Disks large-associated protein

Overview
NameDisks large-associated protein
Smed IDSMED30019794
Length (bp)2537
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Disks large-associated protein (SMED30019794) t-SNE clustered cells

Violin plots show distribution of expression levels for Disks large-associated protein (SMED30019794) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Disks large-associated protein (SMED30019794) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Disks large-associated protein (SMED30019794) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019794

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30019794SMESG000005404.1 dd_Smed_v4_5253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019794SMESG000005404.1 dd_Smed_v6_5253_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Disks large-associated protein vs. Ensembl Human
Match: DLGAP4 (DLG associated protein 4 [Source:HGNC Symbol;Acc:HGNC:24476])

HSP 1 Score: 76.2554 bits (186), Expect = 1.034e-14
Identity = 42/141 (29.79%), Postives = 74/141 (52.48%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNK 2274
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++    + K+ + +
Sbjct:  109 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLVETPEKRKVSMEQ 231          
BLAST of Disks large-associated protein vs. Ensembl Human
Match: DLGAP4 (DLG associated protein 4 [Source:HGNC Symbol;Acc:HGNC:24476])

HSP 1 Score: 77.0258 bits (188), Expect = 1.129e-14
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++
Sbjct:   96 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLV 206          
BLAST of Disks large-associated protein vs. Ensembl Human
Match: DLGAP4 (DLG associated protein 4 [Source:HGNC Symbol;Acc:HGNC:24476])

HSP 1 Score: 78.1814 bits (191), Expect = 2.315e-14
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++
Sbjct:  264 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLV 374          
BLAST of Disks large-associated protein vs. Ensembl Human
Match: DLGAP4 (DLG associated protein 4 [Source:HGNC Symbol;Acc:HGNC:24476])

HSP 1 Score: 78.1814 bits (191), Expect = 5.202e-14
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++
Sbjct:  803 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLV 913          
BLAST of Disks large-associated protein vs. Ensembl Human
Match: DLGAP4 (DLG associated protein 4 [Source:HGNC Symbol;Acc:HGNC:24476])

HSP 1 Score: 78.1814 bits (191), Expect = 5.202e-14
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++
Sbjct:  803 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLV 913          
BLAST of Disks large-associated protein vs. Ensembl Celegans
Match: W03A5.6 (pep chromosome:WBcel235:III:5431407:5434467:-1 gene:WBGene00020970.1 transcript:W03A5.6c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W03A5.6)

HSP 1 Score: 50.8322 bits (120), Expect = 2.441e-6
Identity = 50/198 (25.25%), Postives = 92/198 (46.46%), Query Frame = 1
Query: 1870 GTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKI--VLNKPPV--RSKRSTASSGTP--KNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNS-DP 2442
            G  F  L  K + ++Q K++     L+  + ++ ++ S  L    G A LL+ +K  +F  L  +N+    +D          +   + DL GFW  +  +++ I K F  VE+ R  NW     + E +I    N+PP+  +++  TA    P      +KK++    Q+  AE+R+  M+ ++ Q    ++N  DP
Sbjct:  117 GHEFQLLHDKVKAQLQTKMNAASTDLEHAD-DYPEKCSDSLRAAHGNAHLLVRKKFSKFNELIGKNLNPIADDP---------MPVTVQDLEGFWVTIDMELKGILKEFTKVEQYRAANWDPSAVKEEEEIDSTTNRPPIAPKTRPVTAKKKAPIVSEETRKKLAE---QKALAEQRRAEMRAQILQNRKAAKNQEDP 301          
BLAST of Disks large-associated protein vs. Ensembl Celegans
Match: W03A5.6 (pep chromosome:WBcel235:III:5431407:5434249:-1 gene:WBGene00020970.1 transcript:W03A5.6c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W03A5.6)

HSP 1 Score: 50.8322 bits (120), Expect = 2.441e-6
Identity = 50/198 (25.25%), Postives = 92/198 (46.46%), Query Frame = 1
Query: 1870 GTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKI--VLNKPPV--RSKRSTASSGTP--KNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNS-DP 2442
            G  F  L  K + ++Q K++     L+  + ++ ++ S  L    G A LL+ +K  +F  L  +N+    +D          +   + DL GFW  +  +++ I K F  VE+ R  NW     + E +I    N+PP+  +++  TA    P      +KK++    Q+  AE+R+  M+ ++ Q    ++N  DP
Sbjct:  117 GHEFQLLHDKVKAQLQTKMNAASTDLEHAD-DYPEKCSDSLRAAHGNAHLLVRKKFSKFNELIGKNLNPIADDP---------MPVTVQDLEGFWVTIDMELKGILKEFTKVEQYRAANWDPSAVKEEEEIDSTTNRPPIAPKTRPVTAKKKAPIVSEETRKKLAE---QKALAEQRRAEMRAQILQNRKAAKNQEDP 301          
BLAST of Disks large-associated protein vs. Ensembl Celegans
Match: W03A5.6 (pep chromosome:WBcel235:III:5431407:5440634:-1 gene:WBGene00020970.1 transcript:W03A5.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W03A5.6)

HSP 1 Score: 51.2174 bits (121), Expect = 2.723e-6
Identity = 49/199 (24.62%), Postives = 93/199 (46.73%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKI--VLNKPPV--RSKRSTASSGTP--KNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNS-DP 2442
            +G  F  L  K + ++Q K++     L+  + ++ ++ S  L    G A LL+ +K  +F  L  +N+             ++ +   + DL GFW  +  +++ I K F  VE+ R  NW     + E +I    N+PP+  +++  TA    P      +KK++    Q+  AE+R+  M+ ++ Q    ++N  DP
Sbjct:  419 NGHEFQLLHDKVKAQLQTKMNAASTDLEHAD-DYPEKCSDSLRAAHGNAHLLVRKKFSKFNELIGKNL---------NPIADDPMPVTVQDLEGFWVTIDMELKGILKEFTKVEQYRAANWDPSAVKEEEEIDSTTNRPPIAPKTRPVTAKKKAPIVSEETRKKLAE---QKALAEQRRAEMRAQILQNRKAAKNQEDP 604          
BLAST of Disks large-associated protein vs. Ensembl Celegans
Match: W03A5.6 (pep chromosome:WBcel235:III:5431407:5440632:-1 gene:WBGene00020970.1 transcript:W03A5.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W03A5.6)

HSP 1 Score: 51.2174 bits (121), Expect = 3.118e-6
Identity = 49/199 (24.62%), Postives = 93/199 (46.73%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKI--VLNKPPV--RSKRSTASSGTP--KNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNS-DP 2442
            +G  F  L  K + ++Q K++     L+  + ++ ++ S  L    G A LL+ +K  +F  L  +N+             ++ +   + DL GFW  +  +++ I K F  VE+ R  NW     + E +I    N+PP+  +++  TA    P      +KK++    Q+  AE+R+  M+ ++ Q    ++N  DP
Sbjct:  417 NGHEFQLLHDKVKAQLQTKMNAASTDLEHAD-DYPEKCSDSLRAAHGNAHLLVRKKFSKFNELIGKNL---------NPIADDPMPVTVQDLEGFWVTIDMELKGILKEFTKVEQYRAANWDPSAVKEEEEIDSTTNRPPIAPKTRPVTAKKKAPIVSEETRKKLAE---QKALAEQRRAEMRAQILQNRKAAKNQEDP 602          
BLAST of Disks large-associated protein vs. Ensembl Fly
Match: vlc (gene:FBgn0259978 transcript:FBtr0307532)

