Sulfotransferase

Overview
NameSulfotransferase
Smed IDSMED30019797
Length (bp)1068
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sulfotransferase (SMED30019797) t-SNE clustered cells

Violin plots show distribution of expression levels for Sulfotransferase (SMED30019797) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sulfotransferase (SMED30019797) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sulfotransferase (SMED30019797) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019797

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019797SMESG000026463.1 SmedASXL_002140SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019797SMESG000026463.1 dd_Smed_v4_38079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019797SMESG000026463.1 dd_Smed_v4_38079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019797SMESG000026463.1 dd_Smed_v4_38079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019797SMESG000026463.1 dd_Smed_v4_38079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019797SMESG000026463.1 dd_Smed_v6_38079_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sulfotransferase vs. Ensembl Human
Match: SULT1A2 (sulfotransferase family 1A member 2 [Source:HGNC Symbol;Acc:HGNC:11454])

HSP 1 Score: 173.326 bits (438), Expect = 5.540e-51
Identity = 98/266 (36.84%), Postives = 149/266 (56.02%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWW-LERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV---FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DD+L++T+PKSGTT + +I+ ++    DL K  +  IF+R+PF++     + PG       ++ +   P PR+LKTHLP++ L   L  +  +K + V RN KD AVS YHFY  A  Y P+   W++F  +++ G +S G W +  ++WW L R  P L  +FYED+ +N    I++I  F    L  + ++ ++ HT F+ M+ NPMTNY  V   F       FMRKG  GDWK  F+ AQN+  +  Y   +    L F+ E
Sbjct:   39 DDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLE----FKVPGIPS---GMETLKNTPAPRLLKTHLPLALLPQTL-LDQKVKVVYVARNAKDVAVSYYHFYHMAKVY-PHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVL-YLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAKKMAGCSLSFRSE 294          
BLAST of Sulfotransferase vs. Ensembl Human
Match: SULT1A2 (sulfotransferase family 1A member 2 [Source:HGNC Symbol;Acc:HGNC:11454])

HSP 1 Score: 173.326 bits (438), Expect = 5.540e-51
Identity = 98/266 (36.84%), Postives = 149/266 (56.02%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWW-LERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV---FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DD+L++T+PKSGTT + +I+ ++    DL K  +  IF+R+PF++     + PG       ++ +   P PR+LKTHLP++ L   L  +  +K + V RN KD AVS YHFY  A  Y P+   W++F  +++ G +S G W +  ++WW L R  P L  +FYED+ +N    I++I  F    L  + ++ ++ HT F+ M+ NPMTNY  V   F       FMRKG  GDWK  F+ AQN+  +  Y   +    L F+ E
Sbjct:   39 DDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLE----FKVPGIPS---GMETLKNTPAPRLLKTHLPLALLPQTL-LDQKVKVVYVARNAKDVAVSYYHFYHMAKVY-PHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVL-YLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAKKMAGCSLSFRSE 294          
BLAST of Sulfotransferase vs. Ensembl Human
Match: SULT1A1 (sulfotransferase family 1A member 1 [Source:HGNC Symbol;Acc:HGNC:11453])

HSP 1 Score: 170.629 bits (431), Expect = 5.479e-50
Identity = 98/266 (36.84%), Postives = 148/266 (55.64%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWW-LERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV---FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DD+L++T+PKSGTT + +I+ ++    DL K  +  IF+R+PF++     + PG       ++ +   P PR+LKTHLP++ L   L  +  +K + V RN KD AVS YHFY  A  + P    WD+F  +++ G +S G W +  ++WW L R  P L  +FYED+ +N    I++I  F    L  + ++ ++ HT F+ M+ NPMTNY  V   F       FMRKG  GDWK  F+ AQN+  +  Y   +    L F+ E
Sbjct:   39 DDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLE----FKAPGIPS---GMETLKDTPAPRLLKTHLPLALLPQTL-LDQKVKVVYVARNAKDVAVSYYHFYHMAKVH-PEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVL-YLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSE 294          
BLAST of Sulfotransferase vs. Ensembl Human
Match: SULT1A1 (sulfotransferase family 1A member 1 [Source:HGNC Symbol;Acc:HGNC:11453])

HSP 1 Score: 170.629 bits (431), Expect = 5.479e-50
Identity = 98/266 (36.84%), Postives = 148/266 (55.64%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWW-LERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV---FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DD+L++T+PKSGTT + +I+ ++    DL K  +  IF+R+PF++     + PG       ++ +   P PR+LKTHLP++ L   L  +  +K + V RN KD AVS YHFY  A  + P    WD+F  +++ G +S G W +  ++WW L R  P L  +FYED+ +N    I++I  F    L  + ++ ++ HT F+ M+ NPMTNY  V   F       FMRKG  GDWK  F+ AQN+  +  Y   +    L F+ E
Sbjct:   39 DDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLE----FKAPGIPS---GMETLKDTPAPRLLKTHLPLALLPQTL-LDQKVKVVYVARNAKDVAVSYYHFYHMAKVH-PEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVL-YLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSE 294          
BLAST of Sulfotransferase vs. Ensembl Human
Match: SULT1A1 (sulfotransferase family 1A member 1 [Source:HGNC Symbol;Acc:HGNC:11453])

HSP 1 Score: 170.629 bits (431), Expect = 5.479e-50
Identity = 98/266 (36.84%), Postives = 148/266 (55.64%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWW-LERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV---FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DD+L++T+PKSGTT + +I+ ++    DL K  +  IF+R+PF++     + PG       ++ +   P PR+LKTHLP++ L   L  +  +K + V RN KD AVS YHFY  A  + P    WD+F  +++ G +S G W +  ++WW L R  P L  +FYED+ +N    I++I  F    L  + ++ ++ HT F+ M+ NPMTNY  V   F       FMRKG  GDWK  F+ AQN+  +  Y   +    L F+ E
Sbjct:   39 DDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLE----FKAPGIPS---GMETLKDTPAPRLLKTHLPLALLPQTL-LDQKVKVVYVARNAKDVAVSYYHFYHMAKVH-PEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVL-YLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSE 294          
BLAST of Sulfotransferase vs. Ensembl Celegans
Match: ssu-1 (Suppressor of Stomatin mutant Uncoordination [Source:UniProtKB/TrEMBL;Acc:Q9U2Z2])

HSP 1 Score: 83.5741 bits (205), Expect = 1.537e-17
Identity = 66/260 (25.38%), Postives = 115/260 (44.23%), Query Frame = 2
Query:  194 RIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFC----FMRKGKIGDWKNWFSDAQNKALEN 961
            R  + M+F   D+++AT+PK GTT L+ I   ++   D    K  ++ ++ P I+              +     D    PR+LKTH    N+    D     K I  +RNPKD   S +H       Y      WD F + +  G ++ GD+ E    W       N+  + YED+ ++  +++ +I  F   + + +  N  I+    ++   + M   +  + F ES      F+RKG   DWKN+F+  Q+  +++
Sbjct:   77 RTAKSMQFGETDVVIATYPKCGTTWLQHITSQLIKGHDYKAGKGNELCVQSPMIER-------------MGAAFADNIKGPRVLKTHFHHYNIPKYPD----TKYIYCVRNPKDCLTSYFHHNRNFKIYNWANGTWDVFLDLFASGQLAFGDYFEHLLSWLPCLKDDNVLFLKYEDMFQDLENAVYKIGQFLGGEAAHRVENPEILREIVDNSTIDAMKKDQKRW-FPESQLHKVEFIRKGGSRDWKNYFTREQSDRIDS 318          
BLAST of Sulfotransferase vs. Ensembl Fly
Match: St1 (gene:FBgn0034887 transcript:FBtr0114541)

HSP 1 Score: 125.176 bits (313), Expect = 1.092e-32
Identity = 80/242 (33.06%), Postives = 123/242 (50.83%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVF-------GFE-ESFCFMRKGKIGDWKN 925
            DD+ + T PK GTT ++E+ WLV+N+ D   AK + +  R PF++ N     P      +A    +  P PR++K+HLP   L  R   +   K I V RNPKD A+S +H + G V Y   +    +F + +IDG+++         D+W  R+ PN+    YE +       I E+  F +  +S +Q+ ++  H  FESMR NP  N+   F       G E E F F+R+G +G  K+
Sbjct:   68 DDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGV--VPNVPHDTIA--AANALPSPRLIKSHLPAWML-PRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQGTKS---DFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKD 301          
BLAST of Sulfotransferase vs. Ensembl Fly
Match: St2 (gene:FBgn0037665 transcript:FBtr0081974)

HSP 1 Score: 111.309 bits (277), Expect = 9.736e-28
Identity = 81/300 (27.00%), Postives = 139/300 (46.33%), Query Frame = 2
Query:  128 LPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENY-----THEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVD--LSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQY 1006
            LP +F+    Y  L  S          +  + DD+ + ++P++G+T  +E+VWL+ +  D V A+Q  + LR P I+ +       HE       N  +D++   PRPR  ++HLP   L  + +     + +   RNPKD  VS YH++   + +G     ++ F + +++G    G +      +W      N+  + YED++K+    ++    F  V   L    + K+  H  F+ MRAN   N E +   E S  F+R GKIGDW+N   +  ++  +      +   GL F Y
Sbjct:   30 LPDQFIIPRKYVELGESI-------RSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQ-DLRLRSPLIELSALFSIDHHETVAQKFGN-TVDLVRNLPRPRFARSHLPWPLLPEQFETVKP-RIVYTARNPKDLCVSYYHYF--KLLHG-MNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLP-ESSSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGLNFDY 315          
BLAST of Sulfotransferase vs. Ensembl Fly
Match: St2 (gene:FBgn0037665 transcript:FBtr0346096)

HSP 1 Score: 111.309 bits (277), Expect = 9.736e-28
Identity = 81/300 (27.00%), Postives = 139/300 (46.33%), Query Frame = 2
Query:  128 LPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENY-----THEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVD--LSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQY 1006
            LP +F+    Y  L  S          +  + DD+ + ++P++G+T  +E+VWL+ +  D V A+Q  + LR P I+ +       HE       N  +D++   PRPR  ++HLP   L  + +     + +   RNPKD  VS YH++   + +G     ++ F + +++G    G +      +W      N+  + YED++K+    ++    F  V   L    + K+  H  F+ MRAN   N E +   E S  F+R GKIGDW+N   +  ++  +      +   GL F Y
Sbjct:   30 LPDQFIIPRKYVELGESI-------RSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQ-DLRLRSPLIELSALFSIDHHETVAQKFGN-TVDLVRNLPRPRFARSHLPWPLLPEQFETVKP-RIVYTARNPKDLCVSYYHYF--KLLHG-MNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLP-ESSSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGLNFDY 315          
BLAST of Sulfotransferase vs. Ensembl Fly
Match: St3 (gene:FBgn0265052 transcript:FBtr0336679)

HSP 1 Score: 100.138 bits (248), Expect = 1.078e-23
Identity = 72/275 (26.18%), Postives = 132/275 (48.00%), Query Frame = 2
Query:  194 RIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYG-PYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNY-------ENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGL 994
            R+  +MK   DD+ + T PK GTT ++E++WL+LN+ D   A      LR PF++  Y+     F   N +   I+    PR++K+HL ++ L  +L      K I V RNP D+ VS Y+     V +G  Y +    +F+  +       +++E   +++  R  P +    +E + K+    I ++  F    ++ QQ+ K++ H  F  M+ NP TN+       ++    +E   F+R+G +  +K+     Q +    +   +L + G+
Sbjct:   36 RLVHDMKLRDDDVWIVTLPKCGTTWMQELLWLLLNNCDFEGALAKDQELRTPFLEFGYS----VFHDPNRSFGPIEDLKSPRLIKSHLSLALLPSKL-WEGKNKVIYVSRNPLDSYVSRYYH---GVSFGFNYGKSLHQYFDEVLASDDFPTEFIEHAHEFYQLRNEPWVFYTSFEMMKKDLRGVINDVSRFLNKPINDQQMEKLLKHLSFAEMKKNPTTNHLWELAQVQHENAGKEMHPFVRRGDVNGYKDELKPEQIEKANVRIQEVLAKNGV 302          
BLAST of Sulfotransferase vs. Ensembl Fly
Match: St3 (gene:FBgn0265052 transcript:FBtr0336678)

