHVKESSAVLCQHSDSIHTPERPFSCKKHFSCKVCKKDFTKRKNVKLHMRTQTGEKLFSCDICSKGFINSGALTCHMRTHTGERPFTCKVCQKSFTQSSYLNIHMRSHTGER 203          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000035417.1 (pep primary_assembly:ASM223467v1:17:11165735:11271835:-1 gene:ENSORLG00000007097.2 transcript:ENSORLT00000035417.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 5.446e-39
Identity = 123/417 (29.50%), Postives = 189/417 (45.32%), Query Frame = 1
Query: 2698 DESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKI---VTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR--------DDYGNYLEIKPRGRGHPDYDP 3906
            D   EP+  + T   + LS  A   K FSC+ C  +V ++ R+   H+ +  G   E    C +C   F     L  H+R   I +GE         FSCD C       G +      H    P  Y C  C +         IH+  H   +  ++CD C+  F +  +L  H+ T  G  +    C +C+K F  S++++VH +  H G     PF C +C + FL   +L+AH   H    +  CD+C+KV  S++    H   H   R + C  CQ  F     +  H+R+ H    P  Y C IC K     ++++ HM IH   R Y C+ C K FT+S+    H+RIH GE+PY C +C+++F+ KS+LN+H+  H   R         ++    ++K   R H   +P
Sbjct:   46 DSKPEPIENQLTVTASLLSSDAV-TKLFSCEICK-KVLISLRNLTYHMRIHTG---ERPFTCEVCGKSFTKGSDLKMHIR---IHTGE-------RPFSCDICNKGFINSGALTCHMRTHTGERP--YSCKVCQKSFTQSSYLNIHMRSHT-GERPYSCDICKKTFIHANSLTYHMRTHTG--ERPYSCKLCQKGFLQSKDLKVH-MRTHTG---ERPFICEVCGKNFLQSTKLKAHIRTHTATKLFSCDICKKVFVSLRNLTYHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRL-HTGERP--YSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTGERPYSCEVCEKQFSYKSSLNIHMGTHTGERPFTCEVCGKNFSQRSKLKAHIRTHTAENP 435          

HSP 2 Score: 151.369 bits (381), Expect = 6.471e-37
Identity = 156/656 (23.78%), Postives = 257/656 (39.18%), Query Frame = 1
Query: 1936 NEIADKIFDLPLQISLFDSIWRL-YHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESA--EPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            ++   K+F   +   +  S+  L YH +I+   R  +C  CG+ F   +++  H   H G   F C      F +  +   H      E    C+   ++  + +   +++ +   + P  CD C   F  A+ L  H+                +   GE   S    C +C   + +   L  HM  H       C VC        ++  H+R H             K+  CDIC   + +  N  YH     G      K  +    +P +      +N    + TG + +SC  C      A R    H+ +  G   E    C++C   F     L  H+R   I +GE         +SC+ C     ++  +      H    P  + C  C +  + R   + H+  H      F CD C+  F +   L  H++T  G  +    C +C+K F     + +H +  H G     P+SC +C++ F++ N L  H   H G     C++C+K      ++ +H   H   R F C  C  +F     ++ HI     +   + + C++C K+      ++ HM  H   R + CE C K F  S   N H+RIH GEKPY C +C+++F   S+LNVH+  H   R
Sbjct:   65 SDAVTKLFSCEICKKVLISLRNLTYHMRIHTGERPFTCEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPYSCDICKKTFIHANSLTYHM----------------RTHTGERPYS----CKLCQKGFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTHT----------ATKLFSCDICKKVFVSLRNLTYHMKTHTGERPYSCKVCQKCFIQPSH------LNIHMRLHTGERPYSCDICKKTFIHASR-LTYHMRIHTG---ERPYSCKVCQKCFTQSSCLIVHMR---IHTGE-------RPYSCEVCEKQFSYKSSLNIHMGTHTGERP--FTCEVCGKNFSQRSKLKAHIRTHTAEN-PFLCDICKKVFVSLRNLTYHMKTHTG--ERPYSCKVCQKCFIQPSHLNIH-MRTHTG---ERPYSCDICKKSFIYANRLTCHMRTHTGERPYACEVCEKQFSYKSSFNVHMRIHTGERPFTCEVCGKSFTRGSDLKAHIGT---HTTEKLFPCKMCKKVFASFRNLTCHMRTHTGLRHFTCELCQKGFMDSRALNVHMRIHTGEKPY-CKVCEKKFAHNSSLNVHMRIHTGER 657          

HSP 3 Score: 88.5817 bits (218), Expect = 3.601e-17
Identity = 51/142 (35.92%), Postives = 76/142 (53.52%), Query Frame = 1
Query: 5098 CVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            C  C +VF +LRNL  H+K H    T      CK C + F        HM+++   T  + Y C ICKK   + N    HM+ H+ E   ACE+C+K+F  KS +  H+R HTGE+P+ C++CG  F++  +   H+  H +
Sbjct:  438 CDICKKVFVSLRNLTYHMKTH----TGERPYSCKVCQKCFIQPSHLNIHMRTH---TGERPYSCDICKKSFIYANRLTCHMRTHTGERPYACEVCEKQFSYKSSFNVHMRIHTGERPFTCEVCGKSFTRGSDLKAHIGTHTT 572          

HSP 4 Score: 87.4261 bits (215), Expect = 9.074e-17
Identity = 56/155 (36.13%), Postives = 82/155 (52.90%), Query Frame = 1
Query: 5065 RTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            RT+   KL ++C  C +VF +LRNL  H+K H    T      CK C + F        HM+ +   T  + Y C ICKK     + +  HM+IH+ E   +C++C K F + S  + H+R HTGE+PY C++C  +FS K + N H+  H   R
Sbjct:  260 RTHTATKL-FSCDICKKVFVSLRNLTYHMKTH----TGERPYSCKVCQKCFIQPSHLNIHMRLH---TGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTGERPYSCEVCEKQFSYKSSLNIHMGTHTGER 406          

HSP 5 Score: 80.4925 bits (197), Expect = 1.248e-14
Identity = 42/143 (29.37%), Postives = 74/143 (51.75%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            + C  C + F    +L +H+  H    T  +  PCK C ++F +      HM+++  L   + + C +C+K       +N HM+IH+     C++C+KKF   S    H+R HTGE+P+ C++CG  F+   +   H++ H +
Sbjct:  548 FTCEVCGKSFTRGSDLKAHIGTH----TTEKLFPCKMCKKVFASFRNLTCHMRTHTGL---RHFTCELCQKGFMDSRALNVHMRIHTGEKPYCKVCEKKFAHNSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKVHIRTHTA 683          

HSP 6 Score: 79.7221 bits (195), Expect = 2.155e-14
Identity = 110/544 (20.22%), Postives = 193/544 (35.48%), Query Frame = 1
Query: 1846 TETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWRL-YHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDG----------VSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG 3426
            T TGE  ++     +N  + +  +         A K+F   +   +F S+  L YH K +   R  SC  C + F   +++  H   H G   + C   +  F        H                     ++       C  C KC   F Q+  L +H+ I  G            F+ ++ L+     G       F C +CG N+S+   L +H+  H +     C++CK    S+  ++ H++ H          G+R    C +C   +    +   H     G    P   D   +        R+       TG + ++C+ C  +       +  H+ +  G   E    C +C   F     L  H+       G +     + +F C  C   F  FR +  H   +   +    + C  C +   D R   +H+  H   +    C  C+  F + ++L +H+    G  +    C +C K F+   +++VHI     G +    F C +C++ F+    L  H   H G
Sbjct:  233 THTGERPFICEVCGKN--FLQSTKLKAHIRTHTATKLFSCDICKKVFVSLRNLTYHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRLHTGERPYSCDICKKTFIHASRLTYH-------------------MRIHTGERPYSCKVCQKC---FTQSSCLIVHMRIHTGERPYSCEVCEKQFSYKSSLN--IHMGTHTGERPFTCEVCGKNFSQRSKLKAHIRTHTAENPFLCDICKKVFVSLRNLTYHMKTHT---------GERP-YSCKVCQKCFIQPSHLNIHMRTHTG--ERPYSCDICKKSFI--YANRLTCHMRTHTGERPYACEVCEKQFSYKS-SFNVHMRIHTG---ERPFTCEVCGKSFTRGSDLKAHI-------GTHTT---EKLFPCKMCKKVFASFRNLTCH---MRTHTGLRHFTCELCQKGFMDSRALNVHMRIHTGEKPY--CKVCEKKFAHNSSLNVHMRIHTG--ERPFTCEVCGKSFTTGSDLKVHIRTHTAGKI----FPCDICKKVFVSLRNLTCHMRTHTG 711          

HSP 7 Score: 77.0258 bits (188), Expect = 1.385e-13
Identity = 45/146 (30.82%), Postives = 74/146 (50.68%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + C  C + F     L +H++ H    T      C  C ++F +      HMK++   T  + Y C +C+K     + +N HM+ H+ E   +C+IC K F   +    H+R HTGE+PY C++C  +FS K ++N H++ H   R
Sbjct:  408 FTCEVCGKNFSQRSKLKAHIRTH----TAENPFLCDICKKVFVSLRNLTYHMKTH---TGERPYSCKVCQKCFIQPSHLNIHMRTHTGERPYSCDICKKSFIYANRLTCHMRTHTGERPYACEVCEKQFSYKSSFNVHMRIHTGER 546          

HSP 8 Score: 75.8702 bits (185), Expect = 2.935e-13
Identity = 61/223 (27.35%), Postives = 103/223 (46.19%), Query Frame = 1
Query: 4870 ARKSDLN-SNETTSLKRKIDEEFSDLDQEWSIEESDMEHSMWNISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE-----HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            A  SDL  S+   + +  I  E    + ++ + E D E+   +   + ++N +T  + +L  ++  +        ++C  C +V  +LRNL  H++IH    T      C+ C + F        H++ +   T  + + C IC K   FIN      HM+ H+ E   +C++C K F + SY   H+R HTGE+PY C IC   F    +   H++ H   R
Sbjct:    6 ATYSDLFFSHAVAASQTGITRECVLENYDFMVTEDDQEN--MDSKPEPIENQLTVTASLLSSDAVTKL-------FSCEICKKVLISLRNLTYHMRIH----TGERPFTCEVCGKSFTKGSDLKMHIRIH---TGERPFSCDICNK--GFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPYSCDICKKTFIHANSLTYHMRTHTGER 210          

HSP 9 Score: 70.8626 bits (172), Expect = 1.081e-11
Identity = 46/146 (31.51%), Postives = 66/146 (45.21%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C  C + F     L  H++IH    T      CK C + F        HM+ +   T  + Y C +C+K  ++   +N HM  H+ E    CE+C K F ++S    H+R HT E P+ C IC   F    N   H+K H   R
Sbjct:  324 YSCDICKKTFIHASRLTYHMRIH----TGERPYSCKVCQKCFTQSSCLIVHMRIH---TGERPYSCEVCEKQFSYKSSLNIHMGTHTGERPFTCEVCGKNFSQRSKLKAHIRTHTAENPFLCDICKKVFVSLRNLTYHMKTHTGER 462          

HSP 10 Score: 70.0922 bits (170), Expect = 2.031e-11
Identity = 44/146 (30.14%), Postives = 69/146 (47.26%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            ++C  CN+ F     L  H++ H    T      CK C + F        HM+S+   T  + Y C ICKK     N    HM+ H+ E   +C++C K F +      H+R HTGE+P+ C++CG  F +      H++ H + +
Sbjct:  128 FSCDICNKGFINSGALTCHMRTH----TGERPYSCKVCQKSFTQSSYLNIHMRSH---TGERPYSCDICKKTFIHANSLTYHMRTHTGERPYSCKLCQKGFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTHTATK 266          