HSP 1 Score: 86.6557 bits (213), Expect = 3.359e-17
Identity = 44/127 (34.65%), Postives = 72/127 (56.69%), Query Frame = 1
Query: 1861 IIDGTYFLNLVYKHEGEIQKKIDLVQGYLDA--ENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKM 2235
            + DG +FL ++ + +  +     L + Y DA   N +  ++  G L    GKA+LL+S+K+ QF+GLC  N+           + E+K  T L DL GFWDMV+ Q+E ++  F  +EK++ N+WK+
Sbjct:  380 VKDGNFFLKILKEEQSRLLVLAALAEKYADALSTNPDISEDTFGLLRSASGKARLLVSQKMKQFEGLCHNNL---------NRSPEDKFPTTLDDLQGFWDMVYLQVEHVDSIFADIEKLKSNDWKV 497          
BLAST of Disks large-associated protein vs. Ensembl Fly
Match: vlc (gene:FBgn0259978 transcript:FBtr0086041)

HSP 1 Score: 86.6557 bits (213), Expect = 3.359e-17
Identity = 44/127 (34.65%), Postives = 72/127 (56.69%), Query Frame = 1
Query: 1861 IIDGTYFLNLVYKHEGEIQKKIDLVQGYLDA--ENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKM 2235
            + DG +FL ++ + +  +     L + Y DA   N +  ++  G L    GKA+LL+S+K+ QF+GLC  N+           + E+K  T L DL GFWDMV+ Q+E ++  F  +EK++ N+WK+
Sbjct:  380 VKDGNFFLKILKEEQSRLLVLAALAEKYADALSTNPDISEDTFGLLRSASGKARLLVSQKMKQFEGLCHNNL---------NRSPEDKFPTTLDDLQGFWDMVYLQVEHVDSIFADIEKLKSNDWKV 497          
BLAST of Disks large-associated protein vs. Ensembl Fly
Match: vlc (gene:FBgn0259978 transcript:FBtr0300502)

HSP 1 Score: 86.6557 bits (213), Expect = 3.359e-17
Identity = 44/127 (34.65%), Postives = 72/127 (56.69%), Query Frame = 1
Query: 1861 IIDGTYFLNLVYKHEGEIQKKIDLVQGYLDA--ENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKM 2235
            + DG +FL ++ + +  +     L + Y DA   N +  ++  G L    GKA+LL+S+K+ QF+GLC  N+           + E+K  T L DL GFWDMV+ Q+E ++  F  +EK++ N+WK+
Sbjct:  380 VKDGNFFLKILKEEQSRLLVLAALAEKYADALSTNPDISEDTFGLLRSASGKARLLVSQKMKQFEGLCHNNL---------NRSPEDKFPTTLDDLQGFWDMVYLQVEHVDSIFADIEKLKSNDWKV 497          
BLAST of Disks large-associated protein vs. Ensembl Fly
Match: vlc (gene:FBgn0259978 transcript:FBtr0086039)

HSP 1 Score: 86.6557 bits (213), Expect = 3.359e-17
Identity = 44/127 (34.65%), Postives = 72/127 (56.69%), Query Frame = 1
Query: 1861 IIDGTYFLNLVYKHEGEIQKKIDLVQGYLDA--ENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKM 2235
            + DG +FL ++ + +  +     L + Y DA   N +  ++  G L    GKA+LL+S+K+ QF+GLC  N+           + E+K  T L DL GFWDMV+ Q+E ++  F  +EK++ N+WK+
Sbjct:  380 VKDGNFFLKILKEEQSRLLVLAALAEKYADALSTNPDISEDTFGLLRSASGKARLLVSQKMKQFEGLCHNNL---------NRSPEDKFPTTLDDLQGFWDMVYLQVEHVDSIFADIEKLKSNDWKV 497          
BLAST of Disks large-associated protein vs. Ensembl Fly
Match: vlc (gene:FBgn0259978 transcript:FBtr0300503)

HSP 1 Score: 86.6557 bits (213), Expect = 3.359e-17
Identity = 44/127 (34.65%), Postives = 72/127 (56.69%), Query Frame = 1
Query: 1861 IIDGTYFLNLVYKHEGEIQKKIDLVQGYLDA--ENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKM 2235
            + DG +FL ++ + +  +     L + Y DA   N +  ++  G L    GKA+LL+S+K+ QF+GLC  N+           + E+K  T L DL GFWDMV+ Q+E ++  F  +EK++ N+WK+
Sbjct:  380 VKDGNFFLKILKEEQSRLLVLAALAEKYADALSTNPDISEDTFGLLRSASGKARLLVSQKMKQFEGLCHNNL---------NRSPEDKFPTTLDDLQGFWDMVYLQVEHVDSIFADIEKLKSNDWKV 497          
BLAST of Disks large-associated protein vs. Ensembl Zebrafish
Match: dlgap4b (discs, large (Drosophila) homolog-associated protein 4b [Source:ZFIN;Acc:ZDB-GENE-101215-2])

HSP 1 Score: 86.6557 bits (213), Expect = 3.103e-17
Identity = 62/204 (30.39%), Postives = 99/204 (48.53%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKM---IPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG +FL L+    G ++      Q   +       +EV G++   +G A+LL+++K  QF+GLCE+N+  +              R    DL GFWD++   IEDI+  F  +  ++ N+WK+    P + E++     PPV  K      G  K T  ++ S+ESV +   E RK +M  K +Q  S+ QNS    ++ I  Y
Sbjct:  290 DGHWFLKLLQAETGRMEGWC--CQMEKETTEHQLSEEVLGKVRSAVGSAQLLMNQKFQQFRGLCEQNLNVNANP-----------RPTAQDLAGFWDLLQLSIEDISLKFDELYHLKSNDWKLNGESPEKQENQK--QAPPVPKK-----PGKSKPTLGREKSTESVDKQRQEARKRLMAAKRAQ--SVKQNSATESADSIEIY 471          
BLAST of Disks large-associated protein vs. Ensembl Zebrafish
Match: dlgap4b (discs, large (Drosophila) homolog-associated protein 4b [Source:ZFIN;Acc:ZDB-GENE-101215-2])

HSP 1 Score: 85.5001 bits (210), Expect = 1.645e-16
Identity = 62/204 (30.39%), Postives = 99/204 (48.53%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKM---IPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG +FL L+    G ++      Q   +       +EV G++   +G A+LL+++K  QF+GLCE+N+  +              R    DL GFWD++   IEDI+  F  +  ++ N+WK+    P + E++     PPV  K      G  K T  ++ S+ESV +   E RK +M  K +Q  S+ QNS    ++ I  Y
Sbjct:  753 DGHWFLKLLQAETGRMEGWC--CQMEKETTEHQLSEEVLGKVRSAVGSAQLLMNQKFQQFRGLCEQNLNVNANP-----------RPTAQDLAGFWDLLQLSIEDISLKFDELYHLKSNDWKLNGESPEKQENQK--QAPPVPKK-----PGKSKPTLGREKSTESVDKQRQEARKRLMAAKRAQ--SVKQNSATESADSIEIY 934          
BLAST of Disks large-associated protein vs. Ensembl Zebrafish
Match: AL928723.1 (discs, large (Drosophila) homolog-associated protein 2a [Source:NCBI gene;Acc:557621])

HSP 1 Score: 83.1889 bits (204), Expect = 9.548e-16
Identity = 57/205 (27.80%), Postives = 101/205 (49.27%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQI----NAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG++F+ L++    +++     ++G  +AE  +  +E+ G++   +G A+LL+S+K  QF  LC++N+  S              R    DL GFWD++   I+D+   F  ++KI+ N+W++I  ++  K V   PPV           PK T +K V+ E    +      E R+ +M  K  + +S  QNS    ++ I  Y
Sbjct:  810 DGSWFMQLLHTETKKMEGWCKELEG--EAEENDLSEEILGKIRSAVGSAQLLMSQKFQQFYWLCQQNLDPSAMP-----------RPTSQDLAGFWDLLQLSIDDVTSKFNELQKIKSNDWRLI--DSPVKKVRLPPPV-----------PKKTLRKSVTREKSLDLPDRQRIEARRRLMAAK--RAASFRQNSASERADSIEIY 986          
BLAST of Disks large-associated protein vs. Ensembl Zebrafish
Match: AL928723.1 (discs, large (Drosophila) homolog-associated protein 2a [Source:NCBI gene;Acc:557621])