HSP 1 Score: 99.7525 bits (247), Expect = 2.088e-23
Identity = 72/275 (26.18%), Postives = 132/275 (48.00%), Query Frame = 2
Query:  194 RIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYG-PYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNY-------ENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGL 994
            R+  +MK   DD+ + T PK GTT ++E++WL+LN+ D   A      LR PF++  Y+     F   N +   I+    PR++K+HL ++ L  +L      K I V RNP D+ VS Y+     V +G  Y +    +F+  +       +++E   +++  R  P +    +E + K+    I ++  F    ++ QQ+ K++ H  F  M+ NP TN+       ++    +E   F+R+G +  +K+     Q +    +   +L + G+
Sbjct:   36 RLVHDMKLRDDDVWIVTLPKCGTTWMQELLWLLLNNCDFEGALAKDQELRTPFLEFGYS----VFHDPNRSFGPIEDLKSPRLIKSHLSLALLPSKL-WEGKNKVIYVSRNPLDSYVSRYYH---GVSFGFNYGKSLHQYFDEVLASDDFPTEFIEHAHEFYQLRNEPWVFYTSFEMMKKDLRGVINDVSRFLNKPINDQQMEKLLKHLSFAEMKKNPTTNHLWELAQVQHENAGKEMHPFVRRGDVNGYKDELKPEQIEKANVRIQEVLAKNGV 302          
BLAST of Sulfotransferase vs. Ensembl Zebrafish
Match: sult1st5 (sulfotransferase family 1, cytosolic sulfotransferase 5 [Source:ZFIN;Acc:ZDB-GENE-050809-2])

HSP 1 Score: 177.948 bits (450), Expect = 5.478e-53
Identity = 99/275 (36.00%), Postives = 148/275 (53.82%), Query Frame = 2
Query:  203 EEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHF---YCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNY----ENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQY 1006
            E+ +   +D+L+AT+PKSGTT ++E+V L+LND D+ K K+    +R+PF+      E    DG N  I  ++    PR++KTHLP+  L    + N+G K I V RNPKD+ VS YHF        + GP    W  +  R++ G +  G W +  K +W ER++  +  MF+ED+ ++    +     F    LS   I+ I+  T F  MR NPM NY    + +F    S  FMRKG++GDWKN FS  +N A +  Y   +E   L  ++
Sbjct:   29 EQFQASEEDLLIATYPKSGTTWIQEVVDLILNDGDVDKCKRAPTQVRMPFL------EMTAADGSNAGITKLETMDPPRVIKTHLPIQLLPRSFE-NAGCKVIYVARNPKDSVVSFYHFDRMNLRQPEPGP----WKQYLERFMKGQLVWGSWFDHVKGYWRERHKRKIHYMFFEDMKEDPAREVTRTAQFLGRQLSESTIDHIVQMTTFSVMRENPMANYSTLPDTIFDRTAS-QFMRKGEVGDWKNHFSAEENAAFDEHYQKKMEDCPLPIRF 291          
BLAST of Sulfotransferase vs. Ensembl Zebrafish
Match: sult1st5 (sulfotransferase family 1, cytosolic sulfotransferase 5 [Source:ZFIN;Acc:ZDB-GENE-050809-2])

HSP 1 Score: 177.563 bits (449), Expect = 6.096e-53
Identity = 99/275 (36.00%), Postives = 148/275 (53.82%), Query Frame = 2
Query:  203 EEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHF---YCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNY----ENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQY 1006
            E+ +   +D+L+AT+PKSGTT ++E+V L+LND D+ K K+    +R+PF+      E    DG N  I  ++    PR++KTHLP+  L    + N+G K I V RNPKD+ VS YHF        + GP    W  +  R++ G +  G W +  K +W ER++  +  MF+ED+ ++    +     F    LS   I+ I+  T F  MR NPM NY    + +F    S  FMRKG++GDWKN FS  +N A +  Y   +E   L  ++
Sbjct:   29 EQFQASEEDLLIATYPKSGTTWIQEVVDLILNDGDVDKCKRAPTQVRMPFL------EMTAADGSNAGITKLETMDPPRVIKTHLPIQLLPRSFE-NAGCKVIYVARNPKDSVVSFYHFDRMNLRQPEPGP----WKQYLERFMKGQLVWGSWFDHVKGYWRERHKRKIHYMFFEDMKEDPAREVTRTAQFLGRQLSESTIDHIVQMTTFSVMRENPMANYSTLPDTIFDRTAS-QFMRKGEVGDWKNHFSAEENAAFDEHYQKKMEDCPLPIRF 291          
BLAST of Sulfotransferase vs. Ensembl Zebrafish
Match: sult1st7 (sulfotransferase family 1, cytosolic sulfotransferase 7 [Source:ZFIN;Acc:ZDB-GENE-081112-3])

HSP 1 Score: 148.288 bits (373), Expect = 1.347e-41
Identity = 94/275 (34.18%), Postives = 148/275 (53.82%), Query Frame = 2
Query:  203 EEMKFFS---DDILVATFPKSGTTLLEEIV-WLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGF-DGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREG-WDNFFNRWIDGWISGGDWLEVTKDWWLERYR-PNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFC-FMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQ 1003
            E++K F    DDIL+AT+PK+GTT +  I+  L     D      L I++R+PF++      FPG   G  LA ++ +    PR++KTHLPV  L  +       + + V RN KD  VS +H     +++G    G W+ F   ++ G +  G W +    WW ++   PNL  M YED+ K+    ++ +C+F ++  S ++ NKII   +F++M+ N MTNY  +   +     FMRKGK+GDWKN F+ AQN+  +  Y   ++   L F+
Sbjct:   34 EKLKNFQARPDDILIATYPKAGTTWVSYILDLLYFGKVDPNGQSSLPIYMRVPFLESC----FPGMPSGTELADNLPNS---PRLIKTHLPVQ-LVPKSFWEQNSRVVYVARNAKDNVVSYFH--SDRMNHGQPEPGDWNTFLEDFLKGEVVFGSWFDHVCGWWEKKKTYPNLHYMLYEDMAKDINGEVESLCTFLKLSRSDEEKNKIINSVQFDAMKQNKMTNYSTIPTMDFKISPFMRKGKVGDWKNHFTLAQNEQFDEVYKQKMKNTTLNFR 298          
BLAST of Sulfotransferase vs. Ensembl Zebrafish
Match: sult1st6 (sulfotransferase family 1, cytosolic sulfotransferase 6 [Source:ZFIN;Acc:ZDB-GENE-040718-343])

HSP 1 Score: 146.362 bits (368), Expect = 7.902e-41
Identity = 87/265 (32.83%), Postives = 141/265 (53.21%), Query Frame = 2
Query:  227 DILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHF---YCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFG--FEESF-CFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQ 1003
            D+L++T+PK+GTT  +EIV L+LN+ D    K+    +RIPF++       P        ++++ +   PR++KTHLP+  +      N   K I + RN KD  VS +HF        + GP    WD + ++++ G +  G W +  K +W E    N+  + YED+ +N    IK I  +  + +S   INKI+  T F  M+ NPM NY  +    F++S   FMRKG++GDW N F+ AQ+K  +  Y   ++ + + F+
Sbjct:   52 DLLISTYPKAGTTWTQEIVDLLLNNGDAQVCKRAPTAVRIPFLEICAPPPIPS------GLELLKQMKPPRVIKTHLPIQLVPVGFWQNK-CKVIYMARNAKDNLVSYFHFDRMNLTQPEPGP----WDGYIHKFMKGQLGWGSWYDHVKGYWKESKERNILYILYEDMKENPSREIKRIMHYLDLSVSEDVINKIVQLTSFHVMKDNPMANYSYIPKAVFDQSISAFMRKGEVGDWVNHFTPAQSKMFDEDYTNQMKDVDIPFR 305          
BLAST of Sulfotransferase vs. Ensembl Zebrafish
Match: sult1st2 (sulfotransferase family 1, cytosolic sulfotransferase 2 [Source:NCBI gene;Acc:791732])

HSP 1 Score: 142.124 bits (357), Expect = 2.843e-39
Identity = 89/268 (33.21%), Postives = 143/268 (53.36%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIV-WLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWP-RPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREG-WDNFFNRWIDGWISGGDWLEVTKDWWLERYR-PNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYEN--VFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DDIL+AT+PK+GTT +  I+  L   +    +     I++R+PF++         F G  L  ++ D  P  PR++KTHLPV  L  +       K + V RN KD AVS +HF    ++ G    G W+ F  +++DG    G W +    +W ++    N+  MFYED++++    +  +CSF  +  S  +  +I    +F++M+ N MTNY    V  F+ S  FMRKGK+GDW+N F+ AQN+  +  Y   ++   ++F+ E
Sbjct:   44 DDILIATYPKAGTTWVSYILDLLYFGNESPERQTSQPIYMRVPFLEM-------CFQGLPLGTELADTLPTSPRLIKTHLPV-QLVPKSFWEQNSKVVYVARNAKDNAVSYFHF--DRMNMGQPEPGDWNTFLQKFMDGRNVFGPWYDHVNGYWKKKQTYSNILYMFYEDMVEDTGREVARLCSFLGLSTSAAERERITKGVQFDAMKQNKMTNYSTLPVMDFKIS-PFMRKGKVGDWRNHFTVAQNEQFDEVYKQKMKNTTVKFRTE 300          
BLAST of Sulfotransferase vs. Ensembl Xenopus
Match: ENSXETT00000011235.1 (uncharacterized LOC100145082 [Source:NCBI gene;Acc:100145082])

HSP 1 Score: 173.326 bits (438), Expect = 6.718e-51
Identity = 106/306 (34.64%), Postives = 161/306 (52.61%), Query Frame = 2
Query:  104 EMTSKYSPLPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYG-PYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYE---NVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            EM  +   +P    +     +L S+CD    I    +   DDIL+ATFPKSGTT ++EIV L+L + D  K ++   F+++PFID       P        +++      PR+LKTHLP+ NL         +K + V RN KD  VS Y+F    ++ G P    W+N+F+ ++ G +  G W +    WW    +  +  +FYED+I++    I+++  F   DLS + +  I  HT F++M+ NPMTN+    NV   +    FMRKG +GDWKN F+ AQN   + +Y   +E  GL F+ E
Sbjct:   17 EMAQEAQRIPVAMGHIEGVPLLGSTCDAWDSIYN-FQARGDDILIATFPKSGTTWMQEIVDLILQEGDAQKGRRAPCFIKVPFIDLIPPKPMPS------GVELAQTMKSPRVLKTHLPI-NLLPPSFWEKNVKAVYVARNAKDCMVSYYYFQ--KINKGLPPPGTWENYFSAFLSGDVPWGSWFDHVIGWWKAMDKHQILFIFYEDMIEDPMREIRKVMKFLGKDLSDEVLENIKHHTSFQTMKENPMTNFSVFPNVIFDQTISPFMRKGTVGDWKNHFTVAQNIIFDEEYKKKMEGSGLNFRTE 312          
BLAST of Sulfotransferase vs. Ensembl Xenopus
Match: ENSXETT00000006330.1 (uncharacterized LOC100145082 [Source:NCBI gene;Acc:100145082])

HSP 1 Score: 172.17 bits (435), Expect = 1.185e-50
Identity = 103/286 (36.01%), Postives = 155/286 (54.20%), Query Frame = 2
Query:  164 VLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYG-PYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYE---NVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            +L S+CD    I    +   DDIL+ATFPKSGTT ++EIV L+L + D  K ++   F+++PFID       P        +++      PR+LKTHLP+ NL         +K + V RN KD  VS Y+F    ++ G P    W+N+F+ ++ G +  G W +    WW    +  +  +FYED+I++    I+++  F   DLS + +  I  HT F++M+ NPMTN+    NV   +    FMRKG +GDWKN F+ AQN   + +Y   +E  GL F+ E
Sbjct:   20 LLGSTCDAWDSIYN-FQARGDDILIATFPKSGTTWMQEIVDLILQEGDAQKGRRAPCFIKVPFIDLIPPKPMPS------GVELAQTMKSPRVLKTHLPI-NLLPPSFWEKNVKAVYVARNAKDCMVSYYYFQ--KINKGLPPPGTWENYFSAFLSGDVPWGSWFDHVIGWWKAMDKHQILFIFYEDMIEDPMREIRKVMKFLGKDLSDEVLENIKHHTSFQTMKENPMTNFSVFPNVIFDQTISPFMRKGTVGDWKNHFTVAQNIIFDEEYKKKMEGSGLNFRTE 295          
BLAST of Sulfotransferase vs. Ensembl Xenopus
Match: ENSXETT00000005832.1 (uncharacterized LOC100145082 [Source:NCBI gene;Acc:100145082])