HSP 11 Score: 66.2402 bits (160), Expect = 2.659e-10
Identity = 46/146 (31.51%), Postives = 67/146 (45.89%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y C  C + F    + N H++IH    T      C+ C + F        H+ ++   T  K + C +CKKV A       HM+ H+      CE+C K F        H+R HTGEKPY CK+C  +F+   + N H++ H   R
Sbjct:  520 YACEVCEKQFSYKSSFNVHMRIH----TGERPFTCEVCGKSFTRGSDLKAHIGTH---TTEKLFPCKMCKKVFASFRNLTCHMRTHTGLRHFTCELCQKGFMDSRALNVHMRIHTGEKPY-CKVCEKKFAHNSSLNVHMRIHTGER 657          

HSP 12 Score: 66.2402 bits (160), Expect = 3.073e-10
Identity = 49/150 (32.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query: 5068 TNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            T+  +KL + C  C +VF + RNL  H++ H    T      C+ C + F +      HM+ +   T  K Y C +C+K  A    +N HM+IH+ E    CE+C K F   S    H+R HT  K + C IC   F    N   H++ H
Sbjct:  569 THTTEKL-FPCKMCKKVFASFRNLTCHMRTH----TGLRHFTCELCQKGFMDSRALNVHMRIH---TGEKPY-CKVCEKKFAHNSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKVHIRTHTAGKIFPCDICKKVFVSLRNLTCHMRTH 709          

HSP 13 Score: 65.0846 bits (157), Expect = 5.919e-10
Identity = 44/146 (30.14%), Postives = 68/146 (46.58%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C  C + F    +LN H++ H    T      C  C + F        HM+++   T  + Y C +C+K  ++    N HM+IH+ E    CE+C K F + S    H+  HT EK + CK+C   F+   N   H++ H   R
Sbjct:  464 YSCKVCQKCFIQPSHLNIHMRTH----TGERPYSCDICKKSFIYANRLTCHMRTH---TGERPYACEVCEKQFSYKSSFNVHMRIHTGERPFTCEVCGKSFTRGSDLKAHIGTHTTEKLFPCKMCKKVFASFRNLTCHMRTHTGLR 602          

HSP 14 Score: 58.9214 bits (141), Expect = 5.803e-8
Identity = 43/148 (29.05%), Postives = 64/148 (43.24%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE-----HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C  C + F     LN H++ H    T      C  C + F +      HM+++   T  + Y C +C+K   F+       HM+ H+ E    CE+C K F + +    H+R HT  K + C IC   F    N   H+K H   R
Sbjct:  156 YSCKVCQKSFTQSSYLNIHMRSH----TGERPYSCDICKKTFIHANSLTYHMRTH---TGERPYSCKLCQK--GFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTHTATKLFSCDICKKVFVSLRNLTYHMKTHTGER 294          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000033373.1 (pep primary_assembly:ASM223467v1:17:11165735:11271835:-1 gene:ENSORLG00000007097.2 transcript:ENSORLT00000033373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.073 bits (401), Expect = 6.184e-39
Identity = 169/707 (23.90%), Postives = 280/707 (39.60%), Query Frame = 1
Query: 1936 NEIADKIFDLPLQISLFDSIWRL-YHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEP--LYKRRTKRMNELSY---MATGMKKFSCKFCNA---------------EVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG------------------------------MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            ++   K+F   +   +  S+  L YH +I+   R  +C  CG+ F   +++  H   H G   F C      F +  +   H      E    C+   ++  + +   +++ +   + P  CD C   F  A+ L  H+          C           D K           FIC +CG N+ +   L +H+  H      SC++CK    S+  ++ H++ H          G+R    C +C   +             H  +H  + T E      + K+     + L+Y   + TG + +SCK C                  V V+ R+   H+    G   E    C+IC   F     L+ H+R   I +GE         F+C+ C   F   R + AH    H    P  Y C  C +    +   ++H+  H   +L FTC+ C+ +F +   L  H+ T   ++     C +C+K F  S+++++H +  H G     P+SC +C+++F +++ L  H   H G                                 CD+C+KV  S++    H   H   R + C  CQ  F     +  H+R  H    P  Y C IC K      +++ HM  H   R Y CE C K+F+  + +N H+RIH GE+P+ C +C + F + S+L  HI  H
Sbjct:   65 SDAVTKLFSCEICKKVLISLRNLTYHMRIHTGERPFTCEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPYSCDICKKTFIHANSLTYHMRTHTGERPYSCKLCQKGFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTHTATKLFSCDICKKVFVSLRNLTYHMKTHT---------GERP-YSCKVCQKCF---------IQPSHLNIHMRLHTGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTVFVSLRNLTYHMKTHTG---ERPYSCKICLKRFTQKSSLNVHMR---IHTGE-------RPFTCEVCGKSFTTGRDLKAH-MRTHTGEKP--YSCKVCEKHFTQKYSLKVHMRIHTGERL-FTCEVCRKFFASLRNLTCHVRTHTSLR--PFTCQLCQKGFMQSRDLKIH-MRIHTG---ERPYSCEVCEKQFSYKSSLNIHMGTHTGERPFTCEVCGKNFSQRSKLKAHIRTHTAENPFLCDICKKVFVSLRNLTYHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRT-HTGERP--YSCDICKKSFIYANRLTCHMRTHTGERPYACEVCEKQFSYKSSFNVHMRIHTGERPFTCEVCGKSFTRGSDLKAHIGTH 726          

HSP 2 Score: 140.969 bits (354), Expect = 3.221e-33
Identity = 157/659 (23.82%), Postives = 246/659 (37.33%), Query Frame = 1
Query: 1939 EIADKIFDLPLQISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH---HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMA-----------TGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGL-TVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIV---TQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            ++  K F  P  +++        H +++   R  SC  C + F  ++ +  H   H G   + C   Q  FT       H   H  F+                 ++     + P  C  C   F Q   L +H+ I  G                       F C +CG +++    L +HM  H      SC VC+        +  H+R H          G+R +  C++C  F+ +  N   H           ++T  S  P     T ++ +  +M            TG + +SC+ C  +       Y   L++  G  T E    C +C   F    +L  H+R +            ++ F CD C   F   R +  H    H    P  Y C  C +         IH+  H   +  ++CD C+  F     L  H+ T  G  +    C +CEK FS      VH +  H G     PF+C +C + F   ++L+AH   H    +  C +C+KV  S +    H   H   R F C  CQ  F    A+  H+R+       E+  C++C K     + +++HM IH   R + CE CGK FT  +    H+R H   K + C IC++ F    NL  H+  H
Sbjct:  299 KVCQKCFIQPSHLNI--------HMRLHTGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTVFVS----------LRNLTYHMKTHTGERPYSCKICLKRFTQKSSLNVHMRIHTG--------------------ERPFTCEVCGKSFTTGRDLKAHMRTHTGEKPYSCKVCEKHFTQKYSLKVHMRIHT---------GER-LFTCEVCRKFFASLRNLTCH-----------VRTHTSLRPF----TCQLCQKGFMQSRDLKIHMRIHTGERPYSCEVCEKQF-----SYKSSLNIHMGTHTGERPFTCEVCGKNFSQRSKLKAHIRTH----------TAENPFLCDICKKVFVSLRNLTYH-MKTHTGERP--YSCKVCQKCFIQPSHLNIHMRTHT-GERPYSCDICKKSFIYANRLTCHMRTHTG--ERPYACEVCEKQFSYKSSFNVH-MRIHTG---ERPFTCEVCGKSFTRGSDLKAHIGTHTTEKLFPCKMCKKVFASFRNLTCHMRTHTGLRHFTCELCQKGFMDSRALNVHMRIH----TGEKPYCKVCEKKFAHNSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKVHIRTHTAGKIFPCDICKKVFVSLRNLTCHMRTH 865          

HSP 3 Score: 137.887 bits (346), Expect = 2.758e-32
Identity = 127/535 (23.74%), Postives = 221/535 (41.31%), Query Frame = 1
Query: 2416 FICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSY---MATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHI---------------LEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKI---VTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR--------DDYGNYLEIKPRGRGHPDYDP 3906
            F C +CG +++K   L  H+  H      SC++C     +   ++ H+R H          G+R    C +C   +        H  +  G    P   D     + K+     N L+Y     TG + +SCK C     +  +D   H+    G   E   +C +C   F    +L  H+R +              +FSCD C   F   R +  H    H    P  Y C  C +         IH+  H   +  ++CD C+  F + + L  H+    G  +    C +C+K F+ S  + VH+               ++ H G     P+SC +C ++F  ++ L  H  +H G     C++C K   + +  + H   H   + + C  C+  F  K +++ H+R+   +     + C++C K    +  ++ H+  H + R + C+ C K F +S     H+RIH GE+PY C +C+++F+ KS+LN+H+  H   R         ++    ++K   R H   +P
Sbjct:  100 FTCEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHT---------GERP-YSCKVCQKSFTQSSYLNIHMRSHTG--ERPYSCD-----ICKKTFIHANSLTYHMRTHTGERPYSCKLCQKGF-LQSKDLKVHMRTHTG---ERPFICEVCGKNFLQSTKLKAHIRTH----------TATKLFSCDICKKVFVSLRNLTYH-MKTHTGERP--YSCKVCQKCFIQPSHLNIHMRLHT-GERPYSCDICKKTFIHASRLTYHMRIHTG--ERPYSCKVCQKCFTQSSCLIVHMRIHTVFVSLRNLTYHMKTHTG---ERPYSCKICLKRFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGRDLKAHMRTHTGEKPYSCKVCEKHFTQKYSLKVHMRI---HTGERLFTCEVCRKFFASLRNLTCHVRTHTSLRPFTCQLCQKGFMQSRDLKIHMRIHTGERPYSCEVCEKQFSYKSSLNIHMGTHTGERPFTCEVCGKNFSQRSKLKAHIRTHTAENP 591          

HSP 4 Score: 135.961 bits (341), Expect = 1.057e-31
Identity = 123/446 (27.58%), Postives = 181/446 (40.58%), Query Frame = 1
Query: 2572 VSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRV---------------DHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            +S     K+  C+IC     +  N  YH     G    P   +   +   K    +M+    + TG + FSC  CN     +G     H+    G   E    C++C   F     L+ H+R +   +GE         +SCD C   F H   +  H    H    P  Y C  C +     +  ++H+  H   +  F C+ C   F     LK H+ T    K     C IC+K F + + +  H ++ H G     P+SC +CQ+ F+  + L  H  +H G     CD+C+K          H   H   R + C  CQ  F     +  H+R+                H    P  Y C+IC K  TQ   +++HM IH   R + CE CGK FT       H+R H GEKPY C +C++ F +K +L VH+  H   R
Sbjct:   63 LSSDAVTKLFSCEICKKVLISLRNLTYHMRIHTG--ERPFTCEVCGKSFTKGSDLKMH--IRIHTGERPFSCDICNKGFINSG-ALTCHMRTHTG---ERPYSCKVCQKSFTQSSYLNIHMRSH---TGE-------RPYSCDICKKTFIHANSLTYH-MRTHTGERP--YSCKLCQKGFLQSKDLKVHMRTHT-GERPFICEVCGKNFLQSTKLKAHIRTHTATKL--FSCDICKKVFVSLRNLTYH-MKTHTG---ERPYSCKVCQKCFIQPSHLNIHMRLHTGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTVFVSLRNLTYHMKTHTGERP--YSCKICLKRFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGRDLKAHMRTHTGEKPYSCKVCEKHFTQKYSLKVHMRIHTGER 478          