HSP 1 Score: 82.8037 bits (203), Expect = 1.006e-15
Identity = 57/205 (27.80%), Postives = 101/205 (49.27%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQI----NAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG++F+ L++    +++     ++G  +AE  +  +E+ G++   +G A+LL+S+K  QF  LC++N+  S              R    DL GFWD++   I+D+   F  ++KI+ N+W++I  ++  K V   PPV           PK T +K V+ E    +      E R+ +M  K  + +S  QNS    ++ I  Y
Sbjct:  846 DGSWFMQLLHTETKKMEGWCKELEG--EAEENDLSEEILGKIRSAVGSAQLLMSQKFQQFYWLCQQNLDPSAMP-----------RPTSQDLAGFWDLLQLSIDDVTSKFNELQKIKSNDWRLI--DSPVKKVRLPPPV-----------PKKTLRKSVTREKSLDLPDRQRIEARRRLMAAK--RAASFRQNSASERADSIEIY 1022          
BLAST of Disks large-associated protein vs. Ensembl Zebrafish
Match: AL928723.1 (discs, large (Drosophila) homolog-associated protein 2a [Source:NCBI gene;Acc:557621])

HSP 1 Score: 82.8037 bits (203), Expect = 1.025e-15
Identity = 57/205 (27.80%), Postives = 101/205 (49.27%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQI----NAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG++F+ L++    +++     ++G  +AE  +  +E+ G++   +G A+LL+S+K  QF  LC++N+  S              R    DL GFWD++   I+D+   F  ++KI+ N+W++I  ++  K V   PPV           PK T +K V+ E    +      E R+ +M  K  + +S  QNS    ++ I  Y
Sbjct:  831 DGSWFMQLLHTETKKMEGWCKELEG--EAEENDLSEEILGKIRSAVGSAQLLMSQKFQQFYWLCQQNLDPSAMP-----------RPTSQDLAGFWDLLQLSIDDVTSKFNELQKIKSNDWRLI--DSPVKKVRLPPPV-----------PKKTLRKSVTREKSLDLPDRQRIEARRRLMAAK--RAASFRQNSASERADSIEIY 1007          
BLAST of Disks large-associated protein vs. Ensembl Xenopus
Match: map3k8 (mitogen-activated protein kinase kinase kinase 8 [Source:Xenbase;Acc:XB-GENE-958505])

HSP 1 Score: 73.9442 bits (180), Expect = 9.504e-13
Identity = 39/128 (30.47%), Postives = 68/128 (53.12%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYL-----DAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKM 2235
            DG +FL L       +Q + + ++G+      +  + N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+  ++             R    DL GFWD++   IEDI+  F  + +++ N W +
Sbjct:  881 DGHWFLKL-------LQAETERLEGWCRQMQRETADNNLCEEVIGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPNSNP-----------RPSAQDLAGFWDLLQLSIEDISMKFDELFQLKANGWAL 990          
BLAST of Disks large-associated protein vs. Ensembl Xenopus
Match: utp18 (UTP18 small subunit processome component [Source:Xenbase;Acc:XB-GENE-981919])

HSP 1 Score: 72.4034 bits (176), Expect = 2.924e-12
Identity = 58/208 (27.88%), Postives = 96/208 (46.15%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYL------DAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPK-KKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG +FL L       +Q + D ++G+       + EN +  D +  ++   +G A+LL+S+K  QF+ LCEEN+  +              R    DL GFWDM+   IE+I+  F  + +++ NNWK +         L+K   R+        +    P  +  S ES ++   E RK +M  K  + +S+ QNS    ++ I  Y
Sbjct:  793 DGHWFLKL-------LQAEKDRMEGWCQQMKREEHEN-DLPDPILDKIRSAVGCAQLLMSQKFYQFRELCEENLNPNAHP-----------RPTSQDLAGFWDMLQLSIENISMKFDELHQLKANNWKKMD-------SLDKKDKRAPPPVPKKPSKGQAPLVRDRSLESSERQRHEARKRLMSAK--RAASVRQNSATESADSIEIY 972          
BLAST of Disks large-associated protein vs. Ensembl Xenopus
Match: vps4a (vacuolar protein sorting 4 homolog A [Source:Xenbase;Acc:XB-GENE-970546])

HSP 1 Score: 68.1662 bits (165), Expect = 4.549e-11
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 1
Query: 1855 PEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI--PYENESK---IVLNKPPVRSK 2292
            P   DGT+F+ L++     +++    ++   +AE  +  +E  G++   +G A+LL+S+K  QF  LC++N+  S              R    DL GFWD++   IED++  F  + +++ N WK +  P + + K   + + K P R K
Sbjct:  781 PSRQDGTWFMKLLHAETKRMEEWCKDME--REAEENDLTEENLGKIRSAVGSAQLLMSQKFQQFYWLCQQNMDPSAMP-----------RPTSQDLAGFWDLLQLSIEDVSMKFDKLHQLKANEWKAVDSPEKKDDKKLPLPIPKKPTRGK 918          
BLAST of Disks large-associated protein vs. Ensembl Xenopus
Match: dlgap5 (discs large homolog associated protein 5 [Source:NCBI gene;Acc:407899])

HSP 1 Score: 63.1586 bits (152), Expect = 1.909e-9
Identity = 45/165 (27.27%), Postives = 77/165 (46.67%), Query Frame = 1
Query: 1774 KKSIADDVTVNDNDA----TKPIENGFKTNEPEII-----DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGL---CEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWK 2232
            +K  A DV +   DA    +  + N  K NE E       D  YF + +   + EI +   L   +     ++  ++    +  T+G+ +LL+ E+  QF+GL   CE               +  +  T  +DL+GFWDM++ QIED+ K F+ + K+  N+W+
Sbjct:  477 QKESATDVCLAPTDAPGSPSSSVSNPQKENEKEAPKEPEHDVPYFRDTL---KSEIARLKQLCCEWDKRIELDIPEDAKDLIRTTVGQTRLLMCERFKQFEGLVDNCE--------------FKRGEKETTCTDLDGFWDMIYFQIEDVGKKFINLGKMEENSWQ 624          
BLAST of Disks large-associated protein vs. Ensembl Xenopus
Match: dlgap5 (discs large homolog associated protein 5 [Source:NCBI gene;Acc:407899])

HSP 1 Score: 62.7734 bits (151), Expect = 2.283e-9
Identity = 45/165 (27.27%), Postives = 77/165 (46.67%), Query Frame = 1
Query: 1774 KKSIADDVTVNDNDA----TKPIENGFKTNEPEII-----DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGL---CEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWK 2232
            +K  A DV +   DA    +  + N  K NE E       D  YF + +   + EI +   L   +     ++  ++    +  T+G+ +LL+ E+  QF+GL   CE               +  +  T  +DL+GFWDM++ QIED+ K F+ + K+  N+W+
Sbjct:  407 QKESATDVCLAPTDAPGSPSSSVSNPQKENEKEAPKEPEHDVPYFRDTL---KSEIARLKQLCCEWDKRIELDIPEDAKDLIRTTVGQTRLLMCERFKQFEGLVDNCE--------------FKRGEKETTCTDLDGFWDMIYFQIEDVGKKFINLGKMEENSWQ 554          
BLAST of Disks large-associated protein vs. Ensembl Mouse
Match: Dlgap4 (DLG associated protein 4 [Source:MGI Symbol;Acc:MGI:2138865])

HSP 1 Score: 76.6406 bits (187), Expect = 8.158e-15
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++
Sbjct:   96 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLV 206          
BLAST of Disks large-associated protein vs. Ensembl Mouse
Match: Dlgap4 (DLG associated protein 4 [Source:MGI Symbol;Acc:MGI:2138865])