HSP 1 Score: 172.17 bits (435), Expect = 1.185e-50
Identity = 103/286 (36.01%), Postives = 155/286 (54.20%), Query Frame = 2
Query:  164 VLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYG-PYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYE---NVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            +L S+CD    I    +   DDIL+ATFPKSGTT ++EIV L+L + D  K ++   F+++PFID       P        +++      PR+LKTHLP+ NL         +K + V RN KD  VS Y+F    ++ G P    W+N+F+ ++ G +  G W +    WW    +  +  +FYED+I++    I+++  F   DLS + +  I  HT F++M+ NPMTN+    NV   +    FMRKG +GDWKN F+ AQN   + +Y   +E  GL F+ E
Sbjct:   20 LLGSTCDAWDSIYN-FQARGDDILIATFPKSGTTWMQEIVDLILQEGDAQKGRRAPCFIKVPFIDLIPPKPMPS------GVELAQTMKSPRVLKTHLPI-NLLPPSFWEKNVKAVYVARNAKDCMVSYYYFQ--KINKGLPPPGTWENYFSAFLSGDVPWGSWFDHVIGWWKAMDKHQILFIFYEDMIEDPMREIRKVMKFLGKDLSDEVLENIKHHTSFQTMKENPMTNFSVFPNVIFDQTISPFMRKGTVGDWKNHFTVAQNIIFDEEYKKKMEGSGLNFRTE 295          
BLAST of Sulfotransferase vs. Ensembl Xenopus
Match: ENSXETT00000006355.1 (uncharacterized LOC100145082 [Source:NCBI gene;Acc:100145082])

HSP 1 Score: 172.17 bits (435), Expect = 1.307e-50
Identity = 103/286 (36.01%), Postives = 155/286 (54.20%), Query Frame = 2
Query:  164 VLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYG-PYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYE---NVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            +L S+CD    I    K   DDIL+ATFPK+GTT ++EIV L+L + D  K ++   F+++PFID       P        +++      PR+LKTHLP+ NL         +K + V RN KD  VS Y+F    ++ G P    W+N+F+ ++ G +  G W +    WW    +  +  +FYED+I++    I+++  F   DLS + +  I  HT F++M+ NPMTN+    NV   +    FMRKG +GDWKN F+ AQN   + +Y   +E  GL F+ E
Sbjct:   28 LLGSTCDAWDSIYG-FKARGDDILIATFPKAGTTWMQEIVDLILQEGDAQKGRRAPCFIKVPFIDLIPPKPMPS------GVELAQTMKSPRVLKTHLPI-NLLPPSFWEKNVKAVYVARNAKDCMVSYYYFQ--KINKGLPPPGTWENYFSAFLSGDVPWGSWFDHVIGWWKAMDKHQILFIFYEDMIEDPMREIRKVMKFLGKDLSDEVLENIKHHTSFQTMKENPMTNFSVFPNVIFDQTISPFMRKGTVGDWKNHFTVAQNIIFDEEYKKKMEGSGLNFRTE 303          
BLAST of Sulfotransferase vs. Ensembl Xenopus
Match: ENSXETT00000006135.1 (uncharacterized LOC100145082 [Source:NCBI gene;Acc:100145082])

HSP 1 Score: 168.703 bits (426), Expect = 4.534e-49
Identity = 103/305 (33.77%), Postives = 161/305 (52.79%), Query Frame = 2
Query:  104 EMTSKYSPLPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYE---NVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            EM  +   +P    +     +L S+CD    I    +   DDIL+ATFPKSGTT ++EIV L+L + D  K ++   ++++P I+       P      + +++      PR+LKTHLP+ NL         +K + V RN KD  VS Y+F+   + + P    W+NFF+ ++ G +  G W +    WW    +  +  +FYED+I++    I+++  F   DLS + +  I  HT F++M+ NPMTN+    NV   +    FMRKG +GDWKN F+ AQN   + +Y   +E  GL F+ E
Sbjct:   17 EMAQEAQRIPVAMGHIEGVPLLGSTCDAWDSIYN-FQARGDDILIATFPKSGTTWMQEIVDLILQEGDAQKGRRAPTYIKVPCIELIPPKPRP------IGVELAQTMKFPRVLKTHLPI-NLLPPSFWEKNVKAVYVARNAKDCMVSYYYFHKMNI-FLPDPGTWENFFSTFLSGDVPWGSWFDHVIGWWKAMDKHQILFIFYEDMIEDPMREIRKVMKFLGKDLSDEVLENIKHHTSFQTMKENPMTNFSVFPNVIFDQTISPFMRKGTVGDWKNHFTVAQNIIFDEEYKKKMEGSGLNFRTE 312          
BLAST of Sulfotransferase vs. Ensembl Mouse
Match: Sult1d1 (sulfotransferase family 1D, member 1 [Source:MGI Symbol;Acc:MGI:1926341])

HSP 1 Score: 166.007 bits (419), Expect = 1.994e-48
Identity = 100/268 (37.31%), Postives = 145/268 (54.10%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRL---DCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFC---FMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DDIL++T+PKSGTT + EI+ L+ N+ D  K K+  I+ R+PF++       PG       +++++  P PRI+KTHLPV  L       DC    K I V RN KD  VS Y+FY  A    P    W+ F  +++ G +S G W +  K WW +R    +  +FYED+ +N    I++I  F + D+  + +NKI+ H+ F  M+ NP  NY  +   E       FMRKG  GDWKN F+ AQ +  E  Y   +E   L+F+ E
Sbjct:   39 DDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFME----LIIPGITN---GVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDC----KIIYVARNAKDVVVSYYYFYQMA-KIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRSE 294          
BLAST of Sulfotransferase vs. Ensembl Mouse
Match: Sult1b1 (sulfotransferase family 1B, member 1 [Source:MGI Symbol;Acc:MGI:2136282])

HSP 1 Score: 161.384 bits (407), Expect = 1.439e-46
Identity = 94/269 (34.94%), Postives = 147/269 (54.65%), Query Frame = 2
Query:  203 EEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGF---EESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEF 1000
            EE +    DI++ T+PKSGTT L EIV +VLND ++ K K+  I  ++P ++ +     PG   +   ++++ K P PRI+KTHLP+ +L  +    +  K I + RN KD AVS YHF        P    W+ +  +++ G ++ G W +  K WW +R    L  ++YE+L +N    IK+I SF    L  + +++I+ HT FE M+ NP+ NY ++           FMRKG +GDWKN+F+  Q +  +  Y   +    LEF
Sbjct:   32 EEFQSTPGDIVITTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLELS----VPGI--RISGVELLKKTPSPRIIKTHLPI-DLLPKSFWENKCKMIYLARNGKDVAVSYYHFDL-MNSINPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREEHPLLYLYYEELKQNPKKEIKKIASFLDKTLDEEALDRIVHHTSFEMMKENPLVNYTHLPTAMMDHSKSPFMRKGIVGDWKNYFTMTQTEQFDAVYKKKMSGTTLEF 292          
BLAST of Sulfotransferase vs. Ensembl Mouse
Match: Sult1b1 (sulfotransferase family 1B, member 1 [Source:MGI Symbol;Acc:MGI:2136282])

HSP 1 Score: 161.384 bits (407), Expect = 1.439e-46
Identity = 94/269 (34.94%), Postives = 147/269 (54.65%), Query Frame = 2
Query:  203 EEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGF---EESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEF 1000
            EE +    DI++ T+PKSGTT L EIV +VLND ++ K K+  I  ++P ++ +     PG   +   ++++ K P PRI+KTHLP+ +L  +    +  K I + RN KD AVS YHF        P    W+ +  +++ G ++ G W +  K WW +R    L  ++YE+L +N    IK+I SF    L  + +++I+ HT FE M+ NP+ NY ++           FMRKG +GDWKN+F+  Q +  +  Y   +    LEF
Sbjct:   32 EEFQSTPGDIVITTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLELS----VPGI--RISGVELLKKTPSPRIIKTHLPI-DLLPKSFWENKCKMIYLARNGKDVAVSYYHFDL-MNSINPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREEHPLLYLYYEELKQNPKKEIKKIASFLDKTLDEEALDRIVHHTSFEMMKENPLVNYTHLPTAMMDHSKSPFMRKGIVGDWKNYFTMTQTEQFDAVYKKKMSGTTLEF 292          
BLAST of Sulfotransferase vs. Ensembl Mouse
Match: Sult1b1 (sulfotransferase family 1B, member 1 [Source:MGI Symbol;Acc:MGI:2136282])

HSP 1 Score: 161.384 bits (407), Expect = 1.439e-46
Identity = 94/269 (34.94%), Postives = 147/269 (54.65%), Query Frame = 2
Query:  203 EEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGF---EESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEF 1000
            EE +    DI++ T+PKSGTT L EIV +VLND ++ K K+  I  ++P ++ +     PG   +   ++++ K P PRI+KTHLP+ +L  +    +  K I + RN KD AVS YHF        P    W+ +  +++ G ++ G W +  K WW +R    L  ++YE+L +N    IK+I SF    L  + +++I+ HT FE M+ NP+ NY ++           FMRKG +GDWKN+F+  Q +  +  Y   +    LEF
Sbjct:   32 EEFQSTPGDIVITTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLELS----VPGI--RISGVELLKKTPSPRIIKTHLPI-DLLPKSFWENKCKMIYLARNGKDVAVSYYHFDL-MNSINPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREEHPLLYLYYEELKQNPKKEIKKIASFLDKTLDEEALDRIVHHTSFEMMKENPLVNYTHLPTAMMDHSKSPFMRKGIVGDWKNYFTMTQTEQFDAVYKKKMSGTTLEF 292          
BLAST of Sulfotransferase vs. Ensembl Mouse
Match: Sult1c2 (sulfotransferase family, cytosolic, 1C, member 2 [Source:MGI Symbol;Acc:MGI:1916333])

HSP 1 Score: 160.229 bits (404), Expect = 3.246e-46
Identity = 97/265 (36.60%), Postives = 142/265 (53.58%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFG--FEESFC-FMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DD+L+ T+PKSGTT ++EIV ++  + D+ K ++  I  R PFI+     +  G D  N       + P PRIL+THLP   L      N+  K + V RN KD  VS YHFY  +    P    WD +F  +I+G +S G W +  K WW  R +  +  +FYED+ +N    I+++  F   +L    ++KI++ T FE M+ NPMTN         ++S   FMRKG +GDWKN F+ AQN+  +  Y   + +  L F  E
Sbjct:   40 DDLLICTYPKSGTTWIQEIVDMIEQNGDVEKCRRTIIQHRHPFIEWARPPQPSGVDKAN-------EMPAPRILRTHLPTQLLPPSFWTNN-CKFLYVARNAKDCMVSYYHFYRMS-QVLPEPGTWDEYFETFINGKVSWGSWFDHVKGWWEIRDKYQILFLFYEDMKRNPKHEIQKVMQFMGKNLDEDVVDKIVLETSFEKMKENPMTNRSTAPKSILDQSISPFMRKGTVGDWKNHFTVAQNERFDEIYKQKMGRTSLNFSME 295          
BLAST of Sulfotransferase vs. UniProt/SwissProt
Match: sp|P50226|ST1A2_HUMAN (Sulfotransferase 1A2 OS=Homo sapiens OX=9606 GN=SULT1A2 PE=1 SV=2)