HSP 5 Score: 88.5817 bits (218), Expect = 4.245e-17
Identity = 51/142 (35.92%), Postives = 76/142 (53.52%), Query Frame = 1
Query: 5098 CVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            C  C +VF +LRNL  H+K H    T      CK C + F        HM+++   T  + Y C ICKK   + N    HM+ H+ E   ACE+C+K+F  KS +  H+R HTGE+P+ C++CG  F++  +   H+  H +
Sbjct:  594 CDICKKVFVSLRNLTYHMKTH----TGERPYSCKVCQKCFIQPSHLNIHMRTH---TGERPYSCDICKKSFIYANRLTCHMRTHTGERPYACEVCEKQFSYKSSFNVHMRIHTGERPFTCEVCGKSFTRGSDLKAHIGTHTT 728          

HSP 6 Score: 84.3445 bits (207), Expect = 8.107e-16
Identity = 104/495 (21.01%), Postives = 180/495 (36.36%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHH-----EEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDG----------VSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLS-----CNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG 3426
            H +I+   R  +C  CG+ F    ++  H   H G   + C   +  FT   S K H      E    CE   +          ++    S  P  C  C   F Q+  L++H+ I  G            F+ ++ L+     G       F C +CG N+S+   L +H+  H +     C++CK    S+  ++ H++ H          G+R    C +C   +    +   H     G    P   D   +        R+       TG + ++C+ C  +       +  H+ +  G   E    C +C   F     L  H+       G +     + +F C  C   F  FR +  H   +   +    + C  C +   D R   +H+  H   +    C  C+  F + ++L +H+    G  +    C +C K F+   +++VHI     G +    F C +C++ F+    L  H   H G
Sbjct:  414 HMRIHTGERPFTCEVCGKSFTTGRDLKAHMRTHTGEKPYSCKVCEKHFTQKYSLKVHMRIHTGERLFTCEVCRKFFASLRNLTCHVRTHTSLRPFTCQLCQKGFMQSRDLKIHMRIHTGERPYSCEVCEKQFSYKSSLN--IHMGTHTGERPFTCEVCGKNFSQRSKLKAHIRTHTAENPFLCDICKKVFVSLRNLTYHMKTHT---------GERP-YSCKVCQKCFIQPSHLNIHMRTHTG--ERPYSCDICKKSFIY--ANRLTCHMRTHTGERPYACEVCEKQFSYKS-SFNVHMRIHTG---ERPFTCEVCGKSFTRGSDLKAHI-------GTHTT---EKLFPCKMCKKVFASFRNLTCH---MRTHTGLRHFTCELCQKGFMDSRALNVHMRIHTGEKPY--CKVCEKKFAHNSSLNVHMRIHTG--ERPFTCEVCGKSFTTGSDLKVHIRTHTAGKI----FPCDICKKVFVSLRNLTCHMRTHTG 867          

HSP 7 Score: 80.4925 bits (197), Expect = 1.572e-14
Identity = 42/143 (29.37%), Postives = 74/143 (51.75%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            + C  C + F    +L +H+  H    T  +  PCK C ++F +      HM+++  L   + + C +C+K       +N HM+IH+     C++C+KKF   S    H+R HTGE+P+ C++CG  F+   +   H++ H +
Sbjct:  704 FTCEVCGKSFTRGSDLKAHIGTH----TTEKLFPCKMCKKVFASFRNLTCHMRTHTGL---RHFTCELCQKGFMDSRALNVHMRIHTGEKPYCKVCEKKFAHNSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKVHIRTHTA 839          

HSP 8 Score: 78.9518 bits (193), Expect = 3.738e-14
Identity = 53/159 (33.33%), Postives = 73/159 (45.91%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMK-----------SYHNLTET--KKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C  C + F     L  H++IH    T      CK C + F        HM+           +YH  T T  + Y C IC K     + +N HM+IH+ E    CE+C K F        H+R HTGEKPY CK+C   F++KY+   H++ H   R
Sbjct:  324 YSCDICKKTFIHASRLTYHMRIH----TGERPYSCKVCQKCFTQSSCLIVHMRIHTVFVSLRNLTYHMKTHTGERPYSCKICLKRFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGRDLKAHMRTHTGEKPYSCKVCEKHFTQKYSLKVHMRIHTGER 478          

HSP 9 Score: 77.0258 bits (188), Expect = 1.624e-13
Identity = 45/146 (30.82%), Postives = 74/146 (50.68%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + C  C + F     L +H++ H    T      C  C ++F +      HMK++   T  + Y C +C+K     + +N HM+ H+ E   +C+IC K F   +    H+R HTGE+PY C++C  +FS K ++N H++ H   R
Sbjct:  564 FTCEVCGKNFSQRSKLKAHIRTH----TAENPFLCDICKKVFVSLRNLTYHMKTH---TGERPYSCKVCQKCFIQPSHLNIHMRTHTGERPYSCDICKKSFIYANRLTCHMRTHTGERPYACEVCEKQFSYKSSFNVHMRIHTGER 702          

HSP 10 Score: 75.8702 bits (185), Expect = 3.398e-13
Identity = 61/223 (27.35%), Postives = 103/223 (46.19%), Query Frame = 1
Query: 4870 ARKSDLN-SNETTSLKRKIDEEFSDLDQEWSIEESDMEHSMWNISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE-----HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            A  SDL  S+   + +  I  E    + ++ + E D E+   +   + ++N +T  + +L  ++  +        ++C  C +V  +LRNL  H++IH    T      C+ C + F        H++ +   T  + + C IC K   FIN      HM+ H+ E   +C++C K F + SY   H+R HTGE+PY C IC   F    +   H++ H   R
Sbjct:    6 ATYSDLFFSHAVAASQTGITRECVLENYDFMVTEDDQEN--MDSKPEPIENQLTVTASLLSSDAVTKL-------FSCEICKKVLISLRNLTYHMRIH----TGERPFTCEVCGKSFTKGSDLKMHIRIH---TGERPFSCDICNK--GFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPYSCDICKKTFIHANSLTYHMRTHTGER 210          

HSP 11 Score: 75.485 bits (184), Expect = 4.237e-13
Identity = 47/146 (32.19%), Postives = 68/146 (46.58%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + C  C + F +LRNL  HV+ H    T      C+ C + F        HM+ +   T  + Y C +C+K  ++   +N HM  H+ E    CE+C K F ++S    H+R HT E P+ C IC   F    N   H+K H   R
Sbjct:  480 FTCEVCRKFFASLRNLTCHVRTH----TSLRPFTCQLCQKGFMQSRDLKIHMRIH---TGERPYSCEVCEKQFSYKSSLNIHMGTHTGERPFTCEVCGKNFSQRSKLKAHIRTHTAENPFLCDICKKVFVSLRNLTYHMKTHTGER 618          

HSP 12 Score: 73.1738 bits (178), Expect = 2.672e-12
Identity = 44/146 (30.14%), Postives = 72/146 (49.32%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + C  C + F T R+L +H++ H    T  +   CK C + F  K     HM+ +   T  + + C +C+K  A +     H++ H+      C++C K F +      H+R HTGE+PY C++C  +FS K + N H+  H   R
Sbjct:  424 FTCEVCGKSFTTGRDLKAHMRTH----TGEKPYSCKVCEKHFTQKYSLKVHMRIH---TGERLFTCEVCRKFFASLRNLTCHVRTHTSLRPFTCQLCQKGFMQSRDLKIHMRIHTGERPYSCEVCEKQFSYKSSLNIHMGTHTGER 562          

HSP 13 Score: 71.2478 bits (173), Expect = 8.329e-12
Identity = 53/172 (30.81%), Postives = 81/172 (47.09%), Query Frame = 1
Query: 5014 KNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            K  I  NS+  H     RT+  ++  Y+C  C + F   ++L  H++ H    T      C+ C + F        H++++   T TK + C ICKKV   +     HMK H+ E   +C++C K F + S+   H+R HTGE+PY C IC   F        H++ H   R
Sbjct:  191 KTFIHANSLTYHM----RTHTGER-PYSCKLCQKGFLQSKDLKVHMRTH----TGERPFICEVCGKNFLQSTKLKAHIRTH---TATKLFSCDICKKVFVSLRNLTYHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRLHTGERPYSCDICKKTFIHASRLTYHMRIHTGER 350          

HSP 14 Score: 69.3218 bits (168), Expect = 3.613e-11
Identity = 43/145 (29.66%), Postives = 72/145 (49.66%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESY 5514
            + C  C + F     L +H++ H    T  +   C  C ++F +      HMK++   T  + Y C +C+K     + +N HM++H+ E   +C+IC K F   S    H+R HTGE+PY CK+C   F++      H++ H  +
Sbjct:  240 FICEVCGKNFLQSTKLKAHIRTH----TATKLFSCDICKKVFVSLRNLTYHMKTH---TGERPYSCKVCQKCFIQPSHLNIHMRLHTGERPYSCDICKKTFIHASRLTYHMRIHTGERPYSCKVCQKCFTQSSCLIVHMRIHTVF 377          

HSP 15 Score: 66.2402 bits (160), Expect = 3.141e-10
Identity = 46/146 (31.51%), Postives = 67/146 (45.89%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y C  C + F    + N H++IH    T      C+ C + F        H+ ++   T  K + C +CKKV A       HM+ H+      CE+C K F        H+R HTGEKPY CK+C  +F+   + N H++ H   R
Sbjct:  676 YACEVCEKQFSYKSSFNVHMRIH----TGERPFTCEVCGKSFTRGSDLKAHIGTH---TTEKLFPCKMCKKVFASFRNLTCHMRTHTGLRHFTCELCQKGFMDSRALNVHMRIHTGEKPY-CKVCEKKFAHNSSLNVHMRIHTGER 813          

HSP 16 Score: 65.855 bits (159), Expect = 3.753e-10
Identity = 49/150 (32.67%), Postives = 71/150 (47.33%), Query Frame = 1
Query: 5068 TNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            T+  +KL + C  C +VF + RNL  H++ H    T      C+ C + F +      HM+ +   T  K Y C +C+K  A    +N HM+IH+ E    CE+C K F   S    H+R HT  K + C IC   F    N   H++ H
Sbjct:  725 THTTEKL-FPCKMCKKVFASFRNLTCHMRTH----TGLRHFTCELCQKGFMDSRALNVHMRIH---TGEKPY-CKVCEKKFAHNSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKVHIRTHTAGKIFPCDICKKVFVSLRNLTCHMRTH 865          

HSP 17 Score: 65.0846 bits (157), Expect = 6.679e-10
Identity = 44/146 (30.14%), Postives = 68/146 (46.58%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C  C + F    +LN H++ H    T      C  C + F        HM+++   T  + Y C +C+K  ++    N HM+IH+ E    CE+C K F + S    H+  HT EK + CK+C   F+   N   H++ H   R
Sbjct:  620 YSCKVCQKCFIQPSHLNIHMRTH----TGERPYSCDICKKSFIYANRLTCHMRTH---TGERPYACEVCEKQFSYKSSFNVHMRIHTGERPFTCEVCGKSFTRGSDLKAHIGTHTTEKLFPCKMCKKVFASFRNLTCHMRTHTGLR 758          