HSP 1 Score: 76.6406 bits (187), Expect = 8.826e-15
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++
Sbjct:   96 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLV 206          
BLAST of Disks large-associated protein vs. Ensembl Mouse
Match: Dlgap4 (DLG associated protein 4 [Source:MGI Symbol;Acc:MGI:2138865])

HSP 1 Score: 75.485 bits (184), Expect = 1.170e-14
Identity = 42/141 (29.79%), Postives = 74/141 (52.48%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNK 2274
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++    + K+ + +
Sbjct:  109 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLVETPEKRKVSMEQ 231          
BLAST of Disks large-associated protein vs. Ensembl Mouse
Match: Dlgap4 (DLG associated protein 4 [Source:MGI Symbol;Acc:MGI:2138865])

HSP 1 Score: 77.411 bits (189), Expect = 2.244e-14
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++
Sbjct:  264 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLV 374          
BLAST of Disks large-associated protein vs. Ensembl Mouse
Match: Dlgap4 (DLG associated protein 4 [Source:MGI Symbol;Acc:MGI:2138865])

HSP 1 Score: 77.7962 bits (190), Expect = 4.274e-14
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++
Sbjct:  786 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLV 896          
BLAST of Disks large-associated protein vs. UniProt/SwissProt
Match: sp|Q7ZYZ6|DLGP1_DANRE (Disks large-associated protein 1 OS=Danio rerio OX=7955 GN=dlgap1 PE=3 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 1.402e-13
Identity = 59/211 (27.96%), Postives = 96/211 (45.50%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYL-----DAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTP-----KKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG +FL L       +Q + + ++G+      D +     DEV G++   +G A+LL+S+K  QF+ LCEEN+  +              R +  DL GFWDM+   IE+I+  F  + +++ NNW+ +            PP R +R        K         +  S ES ++   E RK +M  K  + +S+ QNS    ++ I  Y
Sbjct:  812 DGRWFLKL-------LQAETERMEGWCRQMEHDEKENKMPDEVLGKIRGAVGSAQLLMSQKFQQFRELCEENLNPNAHP-----------RPVAQDLAGFWDMLQLSIENISLKFDELHQLKANNWRPL-----------DPPERKERRLPPPVPKKPPKAHPPLARDRSLESTEKQRQEARKRLMAAK--RAASVRQNSATESADSIEIY 991          
BLAST of Disks large-associated protein vs. UniProt/SwissProt
Match: sp|Q9Y2H0|DLGP4_HUMAN (Disks large-associated protein 4 OS=Homo sapiens OX=9606 GN=DLGAP4 PE=1 SV=3)

HSP 1 Score: 78.1814 bits (191), Expect = 2.498e-13
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++
Sbjct:  803 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLV 913          
BLAST of Disks large-associated protein vs. UniProt/SwissProt
Match: sp|B1AZP2|DLGP4_MOUSE (Disks large-associated protein 4 OS=Mus musculus OX=10090 GN=Dlgap4 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.256e-13
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+GLCE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++
Sbjct:  803 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLV 913          
BLAST of Disks large-associated protein vs. UniProt/SwissProt
Match: sp|Q9P1A6|DLGP2_HUMAN (Disks large-associated protein 2 OS=Homo sapiens OX=9606 GN=DLGAP2 PE=1 SV=4)

HSP 1 Score: 77.0258 bits (188), Expect = 5.306e-13
Identity = 37/124 (29.84%), Postives = 69/124 (55.65%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            DG++FL L++     ++     ++   +AE  +  +E+ G++   +G A+LL+S+K  QF  LC++N+  S              R    DL G+WDM+   IED++  F  ++++R+N+WKM+
Sbjct:  866 DGSWFLKLLHAETKRMEGWCKEME--REAEENDLSEEILGKIRSAVGSAQLLMSQKFQQFYWLCQQNMDPSAMP-----------RPTSQDLAGYWDMLQLSIEDVSMKFDELQRLRLNDWKMM 976          
BLAST of Disks large-associated protein vs. UniProt/SwissProt
Match: sp|P97839|DLGP4_RAT (Disks large-associated protein 4 OS=Rattus norvegicus OX=10116 GN=Dlgap4 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 5.920e-13
Identity = 40/129 (31.01%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY---LDAENV--NFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            DG +FL L       +Q + + ++G+   +D E    N  +EV G++L  +G A+LL+S+K  QF+G+CE+N+                 R    DL GFWD++   IEDI+  F  +  ++ N+W+++
Sbjct:  803 DGYWFLKL-------LQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGICEQNLNPDANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLV 913          
BLAST of Disks large-associated protein vs. TrEMBL
Match: A0A448XKJ0 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS32288 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 4.730e-22
Identity = 58/137 (42.34%), Postives = 83/137 (60.58%), Query Frame = 1
Query: 1864 IDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXX---XXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIV 2265
            +DG Y+L LV K EG+++ KI+ ++  L    +   D VSGQL VT+GKAKLLLSEK +QF+ LC +N+                + +L TL SDL GFW +V  Q+EDI   F  V+++R N W  +P +N+S +V
Sbjct:  108 LDGNYYLGLVDKLEGKLRLKIEAIEKDLRT-YLTLSDAVSGQLRVTVGKAKLLLSEKFVQFRSLCAQNLVHLASLRSGKPTTDLPQQQLVTLASDLEGFWALVLLQVEDIEAMFAEVDRLRQNRW--VPPKNDSILV 241          
BLAST of Disks large-associated protein vs. TrEMBL
Match: G4V818 (Putative hepatoma up-regulated protein OS=Schistosoma mansoni OX=6183 GN=Smp_035090.3 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.008e-20
Identity = 88/268 (32.84%), Postives = 136/268 (50.75%), Query Frame = 1
Query: 1525 DIKIRKSREPS-------QNLVARSSMIMLVVSHNSPRSKIV--------------SNQISTPNKEIDLSCSLNSTNQHFNGTIPAM----RLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKPIENGFKTNEPEI-IDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXX----XXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            ++K+R+ R  S       Q    RSS+IML V+H SPR ++V              S+ I+  ++  +    LN++ QH    +  +     L  +  S + + S  DK+S+  D T               +NE EI +DG ++L  V + E E+  K+  ++  L+ E V+  DEVSG L    GKA+LL+SEK  QF+ LC +N+   N   +      +NE N L TL+SDL+GFW MV  Q++DI   F  V+ +R NNW+ +
Sbjct:  456 NVKLRRKRTTSNTNNTDDQEHWNRSSLIMLAVAHASPRGRVVTPTTVLNKPFFPSLSDSITAYSEVNESKGELNTSIQHKTELVDTLSSSTELPSEGNSFLITNSIKDKQSLNTDYTT-------------LSNESEIKVDGNFYLQQVDQTEKELLNKVCEIETDLNNE-VDLNDEVSGLLRTASGKARLLISEKFCQFRALCHQNLAWENSKTVGVDNNFVNEPNTLVTLVSDLDGFWAMVSLQVDDIRGLFKQVDSLRANNWQPV 709          
BLAST of Disks large-associated protein vs. TrEMBL
Match: G4V819 (Putative hepatoma up-regulated protein OS=Schistosoma mansoni OX=6183 GN=Smp_035090.1 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.399e-20
Identity = 88/268 (32.84%), Postives = 136/268 (50.75%), Query Frame = 1
Query: 1525 DIKIRKSREPS-------QNLVARSSMIMLVVSHNSPRSKIV--------------SNQISTPNKEIDLSCSLNSTNQHFNGTIPAM----RLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKPIENGFKTNEPEI-IDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXX----XXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            ++K+R+ R  S       Q    RSS+IML V+H SPR ++V              S+ I+  ++  +    LN++ QH    +  +     L  +  S + + S  DK+S+  D T               +NE EI +DG ++L  V + E E+  K+  ++  L+ E V+  DEVSG L    GKA+LL+SEK  QF+ LC +N+   N   +      +NE N L TL+SDL+GFW MV  Q++DI   F  V+ +R NNW+ +
Sbjct:  510 NVKLRRKRTTSNTNNTDDQEHWNRSSLIMLAVAHASPRGRVVTPTTVLNKPFFPSLSDSITAYSEVNESKGELNTSIQHKTELVDTLSSSTELPSEGNSFLITNSIKDKQSLNTDYTT-------------LSNESEIKVDGNFYLQQVDQTEKELLNKVCEIETDLNNE-VDLNDEVSGLLRTASGKARLLISEKFCQFRALCHQNLAWENSKTVGVDNNFVNEPNTLVTLVSDLDGFWAMVSLQVDDIRGLFKQVDSLRANNWQPV 763          
BLAST of Disks large-associated protein vs. TrEMBL
Match: G4V820 (Putative hepatoma up-regulated protein OS=Schistosoma mansoni OX=6183 GN=Smp_035090.2 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.407e-20
Identity = 88/268 (32.84%), Postives = 136/268 (50.75%), Query Frame = 1
Query: 1525 DIKIRKSREPS-------QNLVARSSMIMLVVSHNSPRSKIV--------------SNQISTPNKEIDLSCSLNSTNQHFNGTIPAM----RLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKPIENGFKTNEPEI-IDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXX----XXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI 2238
            ++K+R+ R  S       Q    RSS+IML V+H SPR ++V              S+ I+  ++  +    LN++ QH    +  +     L  +  S + + S  DK+S+  D T               +NE EI +DG ++L  V + E E+  K+  ++  L+ E V+  DEVSG L    GKA+LL+SEK  QF+ LC +N+   N   +      +NE N L TL+SDL+GFW MV  Q++DI   F  V+ +R NNW+ +
Sbjct:  527 NVKLRRKRTTSNTNNTDDQEHWNRSSLIMLAVAHASPRGRVVTPTTVLNKPFFPSLSDSITAYSEVNESKGELNTSIQHKTELVDTLSSSTELPSEGNSFLITNSIKDKQSLNTDYTT-------------LSNESEIKVDGNFYLQQVDQTEKELLNKVCEIETDLNNE-VDLNDEVSGLLRTASGKARLLISEKFCQFRALCHQNLAWENSKTVGVDNNFVNEPNTLVTLVSDLDGFWAMVSLQVDDIRGLFKQVDSLRANNWQPV 780          
BLAST of Disks large-associated protein vs. TrEMBL
Match: A0A094ZHN7 (Disks large-associated protein 1 OS=Schistosoma haematobium OX=6185 GN=MS3_02231 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.573e-20
Identity = 89/272 (32.72%), Postives = 139/272 (51.10%), Query Frame = 1
Query: 1525 DIKIRKSREPS-------QNLVARSSMIMLVVSHNSPRSKIV--------------SNQISTPNKEIDLSCSLNSTNQHFNGTIPAM----RLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKPIENGFKTNEPEI-IDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXX----XXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYEN 2250
            ++K+R+ R  S       Q    RSS+IML V+H SPR +++              S+ I+  ++  +    LN++ QH    +  +     L+F+  S +   S  DK+S+  D T               +N+ EI +DG ++L  V + E E+  K+  ++  L+ E V+  DEVSG L    GKA+LL+SEK  QF+ LC +N+   N   +      +NE N L TL+SDL+GFW MV  Q++DI   F  V+ +R NNW+  P +N
Sbjct:  520 NVKLRRKRTTSNTNNTDDQEHWNRSSLIMLAVAHASPRGRVITPTTALNKPFFPSFSDSITAYSEVNESKGELNTSIQHKTELVDTLSSSTELSFEGNSSVIINSIKDKQSLNTDYTT-------------LSNQSEIKVDGNFYLQQVDQTEKELLNKVCEIETDLNNE-VDLNDEVSGLLRTASGKARLLISEKFCQFRALCHQNLAWENSKTVGVDNNFVNEPNTLITLVSDLDGFWAMVSLQVDDIRGLFKQVDSLRANNWQ--PVDN 775          
BLAST of Disks large-associated protein vs. Ensembl Cavefish
Match: dlgap4b (disks large-associated protein 4-like [Source:NCBI gene;Acc:103027721])