HSP 1 Score: 173.326 bits (438), Expect = 2.660e-50
Identity = 98/266 (36.84%), Postives = 149/266 (56.02%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWW-LERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV---FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DD+L++T+PKSGTT + +I+ ++    DL K  +  IF+R+PF++     + PG       ++ +   P PR+LKTHLP++ L   L  +  +K + V RN KD AVS YHFY  A  Y P+   W++F  +++ G +S G W +  ++WW L R  P L  +FYED+ +N    I++I  F    L  + ++ ++ HT F+ M+ NPMTNY  V   F       FMRKG  GDWK  F+ AQN+  +  Y   +    L F+ E
Sbjct:   39 DDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLE----FKVPGIPS---GMETLKNTPAPRLLKTHLPLALLPQTL-LDQKVKVVYVARNAKDVAVSYYHFYHMAKVY-PHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVL-YLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAKKMAGCSLSFRSE 294          
BLAST of Sulfotransferase vs. UniProt/SwissProt
Match: sp|P50225|ST1A1_HUMAN (Sulfotransferase 1A1 OS=Homo sapiens OX=9606 GN=SULT1A1 PE=1 SV=3)

HSP 1 Score: 170.629 bits (431), Expect = 2.631e-49
Identity = 98/266 (36.84%), Postives = 148/266 (55.64%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWW-LERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV---FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DD+L++T+PKSGTT + +I+ ++    DL K  +  IF+R+PF++     + PG       ++ +   P PR+LKTHLP++ L   L  +  +K + V RN KD AVS YHFY  A  + P    WD+F  +++ G +S G W +  ++WW L R  P L  +FYED+ +N    I++I  F    L  + ++ ++ HT F+ M+ NPMTNY  V   F       FMRKG  GDWK  F+ AQN+  +  Y   +    L F+ E
Sbjct:   39 DDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLE----FKAPGIPS---GMETLKDTPAPRLLKTHLPLALLPQTL-LDQKVKVVYVARNAKDVAVSYYHFYHMAKVH-PEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVL-YLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSE 294          
BLAST of Sulfotransferase vs. UniProt/SwissProt
Match: sp|P50227|ST1A1_BOVIN (Sulfotransferase 1A1 OS=Bos taurus OX=9913 GN=SULT1A1 PE=1 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 1.007e-48
Identity = 96/272 (35.29%), Postives = 151/272 (55.51%), Query Frame = 2
Query:  203 EEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFG--FEESF-CFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            E  + + DD+L++T+PKSGTT + EI+ L+  + DL K ++  +FLR+PF+      EF    G    ++++   P PR+LKTHLP++ L   L  +  +K I + RN KD AVS YHFY  A    P    WD+F  +++ G +  G W +  ++WW   +   +  +FYED+ ++    I++I  F    L  + ++ I+  T F+ M+ NPMTNY  +     + S   FMRKG  GDWK+ F+ AQN+  E  Y   +    L F++E
Sbjct:   32 ESFEAWPDDLLISTYPKSGTTWVSEILDLIYQEGDLEKCQRAPVFLRVPFL------EFSA-PGVPTGVELLKDTPAPRLLKTHLPLALLPKTL-LDQKVKVIYIARNAKDVAVSYYHFYRMA-KVHPDPGTWDSFLEKFMAGEVCYGSWYQHVQEWWELSHTHPVLYLFYEDIKEDPKREIQKILEFIGRSLPEETVDHIVQRTSFKEMKKNPMTNYSTIPTAVMDHSISAFMRKGITGDWKSTFTVAQNELFEAHYAKKMAGCKLRFRWE 294          
BLAST of Sulfotransferase vs. UniProt/SwissProt
Match: sp|O43704|ST1B1_HUMAN (Sulfotransferase family cytosolic 1B member 1 OS=Homo sapiens OX=9606 GN=SULT1B1 PE=1 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 1.917e-48
Identity = 98/284 (34.51%), Postives = 163/284 (57.39%), Query Frame = 2
Query:  176 SCDIIKRIEEEMKFFS--DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYEN----VFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            +C      E+  +F S  DDI++AT+PKSGTT + EI+ ++LND D+ K K+  I  ++P ++       PG   +   I+ ++K P PRI+KTHLP ++L  +    +  K I + RN KD +VS YHF     +  P+   W+ +  +++ G ++ G W    K+WW ++    +  ++YED+ +N  + IK+I  F + +L+ + +++II HT FE M+ NP+ NY +    V    +S  FMRKG  GDWKN+F+ AQN+  +  Y   + +  L+F+ E
Sbjct:   21 TCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMT----LPGL--RTSGIEQLEKNPSPRIVKTHLP-TDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDL-MNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKS-PFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTE 295          
BLAST of Sulfotransferase vs. UniProt/SwissProt
Match: sp|Q29476|ST1A1_CANLF (Sulfotransferase 1A1 OS=Canis lupus familiaris OX=9615 GN=SULT1A1 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.969e-48
Identity = 93/265 (35.09%), Postives = 149/265 (56.23%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFG--FEESF-CFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DD+L++T+PKSGTT + EI+ ++  D D+ K ++  +F+R+PF+      EF    G    ++++   P PR++KTHLP++ L   L  +  +K + V RN KD AVS YHFY  A    P  + WD+F  +++ G +S G W +  ++WW   +   +  +FYED+ +N    I++I  F    L  + ++ I+ HT F+ M+ N M NY  +     + S   FMRKG  GDWK  F+ AQN+  +  Y   +E  GL F+ +
Sbjct:   39 DDLLISTYPKSGTTWVSEILDMIYQDGDVEKCRRAPVFIRVPFL------EFKA-PGIPTGLEVLKDTPAPRLIKTHLPLALLPQTL-LDQKVKVVYVARNAKDVAVSYYHFYRMA-KVHPDPDTWDSFLEKFMAGEVSYGSWYQHVQEWWELSHTHPVLYLFYEDMKENPKREIQKILKFVGRSLPEETVDLIVQHTSFKEMKNNSMANYTTLSPDIMDHSISAFMRKGISGDWKTTFTVAQNERFDADYAKKMEGCGLSFRTQ 294          
BLAST of Sulfotransferase vs. TrEMBL
Match: A0A1I8H2X7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 4.402e-79
Identity = 125/300 (41.67%), Postives = 188/300 (62.67%), Query Frame = 2
Query:  104 EMTSKYSPLPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDC--NSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLE 997
            ++  KY  +  EFVYK++ +V W++   I+ +E+E +F  DD+L+ATFPKSGTTL++E+ WL+ ++ D   AK  ++F R+PF++EN+T +FPG       +  + + PRPRI+KTHLP   +  R++     G KTI V+RNPKD  VS YHFY G VDYGP+   + +FF+ W+DGWI  GDW  V K WW +R RP+L ++ +EDL++     I  +   +   L +Q   K      F++M+ NP TNY  V G  +SF FMR GK+GDWK +F+ +Q++  +  Y   +   GL+
Sbjct:   28 QLNPKYPKMMNEFVYKDVLFVHWTTRRNIELVEQEFEFLPDDLLIATFPKSGTTLMQELAWLLRHNLDFAGAKASRVFERVPFLEENWTSQFPGHPEGCYPMQYLPEMPRPRIIKTHLPYHIIGPRIEAAPGPGFKTICVLRNPKDVLVSYYHFYKGVVDYGPWPWDFSSFFDMWMDGWIVAGDWFRVAKAWWAQRNRPDLLLVKFEDLVRRPALEIPRVADSWA--LKSQDDVK-----RFDAMKENPATNYSGVPGMLDSFSFMRSGKVGDWKRFFTVSQSEQFDRIYQAEMAGTGLD 320          

HSP 2 Score: 66.6254 bits (161), Expect = 2.450e-8
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  746 IKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGL 994
            I  +  F  V++    + ++     F++M+ NP TNY  V G  +SF FMR GK+GDWK +F+ +Q++  +  Y   +   GL
Sbjct:  332 IPRVAEFLGVEVGQDDVKRLANALSFDAMKENPATNYSGVPGMLDSFSFMRSGKVGDWKRFFTVSQSEQFDRIYQAEMAGTGL 414          
BLAST of Sulfotransferase vs. TrEMBL
Match: A0A1I8H456 (Sulfotransfer_1 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 6.318e-74
Identity = 117/305 (38.36%), Postives = 184/305 (60.33%), Query Frame = 2
Query:  104 EMTSKYSPLPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYT-HEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDC--NSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            ++  KY  +  EFVYK++ +V W++   I+ +E+E +F  DD+L+ATFPKSGTTL++E+ WL+ ++ D   AK  ++F R+PF++EN+T H  P   G+ L+             +   P ++   R++     G KTI V+RNPKD  VS YHFY G VDYGP+   + +FF+ W+DGWI  GDW  V K WW +R RP+L ++ +EDL++     I  +  F  V++    + ++     F++M+ NP TNY  V G  +SF FMR GK+GDWK +F+ +Q++  +  Y   +   GLE +++
Sbjct:  503 QLNPKYPKMMNEFVYKDVLFVHWTTRRNIELVEQEFEFLPDDLLIATFPKSGTTLMQELAWLLRHNLDFAGAKASRVFERVPFLEENWTSHTCPRCRGRALS-------------RRTCPTTSSGARIEAAPGPGFKTICVLRNPKDVLVSYYHFYKGVVDYGPWPWDFSSFFDMWMDGWIVAGDWFRVAKAWWAQRNRPDLLLVKFEDLVRRPALEIPRVAEFLGVEVGQDDVKRLANALSFDAMKENPATNYSGVPGMLDSFSFMRSGKVGDWKRFFTVSQSEQFDRIYQAEMAGTGLELEFD 794          
BLAST of Sulfotransferase vs. TrEMBL
Match: A0A2H1CAB8 (Aryl sulfotransferase OS=Fasciola hepatica OX=6192 GN=D915_005604 PE=4 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.723e-67
Identity = 120/316 (37.97%), Postives = 180/316 (56.96%), Query Frame = 2
Query:  107 MTSKYSPLPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLND-------ADLVK-AKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRP------RILKTHLPVSNLRCRLD-CNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWW-LERY--RPNLKIMF--YEDLIKNKFDSIKEICSFF--QVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQI 988
            + +KY  +PGEF+YK   WV W+S  II+R+E++ +F+  D++++ +PKSG TLL E+V L++         A+ +K A    IF R+ FI+E Y   +P        +D +++W         R++KTHLP  +++C LD  +   + + V RNPKD  VSM+HFY GA +YGP+   WD F + W+DGWI+ G+W  V  +W    R   RP  +I+   YE L++     ++ +  F      L  +    I  HT FE MR NP TNYENV GF   F FMR+G+IGDWK WF+  Q+   +  Y   ++Q+
Sbjct:   12 LNAKYRSMPGEFLYKGNQWVSWTSEQIIRRVEDQFQFWPSDVILSGYPKSGNTLLSEMVSLLVRSQGQKSKWAETLKWAHSYPIFNRVVFIEEIYQWIYPSCTQITKPMDYLEQWTTEGSQLPCRLIKTHLPADSIKCALDRVDQSPRIVYVYRNPKDVCVSMFHFYRGAQEYGPFAGDWDEFLHMWLDGWIAAGNWCSVVPEWLKFSRLCTRPGNRILCLSYESLVREPMKCVQRLHRFLNPHQPLDPEVSEAICEHTSFERMRKNPQTNYENVDGFVSDFEFMRRGEIGDWKRWFTAEQSNEFDRIYESCVDQV 327          
BLAST of Sulfotransferase vs. TrEMBL
Match: A0A504YZ84 (Aryl sulfotransferase OS=Fasciola gigantica OX=46835 GN=FGIG_06674 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.019e-66
Identity = 119/316 (37.66%), Postives = 180/316 (56.96%), Query Frame = 2
Query:  107 MTSKYSPLPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLND-------ADLVK-AKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRP------RILKTHLPVSNLRCRLD-CNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWW-LERY--RPNLKIMF--YEDLIKNKFDSIKEICSFFQ--VDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQI 988
            + +KY  +PGEF+YK   WV W+S  II+R+E++ +F+  D++++ +PKSG TLL E+V L++         A+ +K A    +F R+ FI+E Y   +P        +D +++W         R++KTHLP  +++C LD  +   + + V RNPKD  VSM+HFY GA +YGP+   WD F + W+DGWI+ G+W  V  +W    R   RP  +I+   YE L++     ++ +  F      L  +    I  HT FE MR NP TNYENV GF   F FMR+G+IGDWK WF+  Q+   +  Y   ++Q+
Sbjct:   12 LNAKYRSMPGEFLYKGNQWVSWTSEQIIRRVEDQFQFWPSDVILSGYPKSGNTLLSEMVSLLVRSQGQKSKWAETLKWAHSYPVFNRVVFIEEIYQWIYPSCTQITKPMDYLEQWTTEGSQLPCRLIKTHLPADSMKCALDRVDQSPRIVYVYRNPKDVCVSMFHFYRGAQEYGPFAGDWDEFLHMWLDGWIAAGNWSRVVPEWLKFSRLCTRPGNRILCLSYESLVREPMKCVQRLHRFLNPYQPLDPEVSEAICEHTSFERMRKNPQTNYENVDGFVSDFEFMRRGEIGDWKRWFTAEQSTEFDRIYVSCVDQV 327          
BLAST of Sulfotransferase vs. TrEMBL
Match: A0A4S2LX02 (Sulfotransfer_1 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004271 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.466e-65
Identity = 121/319 (37.93%), Postives = 175/319 (54.86%), Query Frame = 2
Query:   98 KMEMTSKYSPLPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLV--------LNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIID------KWPRPRILKTHLPVSNLRC---RLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDW--WLERYRP-NLKIMFYEDLIKNKFDSIKEICSFF--QVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQI 988
            K  +  KY  +PGEF+YK   W  W+S  +I+++E++  F   DI+++ +PKSG T L EI  L+           + + K +  +++ R+PFI+E +T  +P  + K  A++ +D         +PR++KTHLP  ++ C   R+  N   + + V RNPKD AVSMY+FYCG  +YGP+   WD FF  WIDGWI GGDW +V   W    E   P  +  + YE L+ +    +  I  F   + DL       I+  T F+ MR N MTNY++V  F  SF FMR+G +GDWKNWFS  QN      Y   LE +
Sbjct:   10 KSSLNPKYRRMPGEFMYKGNLWPSWTSEKMIRKVEDQFLFLPTDIILSGYPKSGITFLSEISCLLHFSHGKLECLQSAIEKVENCQVYFRVPFIEEEWTGLYPMMNNKVQAMEYLDCVREQQGGNQPRLIKTHLPFDSIECALNRMQRNLRPRILYVYRNPKDVAVSMYNFYCGLQNYGPFEGAWDEFFEMWIDGWIGGGDWRKVVPPWLKQAEIAEPTQMLAISYEQLVNDTEACVNNIHHFLLPETDLEPTVRQVILERTSFKKMRENKMTNYKDVEEFIPSFQFMRRGCVGDWKNWFSPEQNSRFMAAYKDTLEDL 328          
BLAST of Sulfotransferase vs. Ensembl Cavefish
Match: ENSAMXT00000039560.1 (sulfotransferase 1C1-like [Source:NCBI gene;Acc:103035674])