HSP 18 Score: 58.9214 bits (141), Expect = 5.076e-8
Identity = 40/146 (27.40%), Postives = 67/146 (45.89%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHSEPSI-ACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C  C + F    +L  H++ H    T      CK C + F        HM+++   T  + + C +C K       +  H++ H+   + +C+IC K F        H++ HTGE+PY CK+C   F +  + N H++ H   R
Sbjct:  184 YSCDICKKTFIHANSLTYHMRTH----TGERPYSCKLCQKGFLQSKDLKVHMRTH---TGERPFICEVCGKNFLQSTKLKAHIRTHTATKLFSCDICKKVFVSLRNLTYHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRLHTGER 322          
BLAST of Zinc finger protein vs. Ensembl Medaka
Match: ENSORLT00000031019.1 (pep primary_assembly:ASM223467v1:17:11111179:11269269:-1 gene:ENSORLG00000007097.2 transcript:ENSORLT00000031019.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.836 bits (390), Expect = 9.256e-38
Identity = 155/620 (25.00%), Postives = 250/620 (40.32%), Query Frame = 1
Query: 2032 RDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGM--KKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            R  +C  CG+ F   +++  H   H G   F C      F +  +   H      E    C+   ++  + +   +++ +   + P  CD C   F  +  L++H+ I  G         +  Y            C IC   +     L  HM  H      SC VC+        ++ H+R H          G+R    C+IC   +    +  YH     G  H       + E   K   +  +  ++M T    + +SCK C           V H+ +  G   E    C +C  IF    +L  H R +   +GE        +FSCD C   F   R +  H    H    P  Y C  C +R        +H+  H   +  FTC  C       + LK+H+ T  G  +  L C +C+K F  S  ++ H +  H G     P+SC +C+++F +++ L  H  +H G     C++C K   +    ++H   H   + F C  C+  F S  +   H+R  H +L P  + C++C K   Q   + +HM IH   R Y CE C K+F+  +  + H+R H GE+P+ C +C + F+++S L  HI  H
Sbjct:   11 RPFTCEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPFTCDVCGKGFTISSYLKIHMRIHTG---------ERPYS-----------CDICNKGFVSSGALTGHMRTHTGEKPYSCKVCQKCFFQSSYLNIHMRIHT---------GERP-YSCEICKKAFIYANSLTYHMRTHTGERH------FTCEICQKDFMQSRDLKAHMGTHKDERPYSCKVCEKRFTHKSSLNV-HMRIHTG---ETPFTCEVCGKIFSQRSKLKAHTRSH---TGE-------KLFSCDICKKVFVSLRNLTCH-MRTHTGERP--YSCKVCLKRFTQTSCLNVHMRIH-TGERPFTCKVCGKSLIKSSDLKIHMRTHTG--ERHLTCKLCQKGFRQSSALKAH-MGTHTG---ERPYSCEVCEKQFSYKSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKVHIETHTAEKPFPCDICKKAFASLRSFTCHMRT-HTSLRP--FTCKLCQKGFMQSRDLKIHMRIHTGERPYSCELCEKQFSYKSSLSVHIRTHTGERPFTCEVCGKTFSQRSKLKAHIRTH 567          

HSP 2 Score: 149.058 bits (375), Expect = 5.796e-36
Identity = 166/641 (25.90%), Postives = 245/641 (38.22%), Query Frame = 1
Query: 1972 QISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNH-----LSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDIC-NDFYGTKVNYYYHQWNEHGVVHP---PIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKC-TFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKI---VTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            Q   F S +   H +I+   R  SC  C + F  + ++  H   H G   F C   Q  F   +  K+H     D                       + P  C  C   F     L +H+ I  G      TP               F C +CG  +S+   L +H  +H      SC++CK    S+  ++ H+R H          G+R    C +C   F  T         N H  +H    P       + L K    +++  ++  TG +  +CK C    + +      H+    G   E    C +C   F     L+ H+R   I +GE         F+C+ C   F     +  H    H    P  + C  C +  A  R +  H+  H   +  FTC  CQ  F     LK+H+    G  +    C +CEK FS    + VHI   H G     PF+C +C + F   ++L+AH   H       CD+C+KV  S++    H   H   R + C  CQ  F     +  H+R+ H    P  Y C IC K      +++ HM  H   R + CE C K F  S     H+R H GE+PY C +C++ F   S+L VH+  H   R
Sbjct:  159 QKCFFQSSYLNIHMRIHTGERPYSCEICKKAFIYANSLTYHMRTHTGERHFTCEICQKDFMQSRDLKAHMGTHKD-----------------------ERPYSCKVCEKRFTHKSSLNVHMRIHTG-----ETP---------------FTCEVCGKIFSQRSKLKAHTRSHTGEKLFSCDICKKVFVSLRNLTCHMRTHT---------GERP-YSCKVCLKRFTQTSC------LNVHMRIHTGERPFTCKVCGKSLIKSSDLKIHMRTH--TGERHLTCKLCQKGFRQSS-ALKAHMGTHTG---ERPYSCEVCEKQFSYKSSLNVHMR---IHTGE-------RPFTCEVCGKSFTTGSDLKVH-IETHTAEKP--FPCDICKKAFASLRSFTCHMRTHTSLR-PFTCKLCQKGFMQSRDLKIHMRIHTG--ERPYSCELCEKQFSYKSSLSVHI-RTHTG---ERPFTCEVCGKTFSQRSKLKAHIRTHTAENPFSCDICKKVFVSLRNLTCHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRI-HTGERP--YSCDICKKTFIHANRLTCHMRTHTGERPFTCELCQKGFMDSRALKVHMRTHTGERPYSCKVCEKNFAHNSSLKVHMRIHTGER 711          

HSP 3 Score: 99.7525 bits (247), Expect = 1.577e-20
Identity = 59/171 (34.50%), Postives = 84/171 (49.12%), Query Frame = 1
Query: 3349 PFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGK---IVTQISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            PF+C +C + F   ++L+ H  +H G     CD+C K   +  A   H   H   R + C  CQ +F     +  H+R  H    P  + C +CGK   I + + +HM IH   R Y C+ C K F  S     H+R H GEKPY C +CQ+ F + S LN+H+  H   R
Sbjct:   12 PFTCEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMR-SHTGERP--FTCDVCGKGFTISSYLKIHMRIHTGERPYSCDICNKGFVSSGALTGHMRTHTGEKPYSCKVCQKCFFQSSYLNIHMRIHTGER 179          

HSP 4 Score: 96.2857 bits (238), Expect = 1.984e-19
Identity = 120/557 (21.54%), Postives = 200/557 (35.91%), Query Frame = 1
Query: 2008 HQKINGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSH-----HEEFIDCXXXXXXXXXXXXXXLNISASLSDCP-QCDKCYDYFPQADILRLHLDI--------CDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHL-----SCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFC------------NAEVKVAGRDYV-----KHLDVKHGLTVELDT-------LCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCT-FFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQAT 3540
            H   + D R  SC  C + F   +++  H   H G   F C     +F+     K+H      E+   C+   +  +       ++     + P  C  C   F Q   L +H+ I        C     +     D K             C +C   + +   L +HM  H      SC VC+ +      ++ H+R H          G+R    C++C   + T  +   H   E      P   D   +     R+   +  ++  T ++ F+CK C            +  +    R Y      K    K  L+V + T        C +C   F    +L  H+R +            ++ FSCD C   F   R +  H    H    P  Y C  C +         IH+  H   +  ++CD C+  F +   L  H+ T  G  +    C +C+K F +S+ ++VH +  H G     P+SC +C++ F   + L+ H  +H G     C++C K   +    + H   H   ++F C  C  T
Sbjct:  227 HMGTHKDERPYSCKVCEKRFTHKSSLNVHMRIHTGETPFTCEVCGKIFSQRSKLKAHTRSHTGEKLFSCDICKKVFVSLRNLTCHMRTHTGERPYSCKVCLKRFTQTSCLNVHMRIHTGERPFTCKVCGKSLIKSSDLKIHMRTHTGERHLTCKLCQKGFRQSSALKAHMGTHTGERPYSCEVCEKQFSYKSSLNVHMRIHT---------GERP-FTCEVCGKSFTTGSDLKVHI--ETHTAEKPFPCDICKKAFASLRSFTCHMRTH--TSLRPFTCKLCQKGFMQSRDLKIHMRIHTGERPYSCELCEKQFSYKSSLSVHIRTHTGERPFTCEVCGKTFSQRSKLKAHIRTH----------TAENPFSCDICKKVFVSLRNLTCH-MKTHTGERP--YSCKVCQKCFIQPSHLNIHMRIHT-GERPYSCDICKKTFIHANRLTCHMRTHTG--ERPFTCELCQKGFMDSRALKVH-MRTHTG---ERPYSCKVCEKNFAHNSSLKVHMRIHTGERPFTCEVCGKGFTTGSDLKAHAGTHTAEKLFPCDICLIT 749          

HSP 5 Score: 83.1889 bits (204), Expect = 1.932e-15
Identity = 46/146 (31.51%), Postives = 79/146 (54.11%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE-----HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHES 5511
            + C  C + F T  +L  H++ H    T  +  PC  C + F +   F  HM+++ +L   + + C +C+K   F+       HM+IH+ E   +CE+C+K+F  KS    H+R HTGE+P+ C++CG  FS++     H++ H +
Sbjct:  433 FTCEVCGKSFTTGSDLKVHIETH----TAEKPFPCDICKKAFASLRSFTCHMRTHTSL---RPFTCKLCQK--GFMQSRDLKIHMRIHTGERPYSCELCEKQFSYKSSLSVHIRTHTGERPFTCEVCGKTFSQRSKLKAHIRTHTA 569          

HSP 6 Score: 79.7221 bits (195), Expect = 2.345e-14
Identity = 49/159 (30.82%), Postives = 85/159 (53.46%), Query Frame = 1
Query: 5053 ESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            +++ R++  +KL ++C  C +VF +LRNL  H++ H    T      CK C + F        HM+ +   T  + + C +C K +   + +  HM+ H+ E  + C++C K F++ S    H+  HTGE+PY C++C  +FS K + N H++ H   R
Sbjct:  281 KAHTRSHTGEKL-FSCDICKKVFVSLRNLTCHMRTH----TGERPYSCKVCLKRFTQTSCLNVHMRIH---TGERPFTCKVCGKSLIKSSDLKIHMRTHTGERHLTCKLCQKGFRQSSALKAHMGTHTGERPYSCEVCEKQFSYKSSLNVHMRIHTGER 431          

HSP 7 Score: 78.9518 bits (193), Expect = 4.010e-14
Identity = 50/146 (34.25%), Postives = 69/146 (47.26%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            ++C  C +VF +LRNL  H+K H    T      CK C + F        HM+ +   T  + Y C ICKK     N    HM+ H+ E    CE+C K F        H+R HTGE+PY CK+C   F+   +   H++ H   R
Sbjct:  573 FSCDICKKVFVSLRNLTCHMKTH----TGERPYSCKVCQKCFIQPSHLNIHMRIH---TGERPYSCDICKKTFIHANRLTCHMRTHTGERPFTCELCQKGFMDSRALKVHMRTHTGERPYSCKVCEKNFAHNSSLKVHMRIHTGER 711          

HSP 8 Score: 75.0998 bits (183), Expect = 5.111e-13
Identity = 44/142 (30.99%), Postives = 68/142 (47.89%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            + C  C + F    +L  H++IH    T      C  C++ F N      HM+++   T  + Y C +C+K     +++N HM+ H+ E    C++C K F   SY   H+R HTGE+PY C IC   F        H++ H
Sbjct:   13 FTCEVCGKSFTKGSDLKMHIRIH----TGERPFSCDICNKGFINSGALTCHMRTH---TGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPFTCDVCGKGFTISSYLKIHMRIHTGERPYSCDICNKGFVSSGALTGHMRTH 147          

HSP 9 Score: 73.559 bits (179), Expect = 1.640e-12
Identity = 46/146 (31.51%), Postives = 71/146 (48.63%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            ++C  CN+ F     L  H++ H    T      CK C + F        HM+S+   T  + + C +C K   + +++  HM+IH+ E   +C+IC+K F        H+R HTGEKPY CK+C   F +    N H++ H   R
Sbjct:   41 FSCDICNKGFINSGALTCHMRTH----TGERPYSCKVCQKSFTQSSYLNIHMRSH---TGERPFTCDVCGKGFTISSYLKIHMRIHTGERPYSCDICNKGFVSSGALTGHMRTHTGEKPYSCKVCQKCFFQSSYLNIHMRIHTGER 179          