HSP 1 Score: 82.0333 bits (201), Expect = 1.761e-15
Identity = 60/207 (28.99%), Postives = 100/207 (48.31%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQ---KKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKM---IPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG +FL L+    G ++   K++D      + +     +EV G++   +G A+LL+S+K  QF+GLC++N+  +              R    DL GFWD++   IEDI+  F  +  ++ N+WK+    P + E++     PPV  K      G  K    ++ S E+  +   E RK +M  K +Q  S+ QNS    ++ I  Y
Sbjct:  917 DGHWFLKLLQAETGRMEGWCKQMDE-----ETKEHQLSEEVLGKVRSAVGSAQLLMSQKFQQFRGLCDQNLNVNANP-----------RPTAQDLAGFWDLLQLSIEDISLKFDELYHLKSNDWKLDRDSPDKQENQK--QAPPVPKK-----PGKGKPVLGREKSGEAADKQRQEARKRLMAAKRAQ--SVKQNSATESADSIEIY 1098          
BLAST of Disks large-associated protein vs. Ensembl Cavefish
Match: dlgap4b (disks large-associated protein 4-like [Source:NCBI gene;Acc:103027721])

HSP 1 Score: 82.0333 bits (201), Expect = 2.010e-15
Identity = 60/207 (28.99%), Postives = 100/207 (48.31%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQ---KKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKM---IPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG +FL L+    G ++   K++D      + +     +EV G++   +G A+LL+S+K  QF+GLC++N+  +              R    DL GFWD++   IEDI+  F  +  ++ N+WK+    P + E++     PPV  K      G  K    ++ S E+  +   E RK +M  K +Q  S+ QNS    ++ I  Y
Sbjct:  950 DGHWFLKLLQAETGRMEGWCKQMDE-----ETKEHQLSEEVLGKVRSAVGSAQLLMSQKFQQFRGLCDQNLNVNANP-----------RPTAQDLAGFWDLLQLSIEDISLKFDELYHLKSNDWKLDRDSPDKQENQK--QAPPVPKK-----PGKGKPVLGREKSGEAADKQRQEARKRLMAAKRAQ--SVKQNSATESADSIEIY 1131          
BLAST of Disks large-associated protein vs. Ensembl Cavefish
Match: ENSAMXT00000001081.2 (disks large-associated protein 4-like [Source:NCBI gene;Acc:103030493])

HSP 1 Score: 79.7221 bits (195), Expect = 8.968e-15
Identity = 61/212 (28.77%), Postives = 101/212 (47.64%), Query Frame = 1
Query: 1861 IIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNT--PK------KKVSSESVQ-QINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            + DG +FL L+    G ++     ++   +++     +EV G++   +G A+LL+S+K  QF+GLCE+N+           +   + R    DL GFWD++   IEDI+  F  +  ++ N+WK+    N+ +          K+   +S TPK T  PK      K  SS+S   +   E RK +M  K  +  S  QNS    ++ I  Y
Sbjct:  883 LRDGHWFLKLLQAETGRMEAWCQQME--QESKEKKLSEEVLGKIRSAVGSAQLLMSKKFQQFRGLCEQNL-----------DVNAQPRPTAQDLAGFWDLLQLSIEDISMKFDELHLLKSNDWKLPESSNKKE---------EKKQQPTSTTPKKTLKPKPAAVKEKSASSDSAADKQRQEARKRLMAAK--RAVSERQNSATESADSIEIY 1070          
BLAST of Disks large-associated protein vs. Ensembl Cavefish
Match: dlgap1a (disks large-associated protein 1 [Source:NCBI gene;Acc:103031631])