HSP 1 Score: 152.525 bits (384), Expect = 3.910e-43
Identity = 89/262 (33.97%), Postives = 140/262 (53.44%), Query Frame = 2
Query:  227 DILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV--FGFEESF-CFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQ 1003
            D+L+AT+PK+GTT  +EIV L+L++ D    K+     R PF++  Y    P        +D++ K   PR +KTHLP+  L          K I V RN KD  VS YHF+       P    WD +   ++ G ++ G W +  K +W ER + N+  +FYED+ +N   ++++I  +  + +S + I KI+  T F SM+ NPM NY  +    F+ S   FMRKG++GDW N F+ AQ++  +  Y   +  + + F+
Sbjct:   54 DLLIATYPKAGTTWAQEIVDLLLHNGDSEACKRGPTVDRFPFLEIQYPPPIPS------GLDLLKKMKPPRFIKTHLPI-QLVPEGFWKHKCKVIYVARNAKDNLVSYYHFH-RMNKAQPDPGTWDEYIQNFMRGKLAWGSWYDHVKGYWKEREKKNILYLFYEDMKENPRQAVEQIMRYLDLSVSEEVIEKIVQLTSFNSMKDNPMANYTFIPKIMFDHSVSAFMRKGEVGDWTNHFTPAQSQVFDEDYVRQMADVDMPFR 307          
BLAST of Sulfotransferase vs. Ensembl Cavefish
Match: sult1st5 (sulfotransferase 1C4-like [Source:NCBI gene;Acc:103029072])

HSP 1 Score: 150.599 bits (379), Expect = 1.847e-42
Identity = 91/280 (32.50%), Postives = 148/280 (52.86%), Query Frame = 2
Query:  203 EEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYR-PNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNY----ENVFGFEESFCFMRK-------GKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQY 1006
            +E +   DD+L+AT+PK+GTT  +EIV L+LN  +  K ++    +R+PF+      E    D     +  ++K   PR++KTHLP+  L  R    +G K I + RNPKD  VS +HF C  +   P    W  +  +++ G +  G W +  K +W E+ +  N+  +FYED+ ++    +  I  F    LS   ++ I+  T F+SMR NPM NY    ++VF  + S  FMRK       G++GDW+N+FS  ++   E  Y+  +    + F++
Sbjct:   30 DEFQAHKDDLLIATYPKAGTTWTQEIVDLILNKGNEEKCRRAPTHVRMPFL------EMTTLDPAESGMAKLEKMAPPRVIKTHLPI-QLVPRSFWEAGCKVIYMARNPKDNVVSYFHFDCMNLT-QPEPGPWPEYLKKFMKGELGWGSWYDHVKGFWREKQKNKNILYLFYEDMKEDPSREVLRIAEFLGKPLSKSVVDDIVHLTTFDSMRDNPMANYSTIPDSVFDRKASE-FMRKVYSYVFIGEVGDWQNYFSPQEDAEFEEHYHRTMADTPIPFKF 300          
BLAST of Sulfotransferase vs. Ensembl Cavefish
Match: ENSAMXT00000047219.1 (cytosolic sulfotransferase 3-like [Source:NCBI gene;Acc:103044416])

HSP 1 Score: 145.206 bits (365), Expect = 1.769e-40
Identity = 94/268 (35.07%), Postives = 144/268 (53.73%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIV-WLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPR-PRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREG-WDNFFNRWIDGWISGGDWLE-VTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV--FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DDILVAT+PK+GTT +  I+  L   +    +   L I+LR+PF++ +    FPG       +++ D  P  PRI+KTHLPV  L  +       + + V RN KD  VS YHF    ++ G    G W+ F   +++G    G W + V   W  +R   N+  MF+ED++++    ++ +CSF  +    ++  +I   T F++M+ N MTNY  V    F  S  FMRKGK+GDWKN F+ AQN+  +  Y   ++   L+F+ E
Sbjct:   42 DDILVATYPKAGTTWVSYILDLLYFGNTAPERQTDLPIYLRVPFLEAS----FPGMPS---GVELADTLPTTPRIIKTHLPVQ-LIPKSFWEQNCRIVYVARNAKDNVVSYYHF--DRMNMGEPEPGDWNTFLQTFMEGKKVFGPWYDHVCGYWEKKRTYSNIHYMFFEDMVEDTGREVERLCSFLGLSTPIEERERITKGTHFDAMKKNNMTNYSTVPIMDFNVS-PFMRKGKVGDWKNHFTVAQNEQFDEHYKQKMKNTTLQFRTE 298          
BLAST of Sulfotransferase vs. Ensembl Cavefish
Match: ENSAMXT00000034992.1 (cytosolic sulfotransferase 3-like [Source:NCBI gene;Acc:103043615])

HSP 1 Score: 137.887 bits (346), Expect = 8.710e-38
Identity = 88/268 (32.84%), Postives = 146/268 (54.48%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVL-NDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWP-RPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYG-PYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYR-PNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYEN--VFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DDIL+AT+PK+GTT +  I+ L+  +     + K + I++R+PF++      FPG       +++ D+ P  PR++KTHLPV  L  +       + + V RN KD AVS +HF    ++ G P    W     +++DG    G W +    +W ++    N+  MF+ED++++    ++ +CSF  +    ++  +I   T F++M+ N MTNY    V  F  S  FMRKGK+GDWKN F+ AQN+  +  Y   ++   L+F+ +
Sbjct:   41 DDILIATYPKAGTTWVSYILELLFFSKLGAERQKTMPIYMRVPFLEGI----FPGLP---TGVELADQLPTSPRLIKTHLPV-QLVPKSFWEQNSRVVYVARNAKDNAVSYFHF--DRMNKGQPDPIDWSTDLQKFMDGKKVFGPWYDHVCGYWEKKQTYSNIHYMFFEDMVEDTGREVEHLCSFLGLSTPIEERERITKGTHFDTMKLNNMTNYSTVPVMDFNVS-PFMRKGKVGDWKNHFTVAQNERFDEHYKQRMKNTTLQFRTQ 297          
BLAST of Sulfotransferase vs. Ensembl Cavefish
Match: sult1st6 (sulfotransferase 1C1-like [Source:NCBI gene;Acc:103035168])

HSP 1 Score: 137.887 bits (346), Expect = 9.992e-38
Identity = 83/262 (31.68%), Postives = 137/262 (52.29%), Query Frame = 2
Query:  227 DILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV--FGFEESF-CFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQ 1003
            D+L++T+PK+GTT  +EI+ L+L++ D    K+     RIPF++       P        ++++     PR++KTHLP+  L       +  K I V RN KD  VS YHF        P    WD +  +++ G +  G W +  K +W ER + N+  +F+ED+ +N    ++ I  +  + +S   I KI+  T F+ M+ NPM NY  +    F+ S   FMRKG++GDW N F+ AQ++  +  Y   +  + + F+
Sbjct:   52 DLLISTYPKAGTTWTQEIIDLLLHNGDAEVCKRAPTVERIPFLEIQAPPPIPS------GLELLTIMKPPRVIKTHLPI-QLVPEGFWKNKCKVIYVARNAKDNLVSYYHF-DRMNKTQPEPGTWDEYIQKFMKGNLGWGSWYDHVKGYWKEREKRNILYLFFEDMKENPRREVERIMRYLDLSVSEDVIEKIVQLTSFKVMKDNPMANYTFIPKVVFDHSVSAFMRKGEVGDWINHFTPAQSQMFDEDYVRQMADVDMPFR 305          
BLAST of Sulfotransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005805.1 (pep scaffold:Pmarinus_7.0:GL481881:4266:17404:1 gene:ENSPMAG00000005212.1 transcript:ENSPMAT00000005805.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.257 bits (321), Expect = 8.799e-35
Identity = 84/263 (31.94%), Postives = 132/263 (50.19%), Query Frame = 2
Query:  242 TFPKSG----TTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGA---VDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYE---NVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEF 1000
            T+PKSG    TT ++EI  L+++  DL   K +  + R+P+++           GK      ++  P PR++ TH   S    +L    G K I V+RNPKD  VS++HF   A    D G   E + NF +      ++GG W    + W   +  PN+ I+ +ED++K+   S+K I  F +  LS   ++ I  H  F SM+ +PM NY    N +       FMRKG +G+WK+ F+ A ++A +  Y   +E   L+F
Sbjct:   49 TYPKSGGQKGTTWMQEITTLIVSGGDLTPVKTIPSWQRVPWVES--------ITGKKY----LENRPSPRLISTHASYSIAPKKLKEGKG-KAIYVIRNPKDVMVSIHHFSKFAQFLTDMGTLEECFRNFVSN--KAQLTGGSWFTHVRGWHEHKDAPNIFIISFEDMVKDLRGSVKRIADFMKRPLSESALDTIAEHCTFSSMKKSPMANYSLVPNNWLDHNVGTFMRKGAVGNWKSEFTVALSEAFDTVYAKKMEGCDLKF 296          
BLAST of Sulfotransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001221.1 (pep scaffold:Pmarinus_7.0:GL482898:21441:26832:1 gene:ENSPMAG00000001094.1 transcript:ENSPMAT00000001221.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 5.085e-34
Identity = 70/206 (33.98%), Postives = 104/206 (50.49%), Query Frame = 2
Query:  404 AIDIIDKWPRPRILKTHLPVSNLRCRL---DCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV---FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQ 1003
             +++++  P PR +KTHLP   +       DC    K I V RN KD AVS +HF        P    W+ + +R+I G +  G W +    WW  R R  +  +F+ED++++    +  I  F +  LS QQ+ +++  T F  MR NPMTNY  +   F       FMRKG++GDW+N FS AQ +A E  Y   +    L  +
Sbjct:   11 GVEVLNDLPSPRTIKTHLPYQLVPSSFWDNDC----KVIYVARNAKDNAVSAFHFN-RMNKLHPEPGTWEEYLHRFITGNVCWGSWHDHVTGWWNVRERHRILYLFFEDMMEDPMREVSRIAQFLERPLSEQQLREVVKLTSFPVMRDNPMTNYSTLPTDFLDHSVSPFMRKGEVGDWRNHFSAAQLEAFEQHYKEKMAATDLRLR 211          
BLAST of Sulfotransferase vs. Ensembl Sea Lamprey
Match: sult4a1 (sulfotransferase family 4A, member 1 [Source:ZFIN;Acc:ZDB-GENE-060421-2705])