HSP 10 Score: 72.0182 bits (175), Expect = 4.830e-12
Identity = 45/146 (30.82%), Postives = 72/146 (49.32%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINE---HMKIHSE-PSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C  C + F    +LN H++IH    T      C+ C + F        H++++   T  K + C ICKK  A +     HM+ H+      C++C K F +      H+R HTGE+PY C++C  +FS K + + H++ H   R
Sbjct:  405 YSCEVCEKQFSYKSSLNVHMRIH----TGERPFTCEVCGKSFTTGSDLKVHIETH---TAEKPFPCDICKKAFASLRSFTCHMRTHTSLRPFTCKLCQKGFMQSRDLKIHMRIHTGERPYSCELCEKQFSYKSSLSVHIRTHTGER 543          

HSP 11 Score: 71.2478 bits (173), Expect = 9.868e-12
Identity = 43/139 (30.94%), Postives = 73/139 (52.52%), Query Frame = 1
Query: 5113 EVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            +V G    ++S++KIH +  T      C  C++ F +      HM+++   T  K Y C +C+K     +++N HM+IH+ E   +CEIC K F   +    H+R HTGE+ + C+IC  +F +  +   H+  H+  R
Sbjct:  100 DVCGKGFTISSYLKIHMRIHTGERPYSCDICNKGFVSSGALTGHMRTH---TGEKPYSCKVCQKCFFQSSYLNIHMRIHTGERPYSCEICKKAFIYANSLTYHMRTHTGERHFTCEICQKDFMQSRDLKAHMGTHKDER 235          

HSP 12 Score: 70.8626 bits (172), Expect = 1.221e-11
Identity = 50/171 (29.24%), Postives = 80/171 (46.78%), Query Frame = 1
Query: 5005 DIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            DI   G   +  +     + RT+  +K  Y+C  C + F     LN H++IH    T      C+ C + F        HM+++   T  + + C IC+K       +  HM  H  E   +C++C+K+F  KS    H+R HTGE P+ C++CG  FS++     H + H
Sbjct:  128 DICNKGFVSSGALT---GHMRTHTGEK-PYSCKVCQKCFFQSSYLNIHMRIH----TGERPYSCEICKKAFIYANSLTYHMRTH---TGERHFTCEICQKDFMQSRDLKAHMGTHKDERPYSCKVCEKRFTHKSSLNVHMRIHTGETPFTCEVCGKIFSQRSKLKAHTRSH 287          

HSP 13 Score: 69.707 bits (169), Expect = 2.349e-11
Identity = 43/146 (29.45%), Postives = 68/146 (46.58%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + C  C + F +LR+   H++ H    T      CK C + F        HM+ +   T  + Y C +C+K  ++   ++ H++ H+ E    CE+C K F ++S    H+R HT E P+ C IC   F    N   H+K H   R
Sbjct:  461 FPCDICKKAFASLRSFTCHMRTH----TSLRPFTCKLCQKGFMQSRDLKIHMRIH---TGERPYSCELCEKQFSYKSSLSVHIRTHTGERPFTCEVCGKTFSQRSKLKAHIRTHTAENPFSCDICKKVFVSLRNLTCHMKTHTGER 599          

HSP 14 Score: 66.6254 bits (161), Expect = 2.433e-10
Identity = 53/179 (29.61%), Postives = 79/179 (44.13%), Query Frame = 1
Query: 4996 ISRDIVKNG-ITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKK---VVAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
             S DI   G I   ++  H     RT+  ++  Y+C  C + F     LN H++ H    T      C  C + F        HM+ +   T  + Y C IC K       +  HM+ H+ E   +C++C K F + SY   H+R HTGE+PY C+IC   F    +   H++ H   R
Sbjct:   41 FSCDICNKGFINSGALTCHM----RTHTGER-PYSCKVCQKSFTQSSYLNIHMRSH----TGERPFTCDVCGKGFTISSYLKIHMRIH---TGERPYSCDICNKGFVSSGALTGHMRTHTGEKPYSCKVCQKCFFQSSYLNIHMRIHTGERPYSCEICKKAFIYANSLTYHMRTHTGER 207          

HSP 15 Score: 66.6254 bits (161), Expect = 2.649e-10
Identity = 44/146 (30.14%), Postives = 67/146 (45.89%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            Y+C  C + F    +L  H++ H    T      C+ C + F        HM ++    + + Y C +C+K     + +N HM+IH+ E    CE+C K F ++S    H R HTGEK + C IC   F    N   H++ H   R
Sbjct:  181 YSCEICKKAFIYANSLTYHMRTH----TGERHFTCEICQKDFMQSRDLKAHMGTH---KDERPYSCKVCEKRFTHKSSLNVHMRIHTGETPFTCEVCGKIFSQRSKLKAHTRSHTGEKLFSCDICKKVFVSLRNLTCHMRTHTGER 319          

HSP 16 Score: 63.929 bits (154), Expect = 1.486e-9
Identity = 41/146 (28.08%), Postives = 71/146 (48.63%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            + C  C + F   R+L  H++IH    T      C+ C + F  K   + H++++   T  + + C +C K  +    +  H++ H+ E   +C+IC K F        H++ HTGE+PY CK+C   F +  + N H++ H   R
Sbjct:  489 FTCKLCQKGFMQSRDLKIHMRIH----TGERPYSCELCEKQFSYKSSLSVHIRTH---TGERPFTCEVCGKTFSQRSKLKAHIRTHTAENPFSCDICKKVFVSLRNLTCHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRIHTGER 627          

HSP 17 Score: 56.9954 bits (136), Expect = 1.848e-7
Identity = 32/107 (29.91%), Postives = 52/107 (48.60%), Query Frame = 1
Query: 5275 KKYQCTICKKVV---AFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRD----------DFGNYLQIKQR 5553
            + + C +C K     + +  H++IH+ E   +C+IC+K F        H+R HTGE+PY CK+C   F++    N H++ H   R              +YL+I  R
Sbjct:   11 RPFTCEVCGKSFTKGSDLKMHIRIHTGERPFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHTGERPFTCDVCGKGFTISSYLKIHMR 117          

HSP 18 Score: 54.6842 bits (130), Expect = 1.052e-6
Identity = 38/125 (30.40%), Postives = 56/125 (44.80%), Query Frame = 1
Query: 5092 YNCVKCNEVFGTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAF---INEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKIC 5454
            Y+C  C + F     L  H++ H    T      C+ C + F +      HM+++   T  + Y C +C+K  A    +  HM+IH+ E    CE+C K F   S    H   HT EK + C IC
Sbjct:  629 YSCDICKKTFIHANRLTCHMRTH----TGERPFTCELCQKGFMDSRALKVHMRTH---TGERPYSCKVCEKNFAHNSSLKVHMRIHTGERPFTCEVCGKGFTTGSDLKAHAGTHTAEKLFPCDIC 746          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000048367.1 (SMESG000048367.1)

HSP 1 Score: 2731.44 bits (7079), Expect = 0.000e+0
Identity = 1356/1362 (99.56%), Postives = 1356/1362 (99.56%), Query Frame = 1
Query:    7 TKIKNDEIIASSSELKPPKGRRSKKSEAEVLPRRQSVRQAKQRNESTKVITPKKNVKSKKKIXXXXXXXXXXXXXXXXXXXXXXXYLATMFKKVPKENTDDKNVEDELFQDDENDKDVYDFDQQSSIVSSRQVKDKKWLNQQAKMKSSFKVIKSEPMQNPSWGSNIYSYLATFLNTREELDIYSRYLKCSYVNKSLDQAISDLCKPFRNLNLEGPTASLQNLMAKINDNATVVGLMKEIMSDRFENAAHRISHFVSIVSQPINGLVFYPKFNEILHQIDGKIISESGFIIEVEKSESRKNIPDVDTIVITDSFYSYVCEKLLGQSSRDLQRLVLGIDENKSLIGLFVLDSWNRAGVPYNRSRIKYNTSNAAQQINNSCEQSQPIISNGESNEIKTSQNIDFIDGFFVRMGGKKDVLHLVTKIESKFLVFNVVSEYMFAFKKHGLSSKTPIVLEGMYSTFSEVLGEEKSILIIPDQFYKSLLKTLHKEIHLPNCKFKKFVLLDKQTRAPLGVFFDTDVTLDIQIHDRILSEQQLSILPQTYVQNLKPTKQNVMLGSLNGILVGFEITPQKYITKCYEIISDSCAKINPQIDKRNSIQTLYLAPNGMSTTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKING---DCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCXXXXXXXXXXXXXXLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGRGHPDYDPQKTIARKNAQKKIDAICGPDIQIIMENVLINSKSCDTSDLDANYPLAFNDPDAKKRKIC 4083
            TKIKNDEIIASSS LKPPKGRRSKKSEAEVLPRRQSVRQAKQRNESTKVITPKKNVKSKKKIESSEEDEDDDDVDEDWSMDEDEDYLATMFKKVPKENTDDKNVEDELFQDDENDKDVYDFDQQSSIVSSRQVKDKKWLNQQAKMKSSFKVIKSEPMQNPSWGSNIYSYLATFLNTREELDIYSRYLKCSYVNKSLDQAISDLCKPFRNLNLEGPTASLQNLMAKINDNATVVGLMKEIMSDRFENAAHRISHFVSIVSQPINGLVFYPKFNEILHQIDGKIISESGFIIEVEKSESRKNIPDVDTIVITDSFYSYVCEKLLGQSSRDLQRLVLGIDENKSLIGLFVLDSWNRAGVPYNRSRIKYNTSNAAQQINNSCEQS PIISNGESNEIKTSQNIDFIDGFFVRMGGKKDVLHLVTKIESKFLVFNVVSEYMFAFKKHGLSSKTPIVLEGMYSTFSEVLGEEKSILIIPDQFYKSLLKTLHKEIHLPNCKFKKFVLLDKQTRAPLGVFFDTDVTLDIQIHDRILSEQQLSILPQTYVQNLKPTKQNVMLGSLNGILVGFEITPQKYITKCYEIISDSCAKINPQIDKRNSIQTLYLAPNGMSTTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKING   DCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCESESETELEQTQKLLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGRGHPDYDPQKTIARKNAQKKIDAICGPDIQIIMENVLINSKSCDTSDLDANYPLAFND DAKKRKIC
Sbjct:    3 TKIKNDEIIASSSALKPPKGRRSKKSEAEVLPRRQSVRQAKQRNESTKVITPKKNVKSKKKIESSEEDEDDDDVDEDWSMDEDEDYLATMFKKVPKENTDDKNVEDELFQDDENDKDVYDFDQQSSIVSSRQVKDKKWLNQQAKMKSSFKVIKSEPMQNPSWGSNIYSYLATFLNTREELDIYSRYLKCSYVNKSLDQAISDLCKPFRNLNLEGPTASLQNLMAKINDNATVVGLMKEIMSDRFENAAHRISHFVSIVSQPINGLVFYPKFNEILHQIDGKIISESGFIIEVEKSESRKNIPDVDTIVITDSFYSYVCEKLLGQSSRDLQRLVLGIDENKSLIGLFVLDSWNRAGVPYNRSRIKYNTSNAAQQINNSCEQSLPIISNGESNEIKTSQNIDFIDGFFVRMGGKKDVLHLVTKIESKFLVFNVVSEYMFAFKKHGLSSKTPIVLEGMYSTFSEVLGEEKSILIIPDQFYKSLLKTLHKEIHLPNCKFKKFVLLDKQTRAPLGVFFDTDVTLDIQIHDRILSEQQLSILPQTYVQNLKPTKQNVMLGSLNGILVGFEITPQKYITKCYEIISDSCAKINPQIDKRNSIQTLYLAPNGMSTTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIADKIFDLPLQISLFDSIWRLYHQKINGSNGDCRDDSCVFCGREFKASANVYDHEIRHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCESESETELEQTQKLLNISASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEALTSECFICGICGLNYSKLDILCSHMNNHLSCNVCKTRLGSIDEVSQHLRDHLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTDESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVKHGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCDKCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGRGHPDYDPQKTIARKNAQKKIDAICGPDIQIIMENVLINSKSCDTSDLDANYPLAFNDTDAKKRKIC 1364          