HSP 1 Score: 78.9518 bits (193), Expect = 1.466e-14
Identity = 59/211 (27.96%), Postives = 96/211 (45.50%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYL----DAENVN-FEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTP-----KKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG +FL L       +Q + D ++G+       E  N   D++ G++   +G A+LL+S+K  QF+ LCEEN+  +              R +  DL GFWDM+   IE+I+  F  + +++ NNW+ +            PP R +R        K         +  S ES ++   E RK +M  K  + +S+ QNS    ++ I  Y
Sbjct:  806 DGRWFLKL-------LQAEADRMEGWCRQMEHEERANELPDDILGKIRSAVGSAQLLMSQKFQQFRELCEENLNPNAHP-----------RPVAQDLAGFWDMLQLSIENISLKFDELHQLKANNWRPL-----------DPPERKERRLPPPVPKKPPKAHPPLARDRSLESTEKQRQEARKRLMAAK--RAASVRQNSATESADSIEIY 985          
BLAST of Disks large-associated protein vs. Ensembl Cavefish
Match: dlgap1a (disks large-associated protein 1 [Source:NCBI gene;Acc:103031631])

HSP 1 Score: 78.9518 bits (193), Expect = 1.513e-14
Identity = 59/211 (27.96%), Postives = 96/211 (45.50%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYL----DAENVN-FEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTP-----KKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG +FL L       +Q + D ++G+       E  N   D++ G++   +G A+LL+S+K  QF+ LCEEN+  +              R +  DL GFWDM+   IE+I+  F  + +++ NNW+ +            PP R +R        K         +  S ES ++   E RK +M  K  + +S+ QNS    ++ I  Y
Sbjct:  801 DGRWFLKL-------LQAEADRMEGWCRQMEHEERANELPDDILGKIRSAVGSAQLLMSQKFQQFRELCEENLNPNAHP-----------RPVAQDLAGFWDMLQLSIENISLKFDELHQLKANNWRPL-----------DPPERKERRLPPPVPKKPPKAHPPLARDRSLESTEKQRQEARKRLMAAK--RAASVRQNSATESADSIEIY 980          
BLAST of Disks large-associated protein vs. Ensembl Sea Lamprey
Match: dlgap1b (discs, large (Drosophila) homolog-associated protein 1b [Source:ZFIN;Acc:ZDB-GENE-091116-98])

HSP 1 Score: 86.6557 bits (213), Expect = 4.934e-18
Identity = 55/201 (27.36%), Postives = 100/201 (49.75%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DGT+FL L+      ++     ++   DAE  +  +++ G++   +G A+LL+ +K  QF+GLC EN+  + + +               DL GFWDM+   IED+   F  ++++++N WK    E   +     PP+  K S A     ++T  ++ S+E+  +   E RK ++  K  + +S+ QNS    ++ I  Y
Sbjct:  274 DGTWFLKLLQAERERMESWCQQMEN--DAEENDLPEDILGKIRSAVGSARLLMCQKFQQFQGLCHENLNPTADPHPTSQ-----------DLAGFWDMLQLAIEDVGMKFGELQQLKVNQWKEADAEEVQEEQQLPPPMSRKPSRA-----RSTLYRQKSAEAADRQRVEARKRLLAAK--RAASMRQNSATESADSIEIY 454          
BLAST of Disks large-associated protein vs. Ensembl Sea Lamprey
Match: dlgap1b (discs, large (Drosophila) homolog-associated protein 1b [Source:ZFIN;Acc:ZDB-GENE-091116-98])

HSP 1 Score: 87.0409 bits (214), Expect = 5.673e-18
Identity = 55/201 (27.36%), Postives = 100/201 (49.75%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DGT+FL L+      ++     ++   DAE  +  +++ G++   +G A+LL+ +K  QF+GLC EN+  + + +               DL GFWDM+   IED+   F  ++++++N WK    E   +     PP+  K S A     ++T  ++ S+E+  +   E RK ++  K  + +S+ QNS    ++ I  Y
Sbjct:  445 DGTWFLKLLQAERERMESWCQQMEN--DAEENDLPEDILGKIRSAVGSARLLMCQKFQQFQGLCHENLNPTADPHPTSQ-----------DLAGFWDMLQLAIEDVGMKFGELQQLKVNQWKEADAEEVQEEQQLPPPMSRKPSRA-----RSTLYRQKSAEAADRQRVEARKRLLAAK--RAASMRQNSATESADSIEIY 625          
BLAST of Disks large-associated protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006551.1 (pep scaffold:Pmarinus_7.0:GL476558:405090:419728:-1 gene:ENSPMAG00000005902.1 transcript:ENSPMAT00000006551.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 6.346e-15
Identity = 74/329 (22.49%), Postives = 141/329 (42.86%), Query Frame = 1
Query: 1510 SQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDAT---KPIENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGY-----LDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKN-TPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
             +R + I ++   E      ARS+ +   V  +     +    + TP K    + S +  +   +GT  A    F +++   S  K   +++          A+    P  NG + + P + DG +F+ L       +Q + + +QG+     ++ +     +EV G++   +G A+LL+S+K  QF GLC++N+                 R   +DL GFWDM+   +ED++  F  ++++++  W               PP  +K++       KN  P  ++ S   Q+   E RK +M  K  + ++  Q+S    S++I  Y
Sbjct:  168 GERYHSIGVQVEDERRAGRYARSNSVTTAVQADLEVEDLARLSVFTPEKVTRSASSSSRASHSRSGTPVAGHSAFQHVAQQGSTEKQHSRAVLTQEDCGGQAASLDGGPPPNGGRVS-PCVRDGRWFMRL-------LQSETERLQGWCSQIEVETQGKQLSEEVLGKIRSAVGSAQLLISQKFKQFHGLCQQNLDPDATP-----------RPTSTDLAGFWDMLQLSVEDVSTRFHELQQLKVAGWTQA----------TPPPPSAKKARE-----KNVAPILQIESADKQRAE-EARKRLMAAK--RAAAGRQSSATESSDNIEIY 459          
BLAST of Disks large-associated protein vs. Ensembl Nematostella
Match: EDO42906 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S061])

HSP 1 Score: 79.7221 bits (195), Expect = 1.421e-16
Identity = 55/162 (33.95%), Postives = 86/162 (53.09%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNW--KMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVS 2346
            DG +FL ++ K    + +  + +    D    +  +EV G++   IGK+KLL ++K  QFKGLCE N+          I + N +R   +DL GFWDMV  Q++D+N  F  +E++R N W  K  P EN     L + P  SK++++ +  P     K+VS
Sbjct:   75 DGRHFLEVMKKEAERMTRVCETLDK--DISESSATEEVCGKVRAAIGKSKLLTTKKFKQFKGLCECNL---------GIGDLNGIRPTNADLAGFWDMVMIQVDDVNSMFEALEELRQNGWQEKFKPAENGDG--LTRTPSLSKKASSLTRQPSFGVYKEVS 223          
BLAST of Disks large-associated protein vs. Ensembl Nematostella
Match: EDO35279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLX3])

HSP 1 Score: 72.0182 bits (175), Expect = 7.633e-13
Identity = 40/146 (27.40%), Postives = 69/146 (47.26%), Query Frame = 1
Query: 1792 DVTVNDNDATKPIENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNW 2229
            D+ +     T+  ++  +  EPE   G+ +  ++   E +   K+      +  E     DEV+G +   +G+A+LL+S++  QF GL +              +   K +   SDL GFWDM++ Q+ED+      +EK R NNW
Sbjct:  349 DIPMETVQTTETAQDAKEETEPE--KGSLYFRMLVTSETDKLNKLCACWDKVLEEEEELSDEVTGSIRTAVGQAQLLISQRFKQFSGLID-----------LSEDPTAKKKATPSDLQGFWDMIYFQVEDVYNKMEALEKRRQNNW 481          
BLAST of Disks large-associated protein vs. Ensembl Medaka
Match: ENSORLT00000010418.2 (disks large-associated protein 1-like [Source:NCBI gene;Acc:101160590])