HSP 1 Score: 115.546 bits (288), Expect = 4.524e-30
Identity = 76/273 (27.84%), Postives = 139/273 (50.92%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEF---ESMRANPMTNYENVFGFEESFCF--------MRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DD+ +A++PKSGT++L+E+V+L+    D  +   + I  ++P ++    H  PG       +DI+ +   PRI+KTHLP   L   L  +S  K + + RNPKD AVS Y F       G +R  +  F  R+++  ++ G W +  +++W  R    +  + YEDL +N     +++ +F  +   T     ++ H       SM+ +   N+ +   +E+S           +++G++G WK+  S  +++  +  Y   L QIGL+F+Y+
Sbjct:   39 DDVWIASYPKSGTSVLQEMVFLISQGVDPAEVGIMNIAEQMPVLE----HPQPG-------LDILTELTTPRIIKTHLPYGLLPRDL-WDSKAKVVYMARNPKDLAVSYYQFLRSLRTPG-FRGSFPEFCRRFLENRLAYGSWFDHVQEFWNHRNDEQILFLKYEDLHQNLPKVSEQLQAFLSIKQETAHAQDVVQHCSQLVDASMQPHARGNHTHN-TYEDSPIIEHTKVNDSIQRGRVGIWKDSLSVEESEHFDVAYGERLSQIGLQFEYQ 297          
BLAST of Sulfotransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007474.1 (pep scaffold:Pmarinus_7.0:GL483169:4853:11483:-1 gene:ENSPMAG00000006745.1 transcript:ENSPMAT00000007474.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 1.936e-28
Identity = 60/169 (35.50%), Postives = 89/169 (52.66%), Query Frame = 2
Query:  509 IIVMRNPKDTAVSMYHFYCGAVD-YGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV---FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQ 1003
            I V RN KD A+S +HF  G ++ + P    W+ + +R++ G +  G W +    WW  R R  +  +F+ED+ ++    +  I  F Q  LS QQ+ +++  T F  MR NPMTNY  V   F       FMRKG++GDW+N FS AQ +A E  Y   +    L  +
Sbjct:    1 IYVARNAKDNALSSFHF--GRMNQHHPEPGTWEEYLHRFMIGNVCWGSWYDHVTGWWNVRERHRILYLFFEDMKEDPMREVSRIARFLQRPLSEQQLREVVKLTSFPVMRDNPMTNYSTVPTDFMDHSVSPFMRKGEVGDWRNHFSAAQLEAFEQHYKEKMATTDLRLR 167          
BLAST of Sulfotransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002055.1 (pep scaffold:Pmarinus_7.0:GL480009:3682:6562:1 gene:ENSPMAG00000001865.1 transcript:ENSPMAT00000002055.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 6.627e-19
Identity = 41/114 (35.96%), Postives = 60/114 (52.63%), Query Frame = 2
Query:  671 WWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV---FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQ 1003
            WW  R R  +  +F+ED+ ++    +  I  F +  LS QQ+ +++  + F  MR NPMTNY  V   F       FMRKG++GDW+N FS AQ +A E  Y   +    L  +
Sbjct:    4 WWNVRERHRILYLFFEDMKEDPMREVSRIAQFLERPLSEQQLREVVKLSTFSVMRDNPMTNYSTVPTDFLDHSVSPFMRKGEVGDWRNHFSAAQLEAFEQHYKEKMSTTDLRLR 117          
BLAST of Sulfotransferase vs. Ensembl Nematostella
Match: EDO40769 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S682])

HSP 1 Score: 158.688 bits (400), Expect = 2.531e-46
Identity = 86/261 (32.95%), Postives = 137/261 (52.49%), Query Frame = 2
Query:  227 DILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            D+ VAT+PK GTT + EIVW + ND  + K+    I +R+PF++     +  G    +   +     P PR+ KTHL        +D     K I VMRNPKD AVS++ F+C  + Y      W  FF  +I G +  G W +    WW     PN+  + YED+ K+   ++++I SF     S + I +I+  T F++M+            F+  F F+RKG++GDW+N+F+D QN+ ++  Y  ++   GL+ ++E
Sbjct:   13 DVFVATYPKCGTTWVSEIVWQIFNDGQIDKSD---IIIRVPFLEAYPMIQKRGVFVNDNLTEFYRSVPAPRVFKTHLHHHFAPMGIDTTPKPKYIYVMRNPKDCAVSLF-FHCKGMAYYKCDASWLEFFEAFIRGRVEEGLWFDHVLGWWKHHEDPNILFLKYEDMKKDLPRTVRQIASFVGRSPSEEVIARIVRQTTFDAMKDGEQFYQRKRPDFKPGFKFIRKGEVGDWRNYFTDEQNRRVDEMYTRMMTSSGLQLEFE 269          
BLAST of Sulfotransferase vs. Ensembl Nematostella
Match: EDO40768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S681])

HSP 1 Score: 156.762 bits (395), Expect = 1.225e-45
Identity = 87/263 (33.08%), Postives = 141/263 (53.61%), Query Frame = 2
Query:  227 DILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPG-FDGKNLAI-DIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            D+ VAT+PK GTT + EI+W + ND  + K+    I  R+PF++     +  G F  K+L +  +    P PR+ KTHL         D  +  K I VMRNPKD AVSM+ F+C  +++      W  FF  +I G +  G W +    WW     PN+  + YED+ K+   ++++I SF     S + I +I+  T F++M+            F+  F F+RKG++GDW+N+F+D Q++ ++  Y  ++   GL+ ++E
Sbjct:   18 DVFVATYPKCGTTWVSEIIWQIFNDGQIDKSD---IGKRVPFVEAYPLMQKKGVFINKDLTLTGLYRSVPAPRVFKTHLHHHLAPMGSDTTAKPKYINVMRNPKDCAVSMF-FHCKGMEFFKCNASWSEFFEAFIRGGVEEGLWFDHVLGWWKHHGDPNILFLKYEDMKKDLPSTVRQIASFVGRSPSEEVIARIVRQTTFDAMKDGEQFFQRKRPDFKPGFKFIRKGEVGDWRNYFTDEQSRRVDEMYTRMMAGSGLQLEFE 276          
BLAST of Sulfotransferase vs. Ensembl Nematostella
Match: EDO46840 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP28])

HSP 1 Score: 148.288 bits (373), Expect = 9.352e-43
Identity = 88/253 (34.78%), Postives = 138/253 (54.55%), Query Frame = 2
Query:  260 TTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKW---PRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            TT +EEIVW + +D    K      F+RIPF+      E     G    I+ +DK     +PRI K+H     +      +   K + VMRNPKD AVS++HFY G + +  Y   WD FF  +I G +  G W +    WW  R  PN+ ++ YED++K++  +IK+I SF   ++S   +  +   T F++M+  PM + +    ++E+  FMRKGK+GDW ++FS  Q++ L+  YN  + + GLEF ++
Sbjct:   10 TTWVEEIVWQLHHDG---KLDDRPTFVRIPFL------EIQPSGGVGPEIEKVDKLVQEHKPRIFKSHFGYDIIPKGNAGDDRPKYVCVMRNPKDVAVSLFHFYRG-IHHILYEGTWDEFFELFIKGDVLYGSWFDHVLSWWEHRDDPNVLLLKYEDMVKDRLGAIKQIASFVDKNISPDLVQLVADQTSFDAMKDMPMFSLKGF--YKETEKFMRKGKVGDWVSYFSREQSERLDAIYNERIRETGLEFDFQ 250          
BLAST of Sulfotransferase vs. Ensembl Nematostella
Match: EDO47293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM1])

HSP 1 Score: 143.665 bits (361), Expect = 1.346e-40
Identity = 86/271 (31.73%), Postives = 139/271 (51.29%), Query Frame = 2
Query:  203 EEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGF-DGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFE--ESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQY 1006
              +K  +DD+++ ++PKSGTT   EIVW + ND    K  + +I  ++ F+D  +    P      N  I      PRPR+LKTHL    +    D  S  KTI+VMRNPKD  VS ++ Y G          W+ FF   + G +  G W +  + WW  R+ PN+  + Y+DL ++    I+ I SF ++  +   + ++   T F +MR  P  ++ + FG +    F F+ KGK+G WK++F++ QN+  + K+   +   G +  Y
Sbjct:    6 SRLKVCNDDVIITSWPKSGTTWTMEIVWQLYNDG---KIDETQIDKKVKFLDTMFIPADPANPQTPNDVIKTFQGLPRPRLLKTHLNYQYVPMGEDRGSAPKTIVVMRNPKDAFVSYFNHYTGLAILQ-CDTDWEEFFELALSGDVVFGSWFDFVRSWWPHRHDPNVMFLRYKDLKQDLPAMIQRIASFLELRPNADLMAQVAQQTTFSAMRDRPSFDH-SWFGQKPGRKFEFLWKGKVGSWKDFFTEEQNRRFDRKFKQEMAGTGFDLSY 271          
BLAST of Sulfotransferase vs. Ensembl Nematostella
Match: EDO49874 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REY6])

HSP 1 Score: 133.65 bits (335), Expect = 1.420e-36
Identity = 82/282 (29.08%), Postives = 135/282 (47.87%), Query Frame = 2
Query:  170 WSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDE---NYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQY 1006
            +++ D ++RI   ++   DD+ +  +PKSG T   EIV  VLN  +    +Q  +  R  ++D          P         D     P PRILKTHL    +     C +  K I  +RNPKD AVS Y+ +     Y  ++E W++FF   + G +  G W +   DWW  R  PN+ ++ YED+ K+   ++  I  F    L+ +Q+++I+  T FE M++  +   +  F        +RKG +GDW+N F+  QN+  +  Y   +   G   ++
Sbjct:   12 YTTRDDLQRIAN-LELRDDDVFLTAYPKSGQTWTIEIVKQVLNGGEF--DQQSPMLCRAVYLDAFSLEKRAGIPPMRNYETVTDFAKSLPSPRILKTHLQYHLVPRSDGCTA--KYIYNIRNPKDVAVSFYYHHRTLKPYC-FQEKWNDFFEMMMSGQVQYGSWFDHVLDWWEHRDDPNILLLKYEDMKKDHRGAVAAIAKFLGRALTEEQLDRIVSQTSFEFMKSQELFKVKEPFKNPNEPELIRKGVVGDWRNHFTAEQNQMFDELYETRMSGKGFNIEF 287          
BLAST of Sulfotransferase vs. Ensembl Medaka
Match: sult1st6 (sulfotransferase family 1A member 4 [Source:NCBI gene;Acc:100125513])