HSP 2 Score: 134.42 bits (337), Expect = 4.687e-31
Identity = 70/169 (41.42%), Postives = 100/169 (59.17%), Query Frame = 1
Query: 5194 CKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGK------PIKKVF--NTEKIVNSVQCGTSDYPDLELIWANSKCCGTND 5676
            C  C   F++K+   +H++  H   E ++Y+C IC K+V  I+ HM IH      CE C K+F K +YY EH+R H GEKPY+C IC   F+KK N N H+  HE +RDD+GNYL+IK RG+      P K +   N +K ++++ CG      +E +  NSK C T+D
Sbjct: 1177 CTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGRGHPDYDPQKTIARKNAQKKIDAI-CGPDIQIIMENVLINSKSCDTSD 1344          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000075372.1 (SMESG000075372.1)

HSP 1 Score: 125.176 bits (313), Expect = 6.114e-32
Identity = 64/175 (36.57%), Postives = 98/175 (56.00%), Query Frame = 1
Query: 3517 QCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGRGHPDYDPQKTIARKNAQKKIDAICGPDIQIIMENVLINSKSCDTSDLDANYP 4041
            QC EC   F+++  +  HI+  HL ++  R EC+ICGK+V QI++HM +H NAR++CE CGK F  ++YY  HV  H   +P++C IC   F + S L VH+  HE+++ +  N+L IKPRG        + +   K+  +++                  SK+CDT+DL  N P
Sbjct:    3 QCNECGKLFKTRSGLISHIKFTHLQVKKNRQECKICGKMVLQINLHMELHINARFKCEICGKGFRSNSYYVAHVNTHLDLRPFQCTICLSNFTRHSYLKVHMAIHERNKINGNNFLPIKPRGN-------RNSFLLKSHNRELK---------------FESKACDTNDLVTNSP 155          

HSP 2 Score: 87.8113 bits (216), Expect = 5.730e-19
Identity = 49/146 (33.56%), Postives = 74/146 (50.68%), Query Frame = 1
Query: 5194 CKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKP---IKKVFNTEKIVNSVQCGTSD 5622
            C  C ++F+ +     H+K  H   +  + +C IC K+V  IN HM++H      CEIC K F+  SYYV H+  H   +P++C IC + F++      H+  HE  + +  N+L IK RG     + K  N E    S  C T+D
Sbjct:    4 CNECGKLFKTRSGLISHIKFTHLQVKKNRQECKICGKMVLQINLHMELHINARFKCEICGKGFRSNSYYVAHVNTHLDLRPFQCTICLSNFTRHSYLKVHMAIHERNKINGNNFLPIKPRGNRNSFLLKSHNRELKFESKACDTND 149          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000058089.1 (SMESG000058089.1)

HSP 1 Score: 85.5001 bits (210), Expect = 9.680e-18
Identity = 62/198 (31.31%), Postives = 95/198 (47.98%), Query Frame = 1
Query: 3517 QCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGRG-HPDYDPQKTIARKNAQKKIDAICG---------PDIQIIMENVLINSKSCDTSDLDANYPLAFNDPDAKKRKI 4080
            +C +C+ +   +L +R+HI V+HL LEPERY+C IC KI+T I  H  +H  A   CE C +       Y EHV+ H  +  + C+IC   +++            K R+   N    K +      D   Q +I        +D++CG          D+   + NV  NSK CDT DL++ +    ++P  KKRK+
Sbjct:   73 KCVDCEFSCDHELILRQHILVEHLRLEPERYQCLICNKIITDIIEHRRLHL-APVVCELCKEPLENQLQYLEHVKFHPFDILWPCNICYNAYSRT-----------KMREHKDNMCRDKKKSVNLKADKSHQSSIIL------VDSLCGLDTAKCSVRNDMDFKLINVYFNSKLCDTDDLES-FNTDISEPSNKKRKL 251          

HSP 2 Score: 64.3142 bits (155), Expect = 1.169e-10
Identity = 43/167 (25.75%), Postives = 83/167 (49.70%), Query Frame = 1
Query: 5194 CKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFS--KKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIKKVFNTEKI--VNSVQCGTSDYPDLELI--WANSKCCGTND 5676
            C  C     ++++  +H+   H   E ++YQC IC K++  I EH ++H  P + CE+C +  + +  Y+EH+++H  +  + C IC N +S  K   + D++ R      D    + +K        +   + +  +++ +C   +  D +LI  + NSK C T+D
Sbjct:   74 CVDCEFSCDHELILRQHILVEHLRLEPERYQCLICNKIITDIIEHRRLHLAP-VVCELCKEPLENQLQYLEHVKFHPFDILWPCNICYNAYSRTKMREHKDNMCR------DKKKSVNLKADKSHQSSIILVDSLCGLDTAKCSVRNDMDFKLINVYFNSKLCDTDD 233          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000058089.1 (SMESG000058089.1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.324e-17
Identity = 62/198 (31.31%), Postives = 95/198 (47.98%), Query Frame = 1
Query: 3517 QCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGRG-HPDYDPQKTIARKNAQKKIDAICG---------PDIQIIMENVLINSKSCDTSDLDANYPLAFNDPDAKKRKI 4080
            +C +C+ +   +L +R+HI V+HL LEPERY+C IC KI+T I  H  +H  A   CE C +       Y EHV+ H  +  + C+IC   +++            K R+   N    K +      D   Q +I        +D++CG          D+   + NV  NSK CDT DL++ +    ++P  KKRK+
Sbjct:   76 KCVDCEFSCDHELILRQHILVEHLRLEPERYQCLICNKIITDIIEHRRLHL-APVVCELCKEPLENQLQYLEHVKFHPFDILWPCNICYNAYSRT-----------KMREHKDNMCRDKKKSVNLKADKSHQSSIIL------VDSLCGLDTAKCSVRNDMDFKLINVYFNSKLCDTDDLES-FNTDISEPSNKKRKL 254          

HSP 2 Score: 64.3142 bits (155), Expect = 1.240e-10
Identity = 43/167 (25.75%), Postives = 83/167 (49.70%), Query Frame = 1
Query: 5194 CKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFS--KKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIKKVFNTEKI--VNSVQCGTSDYPDLELI--WANSKCCGTND 5676
            C  C     ++++  +H+   H   E ++YQC IC K++  I EH ++H  P + CE+C +  + +  Y+EH+++H  +  + C IC N +S  K   + D++ R      D    + +K        +   + +  +++ +C   +  D +LI  + NSK C T+D
Sbjct:   77 CVDCEFSCDHELILRQHILVEHLRLEPERYQCLICNKIITDIIEHRRLHLAP-VVCELCKEPLENQLQYLEHVKFHPFDILWPCNICYNAYSRTKMREHKDNMCR------DKKKSVNLKADKSHQSSIILVDSLCGLDTAKCSVRNDMDFKLINVYFNSKLCDTDD 236          
BLAST of Zinc finger protein vs. Planmine SMEST
Match: SMESG000000679.1 (SMESG000000679.1)

HSP 1 Score: 86.6557 bits (213), Expect = 5.380e-17
Identity = 55/181 (30.39%), Postives = 84/181 (46.41%), Query Frame = 1
Query: 3301 IRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFH 3831
            IR+H        +  YP    + +E    + +L A         QC LC +        ++H   H   R F+C  C  TF     +  H R+ H   +P  + C IC +  +Q   ++ HM  H   R Y+C +C K F+ S+   +H R+H GEKPY+C IC  +F++  NLN H+  H
Sbjct:  274 IRIHPGTNSNTPLFKYPNMGNLVKEGSQRDLKLLASHLYLDEPNQCHLCGRSYARPSTLKIHMRTHSGERPFKCNVCSKTFSQVANLTAHKRI-HSGEKP--FSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKHTRVHSGEKPYKCRICLLKFSQSGNLNRHMRVH 451          

HSP 2 Score: 67.781 bits (164), Expect = 4.967e-11
Identity = 41/125 (32.80%), Postives = 60/125 (48.00%), Query Frame = 1
Query: 5143 SHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRH 5505
            S +KIH +  +      C  CS+ F        H + +   +  K + C IC +  +    +  HM+ HS E    C  C K F   S   +H R H+GEKPYKC+IC  +FS+  N N H++ H
Sbjct:  330 STLKIHMRTHSGERPFKCNVCSKTFSQVANLTAHKRIH---SGEKPFSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKHTRVHSGEKPYKCRICLLKFSQSGNLNRHMRVH 451          

HSP 3 Score: 65.4698 bits (158), Expect = 2.215e-10
Identity = 35/95 (36.84%), Postives = 52/95 (54.74%), Query Frame = 1
Query: 3571 IRVDHLNLEPERYECQICGKIVTQIS---MHMLIHKNAR-YQCEYCGKRFTKSAYYNEHVRIHKGEKPYECHICQRRFNKKSNLNVHINFHEKHR 3843
            +   HL L+ E  +C +CG+   + S   +HM  H   R ++C  C K F++ A    H RIH GEKP+ CHIC R F++ S++  H+  H   R
Sbjct:  306 LLASHLYLD-EPNQCHLCGRSYARPSTLKIHMRTHSGERPFKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHICCRTFSQSSSVTTHMRTHSGER 399          

HSP 4 Score: 64.3142 bits (155), Expect = 5.706e-10
Identity = 38/133 (28.57%), Postives = 63/133 (47.37%), Query Frame = 1
Query: 5122 GTLRNLNSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQCTICKKV---VAFINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHE 5508
            G+ R+L    K+    L ++E   C  C + +        HM+++   +  + ++C +C K    VA +  H +IHS E   +C IC + F + S    H+R H+GE+PY+C  C   FS       H + H 
Sbjct:  299 GSQRDL----KLLASHLYLDEPNQCHLCGRSYARPSTLKIHMRTH---SGERPFKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKHTRVHS 424          

HSP 5 Score: 58.9214 bits (141), Expect = 3.089e-8
Identity = 47/162 (29.01%), Postives = 65/162 (40.12%), Query Frame = 1
Query: 3112 DRRLWRIHLEKHEENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLN 3591
            D +L   HL   E NQ    C  C   +   + LK+H+ T  G +    KC++C K FS    +  H    H G     PFSC +C   F   + +  H   H G    +C  C K          H   H   + ++C  C   F     + RH+RV HLN
Sbjct:  303 DLKLLASHLYLDEPNQ----CHLCGRSYARPSTLKIHMRTHSGERP--FKCNVCSKTFSQVANLTAH-KRIHSG---EKPFSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKHTRVHSGEKPYKCRICLLKFSQSGNLNRHMRV-HLN 453          

HSP 6 Score: 56.225 bits (134), Expect = 2.118e-7
Identity = 37/144 (25.69%), Postives = 65/144 (45.14%), Query Frame = 1
Query: 3259 KCSICEKDFSNSQEIRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGG--MMQCDLCQKVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEPERYECQICGKIVTQ---ISMHMLIHKNA 3675
            +C +C + ++    +++H +  H G     PF C +C + F     L AH+ +H G     C +C +      +   H   H   R ++C  C   F     + +H RV H   +P  Y+C+IC    +Q   ++ HM +H N+
Sbjct:  318 QCHLCGRSYARPSTLKIH-MRTHSG---ERPFKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKHTRV-HSGEKP--YKCRICLLKFSQSGNLNRHMRVHLNS 454          