HSP 1 Score: 86.2705 bits (212), Expect = 6.339e-17
Identity = 63/208 (30.29%), Postives = 100/208 (48.08%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY-----LDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI--PYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG +FL L       +Q + D ++G+     LD +  +  DEV G++   +  A+ L+S+K  QF+ LCEEN+  +              R + SDL GFWDM+   IE+I+  F  + ++R NNW+ +  P   E ++    PPV  K        P     +  S ES ++   E RK +M  K  + +S+ QNS    ++ I  Y
Sbjct:  551 DGRWFLKL-------LQAETDRMEGWCQQMELDQQENDLPDEVLGKMRSAMESAQHLMSQKFQQFRELCEENLNPNIHP-----------RPVASDLAGFWDMLQLSIENISLKFDELHQLRANNWRPLDPPERKERRL---PPPVPRKPHKGPHQHPPLV--RDRSLESSEKQRQEARKRLMAAK--RAASVRQNSATESADSIEIY 733          
BLAST of Disks large-associated protein vs. Ensembl Medaka
Match: ENSORLT00000039798.1 (disks large-associated protein 1-like [Source:NCBI gene;Acc:101160590])

HSP 1 Score: 86.2705 bits (212), Expect = 9.029e-17
Identity = 64/210 (30.48%), Postives = 101/210 (48.10%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGY-----LDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI--PYENESKIVLNKPPVRSKRSTASSGTPKNTPK--KKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG +FL L       +Q + D ++G+     LD +  +  DEV G++   +  A+ L+S+K  QF+ LCEEN+  +              R + SDL GFWDM+   IE+I+  F  + ++R NNW+ +  P   E ++    PPV  K        P   P   +  S ES ++   E RK +M  K  + +S+ QNS    ++ I  Y
Sbjct:  933 DGRWFLKL-------LQAETDRMEGWCQQMELDQQENDLPDEVLGKMRSAMESAQHLMSQKFQQFRELCEENLNPNIHP-----------RPVASDLAGFWDMLQLSIENISLKFDELHQLRANNWRPLDPPERKERRL---PPPVPRKPHKG----PHQHPPLVRDRSLESSEKQRQEARKRLMAAK--RAASVRQNSATESADSIEIY 1115          
BLAST of Disks large-associated protein vs. Ensembl Medaka
Match: ENSORLT00000016158.2 (disks large-associated protein 4 [Source:NCBI gene;Acc:101163007])

HSP 1 Score: 84.3445 bits (207), Expect = 3.783e-16
Identity = 60/214 (28.04%), Postives = 104/214 (48.60%), Query Frame = 1
Query: 1831 ENGFKTNEPEII-DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            ++G +   P  + DG +FL L+    G ++     ++   + ++    +EV G +   +G A+LL+S+K  QF+GLC EN+  +              R    DL GFWD++   IEDI+  F  + +++ NNW+ +P + E K+   + P    + T+    P  T K K    +V +   E RK +M  K  + +S+ QNS    ++ I  Y
Sbjct:  875 QDGAQPTVPTCLRDGNWFLKLLQAETGRMEGWCQQME--QETKDNKLSEEVLGTIRSAVGSAQLLISQKFEQFRGLCNENLNVNANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYQLKANNWQ-LPEKPEKKVENKQLPSSVPKKTSKPRLP--TGKDKSVDSAVDKQRQEARKRLMAAK--RAASVRQNSATESADSIEIY 1070          
BLAST of Disks large-associated protein vs. Ensembl Medaka
Match: ENSORLT00000016159.2 (disks large-associated protein 4 [Source:NCBI gene;Acc:101163007])

HSP 1 Score: 84.3445 bits (207), Expect = 3.783e-16
Identity = 60/214 (28.04%), Postives = 104/214 (48.60%), Query Frame = 1
Query: 1831 ENGFKTNEPEII-DGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            ++G +   P  + DG +FL L+    G ++     ++   + ++    +EV G +   +G A+LL+S+K  QF+GLC EN+  +              R    DL GFWD++   IEDI+  F  + +++ NNW+ +P + E K+   + P    + T+    P  T K K    +V +   E RK +M  K  + +S+ QNS    ++ I  Y
Sbjct:  875 QDGAQPTVPTCLRDGNWFLKLLQAETGRMEGWCQQME--QETKDNKLSEEVLGTIRSAVGSAQLLISQKFEQFRGLCNENLNVNANP-----------RPTAQDLAGFWDLLQLSIEDISMKFDELYQLKANNWQ-LPEKPEKKVENKQLPSSVPKKTSKPRLP--TGKDKSVDSAVDKQRQEARKRLMAAK--RAASVRQNSATESADSIEIY 1070          
BLAST of Disks large-associated protein vs. Ensembl Medaka
Match: dlgap1b (DLG associated protein 1 [Source:NCBI gene;Acc:101173818])

HSP 1 Score: 78.1814 bits (191), Expect = 2.900e-14
Identity = 59/216 (27.31%), Postives = 98/216 (45.37%), Query Frame = 1
Query: 1867 DGTYFLNLVYKHEGEIQKKIDLVQGYL-----DAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMI--PYENESKI--------VLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            DG +FL L       +Q + + ++G+      D       DE+ G++   +G A+LL+S+K  QF+ LCEEN+  +              R +  DL GFWDM+   IE+I+  F  + +++ NNWK +  P   E K+        + N PP+   RS                 ES ++   E RK ++  K  + +S+ Q+S    ++ I  Y
Sbjct:  835 DGRWFLKL-------LQAETERMEGWCRQMEQDETEHELPDEILGKIRSAVGSAQLLMSQKFQQFRELCEENLNPNAHP-----------RPVSQDLAGFWDMLQLSIENISLKFDELHQLKANNWKPLTPPEIQERKMPPPLPKKPLKNHPPLARDRSL----------------ESSERQRLEARKRLLAAK--RAASVRQSSTTESADSIEIY 1014          
BLAST of Disks large-associated protein vs. Planmine SMEST
Match: SMESG000005404.1 (SMESG000005404.1)

HSP 1 Score: 1441.02 bits (3729), Expect = 0.000e+0
Identity = 779/783 (99.49%), Postives = 780/783 (99.62%), Query Frame = 1
Query:  121 MNIEIMCESNSHSSNSKMNIKADDYKKSKTFNLGNAENERLSRVDSTNYPDATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQVTNDKQLEILPNKGRHKKTSFMLNIIRHLSVSTPKMFXXXXXXXXXXXXXXXXXQIDHLKNSVSLSHNDDKITNGVTDDKQTQFTPKSKSIRXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXVANHVLNYESATSCNDISLNKVCKNELRNFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQFSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAENSNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVDNVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSEDCVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKPIENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            MNIEIMCESNSHSSNSKMNIKADDYKKSKTFNLGNAENERLSRVDST+YPDATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQVTNDKQLEILPNKGRHKKTSFM NIIRHLSVSTPKMFKKNKKSKLNANENSNENQIDHLKNSVSLSHNDDKI NGVTDDKQTQFTPKSKSIRKMLQKLTKKKGKGKFNSEPPSSIESRPSLSSVANHVLNYESATSCNDISLNKVCKNELRNFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQFSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAENSNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVDNVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSEDCVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKP ENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRESNEDNIHEINEENKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY
Sbjct:    1 MNIEIMCESNSHSSNSKMNIKADDYKKSKTFNLGNAENERLSRVDSTHYPDATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQVTNDKQLEILPNKGRHKKTSFMSNIIRHLSVSTPKMFKKNKKSKLNANENSNENQIDHLKNSVSLSHNDDKIANGVTDDKQTQFTPKSKSIRKMLQKLTKKKGKGKFNSEPPSSIESRPSLSSVANHVLNYESATSCNDISLNKVCKNELRNFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQFSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAENSNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVDNVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSEDCVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKPTENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRESNEDNIHEINEENKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 783          
BLAST of Disks large-associated protein vs. Planmine SMEST
Match: SMESG000005404.1 (SMESG000005404.1)