HSP 1 Score: 148.673 bits (374), Expect = 1.082e-41
Identity = 89/265 (33.58%), Postives = 145/265 (54.72%), Query Frame = 2
Query:  227 DILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYC---GAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFG--FEESFC-FMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQ 1003
            D+L+AT+PK+GTT  +EIV L+L++ D    K+    +R PF++       P        +D++ K   PR++KTHLP   +      N   K I V RN KD  VS Y+F        + GP+    D + N+++ G +S G W +  K +W+E+ + N+  +FYED+ +N    +  I  +  + +S + IN+I+  T F+SM+ NPM NY  +    F++S   FMRKG++GDWKN F+  Q K  +  Y   ++ + + F+
Sbjct:   53 DLLIATYPKAGTTWTQEIVDLLLHNGDAEACKRAPTPIRSPFLEICSPPPIPS------GLDLLKKMDPPRVIKTHLPFQLVPPGFWENK-CKAIYVARNAKDNLVSYYYFDLMNKTQPEPGPF----DGYINKFMRGELSWGPWYDHVKSYWVEKEKRNILYLFYEDMKENPRREVLRIMKYLDLSVSDEVINQIVELTSFKSMKENPMANYSCIPSPVFDQSVSPFMRKGEVGDWKNHFTPEQAKMFDEDYAEQMKDVNIPFR 306          
BLAST of Sulfotransferase vs. Ensembl Medaka
Match: sult1st9 (cytosolic sulfotransferase 1 [Source:NCBI gene;Acc:100125514])

HSP 1 Score: 145.976 bits (367), Expect = 9.247e-41
Identity = 93/268 (34.70%), Postives = 149/268 (55.60%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLV-KAKQLKIFLRIPFIDENYTHEFPG-FDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHF-YCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYR-PNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYEN--VFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DDIL+AT+PK+GTT +  I+ L+     L  +   + I+ R+PF++       PG F GK+L  ++      PR++KTHLPV  +          + + + RN KD  VS +HF     V+  P    W +FF R++DG +  G W +   +WW ++    NL  MF+EDL++N    I+++CSF  +  S +++ ++    +F++M+ + M NY    V  F+ S  FMRKGK+GDWKN F+ AQN+A +  Y   +    L+F+ E
Sbjct:   45 DDILIATYPKAGTTWVSYILDLLYFRESLEDRLTTIPIYERVPFLEIC----IPGLFSGKDLVDNLTTS---PRLIKTHLPVQFVPKSF-WEQNCRIVYMARNAKDNMVSFFHFDRMNKVEPDPGE--WSSFFQRFLDGKMVFGSWYDHVNNWWKKKESYSNLHYMFFEDLVENTGHEIEKLCSFLGLSPSAEEVERLSSSVQFDNMKKDKMANYSTAPVMDFKIS-PFMRKGKVGDWKNHFTVAQNEAFDEDYKKKMTDPTLQFRTE 301          
BLAST of Sulfotransferase vs. Ensembl Medaka
Match: sult1st9 (cytosolic sulfotransferase 1 [Source:NCBI gene;Acc:100125514])

HSP 1 Score: 145.591 bits (366), Expect = 2.086e-40
Identity = 95/275 (34.55%), Postives = 150/275 (54.55%), Query Frame = 2
Query:  224 DDILVATFPKSGTTLLEEIVWLVLNDADLV-KAKQLKIFLRIPFIDENYTHEFPG-FDGKNLAIDIIDKWPRPRILKTHLPVS-------NLRCRLDCNSGMKTIIVMRNPKDTAVSMYHF-YCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYR-PNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYEN--VFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            DDIL+AT+PK+GTT +  I+ L+     L  +   + I+ R+PF++       PG F GK+L  ++      PR++KTHLPV           CR+        + + RN KD  VS +HF     V+  P    W +FF R++DG +  G W +   +WW ++    NL  MF+EDL++N    I+++CSF  +  S +++ ++    +F++M+ + M NY    V  F+ S  FMRKGK+GDWKN F+ AQN+A +  Y   +    L+F+ E
Sbjct:   73 DDILIATYPKAGTTWVSYILDLLYFRESLEDRLTTIPIYERVPFLEIC----IPGLFSGKDLVDNLTTS---PRLIKTHLPVQFVPKSFWEQNCRI--------VYMARNAKDNMVSFFHFDRMNKVEPDPGE--WSSFFQRFLDGKMVFGSWYDHVNNWWKKKESYSNLHYMFFEDLVENTGHEIEKLCSFLGLSPSAEEVERLSSSVQFDNMKKDKMANYSTAPVMDFKIS-PFMRKGKVGDWKNHFTVAQNEAFDEDYKKKMTDPTLQFRTE 329          
BLAST of Sulfotransferase vs. Ensembl Medaka
Match: sult2st3 (sulfotransferase family cytosolic 2B member 1 [Source:NCBI gene;Acc:110016637])

HSP 1 Score: 144.05 bits (362), Expect = 2.825e-40
Identity = 91/277 (32.85%), Postives = 145/277 (52.35%), Query Frame = 2
Query:  194 RIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAV---DYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV---FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQY 1006
            +  ++ KF  DD++  T+PKSGTT ++EI+ LVL+  DL   +    + R+P+++E             LA +++DK   PR + +H P  NL      +S  K I VMRNPKD AVS ++F+  A    D G +    D F +++++G +  G W +    W L +    +  + YE+++++   +I+ I  F  +DLS   I KI  H  F+SM+AN M+N+  V   +   +   F+RKG  GDWKN F+  Q     +     LE  GL F +
Sbjct:   27 KFAQDFKFKDDDVVAVTYPKSGTTWMQEILPLVLSGGDLTPIQSTVNWDRVPWLEET-----------RLA-NVVDKMTSPRAMVSHFPY-NLMPSSFHSSKAKVIYVMRNPKDVAVSSFYFHQMASFLEDPGTF----DEFLDKFLEGRVLFGKWTDHVSSWKLAKLGERILFLTYEEMVQDLGAAIRRISDFLCLDLSEDIIQKIAEHCTFKSMKANTMSNFSLVPKKYMDSDKSPFLRKGVAGDWKNHFNSEQEARFTSVIQKELEAAGLSFPF 286          
BLAST of Sulfotransferase vs. Ensembl Medaka
Match: sult2st3 (sulfotransferase family cytosolic 2B member 1 [Source:NCBI gene;Acc:110016637])

HSP 1 Score: 140.198 bits (352), Expect = 8.234e-39
Identity = 89/268 (33.21%), Postives = 141/268 (52.61%), Query Frame = 2
Query:  221 SDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAV---DYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENV---FGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQY 1006
            +DD++  T+PKSGTT ++EI+ LVL+  DL   +    + R+P+++E             LA +++DK   PR + +H P  NL      +S  K I VMRNPKD AVS ++F+  A    D G +    D F +++++G +  G W +    W L +    +  + YE+++++   +I+ I  F  +DLS   I KI  H  F+SM+AN M+N+  V   +   +   F+RKG  GDWKN F+  Q     +     LE  GL F +
Sbjct:   35 NDDVVAVTYPKSGTTWMQEILPLVLSGGDLTPIQSTVNWDRVPWLEET-----------RLA-NVVDKMTSPRAMVSHFPY-NLMPSSFHSSKAKVIYVMRNPKDVAVSSFYFHQMASFLEDPGTF----DEFLDKFLEGRVLFGKWTDHVSSWKLAKLGERILFLTYEEMVQDLGAAIRRISDFLCLDLSEDIIQKIAEHCTFKSMKANTMSNFSLVPKKYMDSDKSPFLRKGVAGDWKNHFNSEQEARFTSVIQKELEAAGLSFPF 285          
BLAST of Sulfotransferase vs. Planmine SMEST
Match: SMESG000026463.1 (SMESG000026463.1)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 299/303 (98.68%), Postives = 302/303 (99.67%), Query Frame = 2
Query:  101 MEMTSKYSPLPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            MEMTSKYSPLPGEFVYKNIYWVLWSSCDIIKRIEEEM+FFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKA+QLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLD NSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNK+DSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE
Sbjct:    1 MEMTSKYSPLPGEFVYKNIYWVLWSSCDIIKRIEEEMEFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKARQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDSNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKYDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 303          
BLAST of Sulfotransferase vs. Planmine SMEST
Match: SMESG000043528.1 (SMESG000043528.1)

HSP 1 Score: 332.798 bits (852), Expect = 2.273e-113
Identity = 160/318 (50.31%), Postives = 225/318 (70.75%), Query Frame = 2
Query:   68 NQIILKVILFKMEMTSKYSPLPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFG----FEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            NQ  +K++  +  +  KY  LPGEF+YKN  W LWSS DIIK+IE E  F+ DD+L+AT+PKSGTT+L++IVWL++N+ D+ +AK   +  R PFIDEN  H+F  + G    ++     PRPR++KTHL   NL  +++ N  MK ++ +RNPKD AVSM+HFY G  DYGP+   WD+FF RWIDGWISGGDWL+VT  WW  R+R N+KI+F+EDLI  K + I+++C F   +L+  QI++I+ HTEF +M++NP  NY  + G    F  +F FMRKG++GDWKN+F++ Q+K L+ K N +LE+ GL+F+YE
Sbjct:    2 NQNDIKIV--EDRINPKYEKLPGEFIYKNSNWGLWSSLDIIKKIENEFVFYPDDVLIATYPKSGTTVLQQIVWLIMNNVDVGQAKSRSVIKRCPFIDENLEHDFDFYKG--FIVNGGPLIPRPRLMKTHLAFQNLENQINKNPEMKILVTIRNPKDNAVSMFHFYKGVSDYGPFEGSWDDFFERWIDGWISGGDWLDVTTAWWNVRFRKNIKIVFFEDLIFKKKEVIRDLCEFLNKNLTECQIDQIVEHTEFRAMKSNPGVNYNLMPGSQWWFRNNFQFMRKGEVGDWKNYFTEEQSKRLDAKNNRVLEECGLKFRYE 315          
BLAST of Sulfotransferase vs. Planmine SMEST
Match: SMESG000046103.1 (SMESG000046103.1)

HSP 1 Score: 149.828 bits (377), Expect = 2.025e-42
Identity = 90/285 (31.58%), Postives = 162/285 (56.84%), Query Frame = 2
Query:  113 SKYSPLPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADL-VKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENK 964
            + Y     EF YK + +  +S+ +I+  + +  +F   DI+++TFP+SGTT  +EI+W + N   + +  K   IFLR PF++ N+   FP      + I    +    R++KTH+P   ++   +     K I+VMR+PKD  VS Y+ Y G   +G ++  +D FF  +++G  + G + +   +WW  R++ N+ I+FYED++ N  +++ +I +F   +L+ ++++KI+ ++ F +M  N   N      F+    F+RKG IGDWKN FS+ Q++ ++ K
Sbjct:    4 TDYRHCDNEFSYKEVQFHGYSTPEILDGVCQ-FEFLPTDIVLSTFPRSGTTFTQEIIWQIKNRKFIHLDEKIENIFLRFPFLEFNHE-AFPIIPDSFINILNRQRKSEYRLIKTHVPFKFIKENFE-KPNPKMIVVMRSPKDCLVSNYYHYIGVPFHG-WKGTFDEFFPIFLNGKTASGCYFDNNLEWWALRHQKNILILFYEDILNNLKENVLKIATFMGDELTEEELHKIVHNSTFSTMYNNSKMN----ISFDGKHKFIRKGVIGDWKNHFSNEQSQLIDEK 280          
BLAST of Sulfotransferase vs. Planmine SMEST
Match: SMESG000046092.1 (SMESG000046092.1)

HSP 1 Score: 143.28 bits (360), Expect = 5.648e-40
Identity = 89/298 (29.87%), Postives = 160/298 (53.69%), Query Frame = 2
Query:  119 YSPLPGEFVYKNIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLNDADLVKAK-QLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            Y     EF Y+   +  +++  ++  + +  +F   DIL  TFP+ GTTL+ EI+W + N  ++ K K +  I LR PF++ NY ++   ++   + +  + K    R++KTH+P   ++   +     K +IV+RNPKD  VS ++FY   +    +   + +FF+ +++G    G + +   + W  R + N+ I+FYED+++N  +++ +I  F    L+ ++++ I+ +  F +M  NP  N +     ++ F F+RKG IGDWKN FS+ QN+ L  K         L F YE
Sbjct:    6 YIKCGNEFSYQGRQFNGYTTSSLLDEVSK-FEFLPTDILTLTFPRCGTTLINEIIWHIKNHKEISKNKIREDITLRFPFLEYNYEYD-KEYEMSFIRMLNLKKNNPFRLIKTHVPYEFIKGNFE-KVHPKMVIVLRNPKDCLVSNFYFYL-KMSVHEWHGTFGDFFHLFLNGKTFTGSYFDNILECWSLRNQKNVLILFYEDIVRNMGENVTKIVDFLNETLTVEELDIILHNCSFSTMSQNPNINVK----IDDEFSFLRKGVIGDWKNHFSEEQNRLLNLKIEEEFRGSDLSFIYE 295          
BLAST of Sulfotransferase vs. Planmine SMEST
Match: SMESG000048694.1 (SMESG000048694.1)