HSP 7 Score: 55.4546 bits (132), Expect = 3.150e-7
Identity = 28/82 (34.15%), Postives = 41/82 (50.00%), Query Frame = 1
Query: 5284 QCTICKKVVA---FINEHMKIHS-EPSIACEICDKKFKKKSYYVEHLRYHTGEKPYKCKICGNEFSKKYNYNDHLKRHESYR 5517
            QC +C +  A    +  HM+ HS E    C +C K F + +    H R H+GEKP+ C IC   FS+  +   H++ H   R
Sbjct:  318 QCHLCGRSYARPSTLKIHMRTHSGERPFKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHICCRTFSQSSSVTTHMRTHSGER 399          
The following BLAST results are available for this feature:
BLAST of Zinc finger protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF2261.751e-3525.21zinc finger protein 226 [Source:HGNC Symbol;Acc:HG... [more]
ZNF2261.751e-3525.21zinc finger protein 226 [Source:HGNC Symbol;Acc:HG... [more]
ZNF2261.751e-3525.21zinc finger protein 226 [Source:HGNC Symbol;Acc:HG... [more]
ZNF8451.996e-3225.23zinc finger protein 845 [Source:HGNC Symbol;Acc:HG... [more]
ZNF8451.996e-3225.23zinc finger protein 845 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y55F3AM.141.395e-1624.38pep chromosome:WBcel235:IV:1058845:1063187:-1 gene... [more]
Y55F3AM.141.395e-1624.38pep chromosome:WBcel235:IV:1058695:1067525:-1 gene... [more]
pag-32.666e-1637.50Zinc finger protein PAG-3 [Source:UniProtKB/TrEMB... [more]
zfp-21.674e-1430.10Zinc finger protein zfp-2 [Source:UniProtKB/Swiss... [more]
fezf-11.238e-1236.94FEZ Family zinc finger protein [Source:UniProtKB/... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG122997.224e-2729.34gene:FBgn0032295 transcript:FBtr0080113[more]
CG52454.991e-2625.11gene:FBgn0038047 transcript:FBtr0082589[more]
CG112471.447e-2328.03gene:FBgn0037120 transcript:FBtr0078458[more]
CG112471.447e-2328.03gene:FBgn0037120 transcript:FBtr0078459[more]
CG112471.447e-2328.03gene:FBgn0037120 transcript:FBtr0113184[more]
back to top
BLAST of Zinc finger protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf10261.011e-4025.12zinc finger protein 1026 [Source:ZFIN;Acc:ZDB-GENE... [more]
znf10261.119e-3624.35zinc finger protein 1026 [Source:ZFIN;Acc:ZDB-GENE... [more]
znf9855.896e-3624.07zinc finger protein 985 [Source:ZFIN;Acc:ZDB-GENE-... [more]
znf11044.124e-3525.69zinc finger protein 1104 [Source:ZFIN;Acc:ZDB-GENE... [more]
znf10186.542e-3523.74zinc finger protein 1018 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
synrg9.597e-3525.15synergin, gamma [Source:Xenbase;Acc:XB-GENE-993541... [more]
ENSXETT00000036778.11.099e-3426.06pep primary_assembly:Xenopus_tropicalis_v9.1:9:757... [more]
synrg1.224e-3425.15synergin, gamma [Source:Xenbase;Acc:XB-GENE-993541... [more]
ENSXETT00000036920.11.110e-3324.81pep primary_assembly:Xenopus_tropicalis_v9.1:9:678... [more]
ENSXETT00000036869.12.164e-3225.33pep primary_assembly:Xenopus_tropicalis_v9.1:9:730... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp263.229e-3625.40zinc finger protein 26 [Source:MGI Symbol;Acc:MGI:... [more]
BC0240632.282e-3223.93cDNA sequence BC024063 [Source:MGI Symbol;Acc:MGI:... [more]
Zfp9304.371e-3128.65zinc finger protein 930 [Source:MGI Symbol;Acc:MGI... [more]
Zfp9304.739e-3128.46zinc finger protein 930 [Source:MGI Symbol;Acc:MGI... [more]
Gm144192.799e-3025.52predicted gene 14419 [Source:MGI Symbol;Acc:MGI:37... [more]
back to top
BLAST of Zinc finger protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P10076|ZFP26_MOUSE2.055e-3525.40Zinc finger protein 26 OS=Mus musculus OX=10090 GN... [more]
sp|Q9NYT6|ZN226_HUMAN8.410e-3525.21Zinc finger protein 226 OS=Homo sapiens OX=9606 GN... [more]
sp|Q96IR2|ZN845_HUMAN9.585e-3225.23Zinc finger protein 845 OS=Homo sapiens OX=9606 GN... [more]
sp|Q08AN1|ZN616_HUMAN4.817e-3126.08Zinc finger protein 616 OS=Homo sapiens OX=9606 GN... [more]
sp|Q14588|ZN234_HUMAN1.068e-3024.85Zinc finger protein 234 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of Zinc finger protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DFW33.600e-2633.69Zinc finger protein OS=Schistosoma japonicum OX=61... [more]
G4VKL68.324e-2533.58Putative zinc finger protein OS=Schistosoma manson... [more]
A0A267GR525.053e-2335.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HRL94.885e-2334.40Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GAR86.029e-2334.40Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000056400.11.168e-3222.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000039103.14.355e-3225.20pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000033422.15.054e-3124.34pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050172.15.075e-3132.95zinc finger protein 883-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000053638.11.467e-3022.96pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdm51.156e-2429.00PR domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000002487.11.892e-2323.85pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1... [more]
GZF12.622e-2329.52GDNF inducible zinc finger protein 1 [Source:HGNC ... [more]
ENSPMAT00000006878.11.210e-2228.45pep scaffold:Pmarinus_7.0:GL476706:187714:192918:-... [more]
ENSPMAT00000001428.13.007e-2225.20pep scaffold:Pmarinus_7.0:GL481113:143068:144258:1... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP11.235e-1333.56Zinc-regulated transcription factor; binds to zinc... [more]
AZF11.067e-1238.10Zinc-finger transcription factor; involved in diau... [more]
PZF15.435e-925.34Transcription factor IIIA (TFIIIA); essential DNA ... [more]
MSN23.032e-842.11Stress-responsive transcriptional activator; activ... [more]
COM22.304e-742.59Transcription factor that binds IME1 Upstream Acti... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO318385.126e-3328.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268794.729e-3029.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413588.020e-2933.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301481.535e-2830.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488394.616e-2824.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000035130.11.848e-4124.52pep primary_assembly:ASM223467v1:17:11263917:11382... [more]
ENSORLT00000045028.12.352e-4025.93pep primary_assembly:ASM223467v1:17:11266576:11351... [more]
ENSORLT00000035417.15.446e-3929.50pep primary_assembly:ASM223467v1:17:11165735:11271... [more]
ENSORLT00000033373.16.184e-3923.90pep primary_assembly:ASM223467v1:17:11165735:11271... [more]
ENSORLT00000031019.19.256e-3825.00pep primary_assembly:ASM223467v1:17:11111179:11269... [more]
back to top
BLAST of Zinc finger protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048367.14.687e-3199.56SMESG000048367.1[more]
SMESG000075372.16.114e-3236.57SMESG000075372.1[more]
SMESG000058089.19.680e-1831.31SMESG000058089.1[more]
SMESG000058089.11.324e-1731.31SMESG000058089.1[more]
SMESG000000679.15.380e-1730.39SMESG000000679.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019808 ID=SMED30019808|Name=Zinc finger protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5739bp
TTAAATACTAAGATCAAAAACGATGAAATTATTGCTTCTAGCAGTGAATT
GAAACCTCCTAAAGGTAGACGCTCAAAAAAATCAGAAGCTGAAGTTTTAC
CACGAAGACAATCTGTTCGTCAAGCAAAACAAAGAAATGAATCAACTAAA
GTCATTACACCAAAGAAAAATGTAAAATCCAAAAAAAAAATTGAAAGCTC
CGAGGAAGACGAGGATGATGACGACGTCGATGAAGATTGGTCGATGGATG
AAGATGAAGATTATTTGGCTACAATGTTTAAAAAAGTACCAAAAGAAAAT
ACTGACGATAAAAATGTAGAAGATGAATTATTTCAAGATGATGAAAATGA
TAAAGATGTCTATGACTTCGATCAACAAAGTAGTATTGTATCCAGTCGGC
AAGTTAAAGATAAGAAGTGGTTAAATCAACAAGCTAAAATGAAGTCATCT
TTCAAAGTAATTAAATCGGAACCCATGCAAAATCCTAGTTGGGGTTCGAA
TATATATTCTTATCTTGCTACATTTCTTAATACTCGAGAAGAACTGGATA
TTTATTCACGATATCTTAAATGTAGCTATGTTAATAAATCACTCGATCAA
GCAATTTCCGACCTTTGTAAACCATTTAGAAATCTAAACTTAGAAGGTCC
AACAGCATCGCTTCAAAATCTCATGGCAAAAATTAATGACAACGCGACTG
TTGTGGGTTTAATGAAGGAAATAATGTCAGATCGTTTTGAAAATGCTGCC
CACCGAATCAGCCATTTTGTTTCGATTGTAAGTCAACCGATTAATGGGCT
AGTATTTTATCCGAAATTTAATGAGATTTTACACCAAATCGATGGAAAAA
TTATCAGTGAATCTGGATTTATTATTGAAGTTGAAAAATCGGAATCAAGA
AAAAATATTCCCGATGTTGATACGATTGTCATTACAGATTCATTTTATTC
ATATGTTTGTGAAAAACTGCTCGGTCAATCAAGTCGGGATCTTCAACGAC
TTGTTTTGGGAATCGATGAAAACAAATCTTTGATTGGTTTATTTGTATTG
GATTCCTGGAATAGAGCTGGAGTTCCATATAATCGATCAAGAATAAAATA
TAACACATCAAATGCAGCTCAGCAAATCAATAATTCTTGTGAGCAATCAC
AGCCGATTATTTCCAATGGGGAATCAAATGAAATCAAAACCAGTCAAAAT
ATTGATTTCATAGACGGATTTTTTGTACGAATGGGCGGGAAAAAGGATGT
GTTGCATTTAGTAACGAAAATCGAATCAAAATTTCTTGTGTTTAATGTTG
TCAGTGAGTATATGTTTGCATTTAAAAAGCACGGATTGTCATCTAAAACT
CCAATAGTTCTCGAAGGAATGTATTCAACATTTTCTGAAGTTCTCGGTGA
AGAAAAATCGATTTTAATCATCCCAGATCAATTTTATAAATCTCTTTTAA
AAACTCTACACAAAGAAATACATTTGCCAAATTGTAAATTCAAAAAATTC
GTTTTGTTAGACAAACAAACACGTGCACCTCTTGGAGTGTTTTTCGATAC
AGATGTGACGCTAGATATACAAATTCATGATAGGATTCTATCGGAACAGC
AATTATCGATTTTACCACAAACATATGTACAGAATTTAAAACCAACCAAG
CAAAACGTCATGCTCGGATCTCTGAATGGAATTCTTGTTGGATTTGAAAT
CACTCCACAGAAATATATCACAAAATGTTATGAAATAATTTCAGACAGTT
GTGCAAAAATCAATCCGCAAATCGATAAACGGAATTCAATACAAACTCTC
TATTTGGCTCCAAATGGAATGTCTACGACTGTGCAATTCTGTAACACGGA
AACCGGTGAAAATACGTACGTGTCAGCGTCGCTGTTTGAAAATATTCCCT
ATTGCAAACGGCAAGAACAGATCGATGATTTCCTCAACGAAATTGCCGAT
AAAATATTCGATTTGCCTCTACAAATTAGTTTATTCGACTCTATTTGGAG
ATTATACCATCAGAAAATCAACGGTGACTGTCGCGATGACAGTTGTGTGT
TCTGTGGTCGTGAGTTCAAGGCATCCGCTAATGTGTACGATCACGAGATC
AGACATGTCGGTCTGATTCGGTTCAAGTGTCACAAGCATCAAATGGTGTT
CACTGACATGAAAAGCTACAAATCTCACCACGAGGAATTTATAGATTGCG
AAAGTGAATCTGAAACCGAGTTGGAACAAACTCAGAAACTCCTCAATATC
TCGGCATCTCTATCCGATTGTCCACAGTGTGATAAATGCTACGATTATTT
CCCCCAAGCCGACATTCTTCGTCTTCATCTCGATATTTGCGATGGAGTTT
CGTTTAATGCTCGTACCCCACTCGACTCGAAATACGATCCGGGAGAGGCT
TTGACCTCGGAATGTTTCATTTGTGGAATTTGTGGATTGAACTACTCGAA
ATTGGATATTCTCTGTTCCCATATGAACAATCATTTGTCGTGCAATGTGT
GCAAAACCCGACTAGGATCAATTGATGAGGTCAGTCAGCATTTGAGAGAT
CATTTACACAAAAATGAAAATGTCAGCGGCCCGGGCAAACGAAAAATCCT
CATCTGTGACATCTGTAACGATTTTTACGGCACTAAAGTCAACTATTACT
ACCACCAATGGAATGAGCACGGTGTAGTGCATCCACCAATCAAAACCGAC
GAATCTGCTGAACCGCTATATAAACGCCGCACAAAGCGAATGAATGAATT
ATCGTACATGGCGACTGGAATGAAGAAGTTCAGCTGTAAATTTTGCAACG
CCGAAGTAAAAGTAGCCGGCCGAGATTATGTTAAGCATTTGGATGTAAAG
CATGGGTTGACTGTGGAATTGGACACGTTGTGTAGGATTTGCGCTGACAT
TTTTGAGACTCCAGAACGTCTAAGTGACCATTTACGCGAGAATCACATTC
AATCCGGGGAATACATTAACGCAGGGATCCAAAGCATTTTCAGTTGCGAT
AAGTGCACGTTTTTCGGGCATTTTCGCGGGGTTGTAGCCCATTCCACATC
TGTTCATGCCGATTCCAATCCGTGTTTATACGAATGTCCCCATTGTCCGG
AACGAATGGCTGACAGGAGGTTGTGGAGAATTCACCTGGAAAAACACGAA
GAAAATCAATTGACATTTACGTGTGACGAATGCCAGACGTATTTTAAGAA
CGAAGCCGCATTGAAATTGCATTTGGAAACGTTTCATGGTGTCAAGCAGA
ATGATTTGAAATGCAGTATTTGCGAGAAGGATTTCTCGAATTCCCAGGAA
ATAAGGGTGCACATATTAGAGGAACACGAGGGCTGTGTGGAACTGTATCC
ATTCAGTTGTTTCATGTGTCAGGAGAAATTTTTATTTGAGAACGAATTGC
AAGCCCATCAAGAAGTTCACGGTGGAATGATGCAATGTGATCTCTGTCAA
AAAGTGTGCAAATCGATGAAAGCATACGAGTTGCATCGAATGAAGCATTT
TAGGACAAGGATATTTCAATGCACAGAATGCCAAGCCACATTTCGCAGTA
AATTAGCCATGCGGCGGCATATTAGGGTTGACCATTTGAATTTGGAACCG
GAGCGGTACGAATGCCAAATTTGTGGGAAAATCGTTACACAGATCTCCAT
GCACATGCTCATTCATAAGAATGCCAGATATCAGTGCGAATATTGCGGTA
AACGGTTCACAAAGAGCGCCTATTACAACGAGCACGTCCGAATCCACAAA
GGAGAAAAACCGTATGAATGTCACATTTGTCAGAGGAGATTCAATAAAAA
ATCGAATTTGAATGTGCACATAAATTTTCATGAGAAACACAGGGATGATT
ATGGAAATTATTTGGAAATCAAACCGAGGGGTAGGGGGCATCCTGATTAT
GATCCTCAGAAAACGATTGCGAGAAAAAATGCCCAGAAGAAAATTGATGC
AATTTGTGGACCGGATATTCAAATCATTATGGAAAATGTACTCATCAATT
CCAAGAGTTGCGATACTAGTGACCTAGATGCAAATTATCCGCTTGCATTT
AATGATCCAGACGCTAAGAAACGTAAAATATGTTGAGATATGCAATATTC
AGCAATGTCGTAACCTGATTGGGTAATCAGTGCATTTTAATTTTTGTAAA
GATGTGTGTTTGAATACATTTTGATTTTTTAATAAGGATTAAATCCAAGT
GGTTTAGTCAAAGTTAAGCACGACTTTTTCTATTTTGTCAAGAAAGTCAC
ACTTTTAAACACTGAATTTTGCAGTTGGCAAGAATAAGTAATCTATTGTG
GTTAATATGAGTTGTTTTTTTCACTATATAATCGAATGAAATTAAATAAA
ACTTAATAGTAAAATTAATAACTTGTTAAAATGGATATAATGGAAGTAAT
ATCAAGTAAAAAAAATTTTTTTTTGCCAATTTTCAGTTTTGATTAATAAA
AATATATTACGAATCAGTAGAATAAATTAAACTAATTTTTTTAAAGTTTT
TTTAATTTTATTAAATTATAAAATAATCACTTGGAACAAATAATTGAATT
AAGGTCTGTAAGAAGATACAACTTAAATAGCATTGAAACCAATAAATCGT
CAAAATCGTAAATTTAAGATAGTTATTTAATTCTAAATGAAAAAATTGTT
TATTATTAATTTTTTAAACTATTTTAATATTTAGATTTCGATTAAACTTG
TAAGATTCTATAAACTCTAAGCAAATATAAACTAAAATTTAAAAAAATAT
ATTACTTAATTAATAATCAGTAGAATAATATATTATAGTTTGTTTAAAAA
TTAATTAATTTTCTTAAATTATAAAGTAATCACTTTCATATGGAATATGA
AACTAAACTGAGAAGGTCAGCAAGAAAATCCGATTTAAATAGTAATGAAA
CTACATCGTTAAAAAGGAAAATTGATGAAGAATTTTCTGATCTTGATCAA
GAGTGGTCTATTGAGGAGAGCGATATGGAACATAGCATGTGGAACATAAG
TAGGGATATTGTCAAAAATGGAATTACAGAAAATTCAATTATTCTCCACA
AGGAATCTAACAATCGAACTAACAAAAAGCAGAAATTGGAATACAATTGT
GTCAAATGCAATGAAGTATTTGGTACCCTTCGCAATCTCAATTCCCACGT
TAAGATTCATAACAAAGATCTAACTGTAAATGAAAAGATTCCATGTAAAC
ATTGCAGTCAAATATTTCAAAATAAGATATTGTTTGCTAAGCATATGAAA
TCATATCACAACTTGACTGAAACCAAAAAATACCAATGCACAATTTGTAA
GAAAGTTGTCGCCTTTATTAATGAGCACATGAAGATTCATTCCGAACCAT
CTATTGCTTGTGAGATTTGTGACAAGAAATTCAAAAAGAAAAGTTATTAC
GTTGAGCATCTAAGATATCACACCGGGGAAAAGCCATACAAATGTAAAAT
TTGTGGAAATGAATTTTCTAAAAAATATAATTATAATGACCATTTGAAAA
GGCACGAAAGTTATCGTGATGATTTCGGAAACTATTTGCAAATAAAACAG
AGAGGAAAACCTATAAAGAAAGTATTTAATACAGAAAAAATAGTTAATAG
CGTGCAATGCGGAACTTCAGATTATCCGGACTTAGAATTAATTTGGGCCA
ATTCAAAGTGTTGCGGTACGAATGATCAATCAGATCATTGATTTCTAATA
GACTTATTGCTTTTACTTTGTATATTTTTTGTCCGCAGA
back to top

protein sequence of SMED30019808-orf-1

>SMED30019808-orf-1 ID=SMED30019808-orf-1|Name=SMED30019808-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1362bp
LNTKIKNDEIIASSSELKPPKGRRSKKSEAEVLPRRQSVRQAKQRNESTK
VITPKKNVKSKKKIESSEEDEDDDDVDEDWSMDEDEDYLATMFKKVPKEN
TDDKNVEDELFQDDENDKDVYDFDQQSSIVSSRQVKDKKWLNQQAKMKSS
FKVIKSEPMQNPSWGSNIYSYLATFLNTREELDIYSRYLKCSYVNKSLDQ
AISDLCKPFRNLNLEGPTASLQNLMAKINDNATVVGLMKEIMSDRFENAA
HRISHFVSIVSQPINGLVFYPKFNEILHQIDGKIISESGFIIEVEKSESR
KNIPDVDTIVITDSFYSYVCEKLLGQSSRDLQRLVLGIDENKSLIGLFVL
DSWNRAGVPYNRSRIKYNTSNAAQQINNSCEQSQPIISNGESNEIKTSQN
IDFIDGFFVRMGGKKDVLHLVTKIESKFLVFNVVSEYMFAFKKHGLSSKT
PIVLEGMYSTFSEVLGEEKSILIIPDQFYKSLLKTLHKEIHLPNCKFKKF
VLLDKQTRAPLGVFFDTDVTLDIQIHDRILSEQQLSILPQTYVQNLKPTK
QNVMLGSLNGILVGFEITPQKYITKCYEIISDSCAKINPQIDKRNSIQTL
YLAPNGMSTTVQFCNTETGENTYVSASLFENIPYCKRQEQIDDFLNEIAD
KIFDLPLQISLFDSIWRLYHQKINGDCRDDSCVFCGREFKASANVYDHEI
RHVGLIRFKCHKHQMVFTDMKSYKSHHEEFIDCESESETELEQTQKLLNI
SASLSDCPQCDKCYDYFPQADILRLHLDICDGVSFNARTPLDSKYDPGEA
LTSECFICGICGLNYSKLDILCSHMNNHLSCNVCKTRLGSIDEVSQHLRD
HLHKNENVSGPGKRKILICDICNDFYGTKVNYYYHQWNEHGVVHPPIKTD
ESAEPLYKRRTKRMNELSYMATGMKKFSCKFCNAEVKVAGRDYVKHLDVK
HGLTVELDTLCRICADIFETPERLSDHLRENHIQSGEYINAGIQSIFSCD
KCTFFGHFRGVVAHSTSVHADSNPCLYECPHCPERMADRRLWRIHLEKHE
ENQLTFTCDECQTYFKNEAALKLHLETFHGVKQNDLKCSICEKDFSNSQE
IRVHILEEHEGCVELYPFSCFMCQEKFLFENELQAHQEVHGGMMQCDLCQ
KVCKSMKAYELHRMKHFRTRIFQCTECQATFRSKLAMRRHIRVDHLNLEP
ERYECQICGKIVTQISMHMLIHKNARYQCEYCGKRFTKSAYYNEHVRIHK
GEKPYECHICQRRFNKKSNLNVHINFHEKHRDDYGNYLEIKPRGRGHPDY
DPQKTIARKNAQKKIDAICGPDIQIIMENVLINSKSCDTSDLDANYPLAF
NDPDAKKRKIC*
back to top

protein sequence of SMED30019808-orf-2

>SMED30019808-orf-2 ID=SMED30019808-orf-2|Name=SMED30019808-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=284bp
MEYETKLRRSARKSDLNSNETTSLKRKIDEEFSDLDQEWSIEESDMEHSM
WNISRDIVKNGITENSIILHKESNNRTNKKQKLEYNCVKCNEVFGTLRNL
NSHVKIHNKDLTVNEKIPCKHCSQIFQNKILFAKHMKSYHNLTETKKYQC
TICKKVVAFINEHMKIHSEPSIACEICDKKFKKKSYYVEHLRYHTGEKPY
KCKICGNEFSKKYNYNDHLKRHESYRDDFGNYLQIKQRGKPIKKVFNTEK
IVNSVQCGTSDYPDLELIWANSKCCGTNDQSDH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01