HSP 1 Score: 107.457 bits (267), Expect = 4.083e-27
Identity = 70/228 (30.70%), Postives = 120/228 (52.63%), Query Frame = 2
Query:  341 RIPFIDENYTHEFPGFDGKNLAIDIID--KWPRPRILKTHLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGWDNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYE--DLIKNKFDSIKEICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYE-NVFGFEESFCFMRKGKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE 1009
            R PF++  +  +F G D     ID+++  +  R R++KTH P++ +R  L   S  K I+V RNP+D  VS++HFYCG   +GP+   W+ F   +  G+   G W     DW  E     +K   ++   L+K     I+ I  F    L+ +Q++ I+ ++ F+ M  +   N E ++ GF     F+R+G+IG+WKN+F + Q    +       + +G++F+YE
Sbjct:   14 RFPFLE--FNSKFYGIDVP-YPIDVLETKQNDRYRLIKTHCPLNYIRPNL-LESLPKCIVVFRNPRDVCVSLFHFYCGMKLFGPWPGTWEEFLEMFQRGYTKCGSWAGWNSDWLQEIGIEKMKRFHHKLPMLLKKPKIVIESIAEFLDESLTDEQMDIILHNSNFKQMSLDDNLNVEDDITGFR----FLRQGQIGNWKNYFKEQQLITFQKLVEKQTDDLGIQFEYE 233          
The following BLAST results are available for this feature:
BLAST of Sulfotransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SULT1A25.540e-5136.84sulfotransferase family 1A member 2 [Source:HGNC S... [more]
SULT1A25.540e-5136.84sulfotransferase family 1A member 2 [Source:HGNC S... [more]
SULT1A15.479e-5036.84sulfotransferase family 1A member 1 [Source:HGNC S... [more]
SULT1A15.479e-5036.84sulfotransferase family 1A member 1 [Source:HGNC S... [more]
SULT1A15.479e-5036.84sulfotransferase family 1A member 1 [Source:HGNC S... [more]
back to top
BLAST of Sulfotransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ssu-11.537e-1725.38Suppressor of Stomatin mutant Uncoordination [Sou... [more]
back to top
BLAST of Sulfotransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
St11.092e-3233.06gene:FBgn0034887 transcript:FBtr0114541[more]
St29.736e-2827.00gene:FBgn0037665 transcript:FBtr0081974[more]
St29.736e-2827.00gene:FBgn0037665 transcript:FBtr0346096[more]
St31.078e-2326.18gene:FBgn0265052 transcript:FBtr0336679[more]
St32.088e-2326.18gene:FBgn0265052 transcript:FBtr0336678[more]
back to top
BLAST of Sulfotransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sult1st55.478e-5336.00sulfotransferase family 1, cytosolic sulfotransfer... [more]
sult1st56.096e-5336.00sulfotransferase family 1, cytosolic sulfotransfer... [more]
sult1st71.347e-4134.18sulfotransferase family 1, cytosolic sulfotransfer... [more]
sult1st67.902e-4132.83sulfotransferase family 1, cytosolic sulfotransfer... [more]
sult1st22.843e-3933.21sulfotransferase family 1, cytosolic sulfotransfer... [more]
back to top
BLAST of Sulfotransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000011235.16.718e-5134.64uncharacterized LOC100145082 [Source:NCBI gene;Acc... [more]
ENSXETT00000006330.11.185e-5036.01uncharacterized LOC100145082 [Source:NCBI gene;Acc... [more]
ENSXETT00000005832.11.185e-5036.01uncharacterized LOC100145082 [Source:NCBI gene;Acc... [more]
ENSXETT00000006355.11.307e-5036.01uncharacterized LOC100145082 [Source:NCBI gene;Acc... [more]
ENSXETT00000006135.14.534e-4933.77uncharacterized LOC100145082 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Sulfotransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sult1d11.994e-4837.31sulfotransferase family 1D, member 1 [Source:MGI S... [more]
Sult1b11.439e-4634.94sulfotransferase family 1B, member 1 [Source:MGI S... [more]
Sult1b11.439e-4634.94sulfotransferase family 1B, member 1 [Source:MGI S... [more]
Sult1b11.439e-4634.94sulfotransferase family 1B, member 1 [Source:MGI S... [more]
Sult1c23.246e-4636.60sulfotransferase family, cytosolic, 1C, member 2 [... [more]
back to top
BLAST of Sulfotransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50226|ST1A2_HUMAN2.660e-5036.84Sulfotransferase 1A2 OS=Homo sapiens OX=9606 GN=SU... [more]
sp|P50225|ST1A1_HUMAN2.631e-4936.84Sulfotransferase 1A1 OS=Homo sapiens OX=9606 GN=SU... [more]
sp|P50227|ST1A1_BOVIN1.007e-4835.29Sulfotransferase 1A1 OS=Bos taurus OX=9913 GN=SULT... [more]
sp|O43704|ST1B1_HUMAN1.917e-4834.51Sulfotransferase family cytosolic 1B member 1 OS=H... [more]
sp|Q29476|ST1A1_CANLF1.969e-4835.09Sulfotransferase 1A1 OS=Canis lupus familiaris OX=... [more]
back to top
BLAST of Sulfotransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H2X74.402e-7941.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H4566.318e-7438.36Sulfotransfer_1 domain-containing protein OS=Macro... [more]
A0A2H1CAB81.723e-6737.97Aryl sulfotransferase OS=Fasciola hepatica OX=6192... [more]
A0A504YZ841.019e-6637.66Aryl sulfotransferase OS=Fasciola gigantica OX=468... [more]
A0A4S2LX021.466e-6537.93Sulfotransfer_1 domain-containing protein OS=Opist... [more]
back to top
BLAST of Sulfotransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039560.13.910e-4333.97sulfotransferase 1C1-like [Source:NCBI gene;Acc:10... [more]
sult1st51.847e-4232.50sulfotransferase 1C4-like [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000047219.11.769e-4035.07cytosolic sulfotransferase 3-like [Source:NCBI gen... [more]
ENSAMXT00000034992.18.710e-3832.84cytosolic sulfotransferase 3-like [Source:NCBI gen... [more]
sult1st69.992e-3831.68sulfotransferase 1C1-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Sulfotransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005805.18.799e-3531.94pep scaffold:Pmarinus_7.0:GL481881:4266:17404:1 ge... [more]
ENSPMAT00000001221.15.085e-3433.98pep scaffold:Pmarinus_7.0:GL482898:21441:26832:1 g... [more]
sult4a14.524e-3027.84sulfotransferase family 4A, member 1 [Source:ZFIN;... [more]
ENSPMAT00000007474.11.936e-2835.50pep scaffold:Pmarinus_7.0:GL483169:4853:11483:-1 g... [more]
ENSPMAT00000002055.16.627e-1935.96pep scaffold:Pmarinus_7.0:GL480009:3682:6562:1 gen... [more]
back to top
BLAST of Sulfotransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sulfotransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407692.531e-4632.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407681.225e-4533.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468409.352e-4334.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472931.346e-4031.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498741.420e-3629.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sulfotransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sult1st61.082e-4133.58sulfotransferase family 1A member 4 [Source:NCBI g... [more]
sult1st99.247e-4134.70cytosolic sulfotransferase 1 [Source:NCBI gene;Acc... [more]
sult1st92.086e-4034.55cytosolic sulfotransferase 1 [Source:NCBI gene;Acc... [more]
sult2st32.825e-4032.85sulfotransferase family cytosolic 2B member 1 [Sou... [more]
sult2st38.234e-3933.21sulfotransferase family cytosolic 2B member 1 [Sou... [more]
back to top
BLAST of Sulfotransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026463.10.000e+098.68SMESG000026463.1[more]
SMESG000043528.12.273e-11350.31SMESG000043528.1[more]
SMESG000046103.12.025e-4231.58SMESG000046103.1[more]
SMESG000046092.15.648e-4029.87SMESG000046092.1[more]
SMESG000048694.14.083e-2730.70SMESG000048694.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019797 ID=SMED30019797|Name=Sulfotransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1068bp
TGAGACTCTAGATAATGAAGTTATCTTGTTTCCGGAAATGTTGTTTCCTA
TTTTGGTTTCATATAAAAACCAAATTATTTTAAAAGTTATTTTATTTAAA
ATGGAAATGACATCCAAATATTCGCCTTTACCTGGGGAATTTGTTTATAA
GAATATTTATTGGGTTTTGTGGTCTTCATGTGATATTATAAAGAGAATCG
AAGAGGAAATGAAATTTTTCTCAGATGACATTTTAGTCGCAACTTTTCCA
AAGTCCGGTACGACATTGCTGGAAGAAATTGTATGGCTGGTTCTCAATGA
TGCAGATTTGGTTAAAGCAAAACAATTAAAAATATTTTTGAGAATACCTT
TCATTGATGAGAATTATACGCATGAGTTTCCTGGGTTTGACGGGAAAAAT
TTAGCCATTGACATTATTGATAAATGGCCCCGACCAAGGATTTTGAAAAC
CCATTTGCCAGTTTCCAATCTTAGGTGTCGTCTTGACTGTAATTCCGGAA
TGAAAACAATTATTGTTATGAGGAATCCAAAAGACACTGCTGTATCTATG
TATCATTTTTATTGTGGAGCAGTTGATTATGGACCTTATCGAGAAGGTTG
GGATAATTTCTTCAATAGATGGATAGATGGCTGGATTTCTGGCGGTGATT
GGCTTGAGGTTACCAAAGATTGGTGGTTAGAAAGATACAGACCGAATTTA
AAAATCATGTTTTATGAAGACCTTATTAAAAATAAATTTGACAGTATTAA
AGAAATTTGTAGTTTTTTTCAAGTTGATTTATCTACACAGCAAATTAATA
AAATTATTGTCCACACCGAATTCGAAAGTATGAGAGCAAACCCCATGACA
AATTATGAAAATGTTTTTGGGTTTGAGGAGTCATTTTGCTTCATGAGGAA
AGGAAAAATTGGAGACTGGAAAAACTGGTTCAGTGACGCTCAGAATAAGG
CACTTGAAAATAAATATAATCCAATTCTTGAACAGATCGGACTTGAATTT
CAATACGAATGATCTTTTATCATTTATACTTCAATAAATCTTATTATTGT
AAAAAAAAGATCGGAAGA
back to top

protein sequence of SMED30019797-orf-1

>SMED30019797-orf-1 ID=SMED30019797-orf-1|Name=SMED30019797-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=337bp
ETLDNEVILFPEMLFPILVSYKNQIILKVILFKMEMTSKYSPLPGEFVYK
NIYWVLWSSCDIIKRIEEEMKFFSDDILVATFPKSGTTLLEEIVWLVLND
ADLVKAKQLKIFLRIPFIDENYTHEFPGFDGKNLAIDIIDKWPRPRILKT
HLPVSNLRCRLDCNSGMKTIIVMRNPKDTAVSMYHFYCGAVDYGPYREGW
DNFFNRWIDGWISGGDWLEVTKDWWLERYRPNLKIMFYEDLIKNKFDSIK
EICSFFQVDLSTQQINKIIVHTEFESMRANPMTNYENVFGFEESFCFMRK
GKIGDWKNWFSDAQNKALENKYNPILEQIGLEFQYE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000863Sulfotransferase_dom
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0008146sulfotransferase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000863Sulfotransferase domainPFAMPF00685Sulfotransfer_1coord: 75..328
e-value: 9.7E-53
score: 179.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 35..335
e-value: 2.5E-77
score: 262.5
NoneNo IPR availablePANTHERPTHR11783SULFOTRANSFERASE SULTcoord: 70..336
NoneNo IPR availablePANTHERPTHR11783:SF73SULFOTRANSFERASE 1C2coord: 70..336
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 47..335