HSP 1 Score: 1432.54 bits (3707), Expect = 0.000e+0
Identity = 774/778 (99.49%), Postives = 775/778 (99.61%), Query Frame = 1
Query:  136 MCESNSHSSNSKMNIKADDYKKSKTFNLGNAENERLSRVDSTNYPDATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQVTNDKQLEILPNKGRHKKTSFMLNIIRHLSVSTPKMFXXXXXXXXXXXXXXXXXQIDHLKNSVSLSHNDDKITNGVTDDKQTQFTPKSKSIRXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXVANHVLNYESATSCNDISLNKVCKNELRNFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQFSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAENSNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVDNVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSEDCVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKPIENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            MCESNSHSSNSKMNIKADDYKKSKTFNLGNAENERLSRVDST+YPDATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQVTNDKQLEILPNKGRHKKTSFM NIIRHLSVSTPKMFKKNKKSKLNANENSNENQIDHLKNSVSLSHNDDKI NGVTDDKQTQFTPKSKSIRKMLQKLTKKKGKGKFNSEPPSSIESRPSLSSVANHVLNYESATSCNDISLNKVCKNELRNFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQFSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAENSNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVDNVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSEDCVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKP ENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRESNEDNIHEINEENKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY
Sbjct:    1 MCESNSHSSNSKMNIKADDYKKSKTFNLGNAENERLSRVDSTHYPDATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQVTNDKQLEILPNKGRHKKTSFMSNIIRHLSVSTPKMFKKNKKSKLNANENSNENQIDHLKNSVSLSHNDDKIANGVTDDKQTQFTPKSKSIRKMLQKLTKKKGKGKFNSEPPSSIESRPSLSSVANHVLNYESATSCNDISLNKVCKNELRNFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQFSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAENSNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVDNVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSEDCVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKPTENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRESNEDNIHEINEENKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 778          
BLAST of Disks large-associated protein vs. Planmine SMEST
Match: SMESG000005404.1 (SMESG000005404.1)

HSP 1 Score: 1398.26 bits (3618), Expect = 0.000e+0
Identity = 762/783 (97.32%), Postives = 764/783 (97.57%), Query Frame = 1
Query:  121 MNIEIMCESNSHSSNSKMNIKADDYKKSKTFNLGNAENERLSRVDSTNYPDATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQVTNDKQLEILPNKGRHKKTSFMLNIIRHLSVSTPKMFXXXXXXXXXXXXXXXXXQIDHLKNSVSLSHNDDKITNGVTDDKQTQFTPKSKSIRXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXVANHVLNYESATSCNDISLNKVCKNELRNFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQFSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAENSNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVDNVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSEDCVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKPIENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            MNIEIMCESNSHSSNSKMNIKADDYKK                +DST+YPDATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQVTNDKQLEILPNKGRHKKTSFM NIIRHLSVSTPKMFKKNKKSKLNANENSNENQIDHLKNSVSLSHNDDKI NGVTDDKQTQFTPKSKSIRKMLQKLTKKKGKGKFNSEPPSSIESRPSLSSVANHVLNYESATSCNDISLNKVCKNELRNFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQFSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAENSNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVDNVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSEDCVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKP ENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRESNEDNIHEINEENKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY
Sbjct:    1 MNIEIMCESNSHSSNSKMNIKADDYKK----------------IDSTHYPDATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQVTNDKQLEILPNKGRHKKTSFMSNIIRHLSVSTPKMFKKNKKSKLNANENSNENQIDHLKNSVSLSHNDDKIANGVTDDKQTQFTPKSKSIRKMLQKLTKKKGKGKFNSEPPSSIESRPSLSSVANHVLNYESATSCNDISLNKVCKNELRNFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQFSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAENSNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVDNVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSEDCVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKPTENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRESNEDNIHEINEENKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 767          
BLAST of Disks large-associated protein vs. Planmine SMEST
Match: SMESG000005404.1 (SMESG000005404.1)

HSP 1 Score: 1387.86 bits (3591), Expect = 0.000e+0
Identity = 757/778 (97.30%), Postives = 759/778 (97.56%), Query Frame = 1
Query:  136 MCESNSHSSNSKMNIKADDYKKSKTFNLGNAENERLSRVDSTNYPDATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQVTNDKQLEILPNKGRHKKTSFMLNIIRHLSVSTPKMFXXXXXXXXXXXXXXXXXQIDHLKNSVSLSHNDDKITNGVTDDKQTQFTPKSKSIRXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXVANHVLNYESATSCNDISLNKVCKNELRNFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQFSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAENSNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVDNVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSEDCVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKPIENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRXXXXXXXXXXXXXXKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 2469
            MCESNSHSSNSKMNIKADDYKK                +DST+YPDATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQVTNDKQLEILPNKGRHKKTSFM NIIRHLSVSTPKMFKKNKKSKLNANENSNENQIDHLKNSVSLSHNDDKI NGVTDDKQTQFTPKSKSIRKMLQKLTKKKGKGKFNSEPPSSIESRPSLSSVANHVLNYESATSCNDISLNKVCKNELRNFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQFSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAENSNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVDNVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSEDCVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKP ENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRESNEDNIHEINEENKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY
Sbjct:    1 MCESNSHSSNSKMNIKADDYKK----------------IDSTHYPDATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQVTNDKQLEILPNKGRHKKTSFMSNIIRHLSVSTPKMFKKNKKSKLNANENSNENQIDHLKNSVSLSHNDDKIANGVTDDKQTQFTPKSKSIRKMLQKLTKKKGKGKFNSEPPSSIESRPSLSSVANHVLNYESATSCNDISLNKVCKNELRNFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQFSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAENSNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVDNVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSEDCVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRSKIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKNDKKSIADDVTVNDNDATKPTENGFKTNEPEIIDGTYFLNLVYKHEGEIQKKIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENIRESNEDNIHEINEENKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRMNNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQINAEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY 762          
The following BLAST results are available for this feature:
BLAST of Disks large-associated protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DLGAP41.034e-1429.79DLG associated protein 4 [Source:HGNC Symbol;Acc:H... [more]
DLGAP41.129e-1431.78DLG associated protein 4 [Source:HGNC Symbol;Acc:H... [more]
DLGAP42.315e-1431.78DLG associated protein 4 [Source:HGNC Symbol;Acc:H... [more]
DLGAP45.202e-1431.78DLG associated protein 4 [Source:HGNC Symbol;Acc:H... [more]
DLGAP45.202e-1431.78DLG associated protein 4 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Disks large-associated protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
W03A5.62.441e-625.25pep chromosome:WBcel235:III:5431407:5434467:-1 gen... [more]
W03A5.62.441e-625.25pep chromosome:WBcel235:III:5431407:5434249:-1 gen... [more]
W03A5.62.723e-624.62pep chromosome:WBcel235:III:5431407:5440634:-1 gen... [more]
W03A5.63.118e-624.62pep chromosome:WBcel235:III:5431407:5440632:-1 gen... [more]
back to top
BLAST of Disks large-associated protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vlc3.359e-1734.65gene:FBgn0259978 transcript:FBtr0307532[more]
vlc3.359e-1734.65gene:FBgn0259978 transcript:FBtr0086041[more]
vlc3.359e-1734.65gene:FBgn0259978 transcript:FBtr0300502[more]
vlc3.359e-1734.65gene:FBgn0259978 transcript:FBtr0086039[more]
vlc3.359e-1734.65gene:FBgn0259978 transcript:FBtr0300503[more]
back to top
BLAST of Disks large-associated protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlgap4b3.103e-1730.39discs, large (Drosophila) homolog-associated prote... [more]
dlgap4b1.645e-1630.39discs, large (Drosophila) homolog-associated prote... [more]
AL928723.19.548e-1627.80discs, large (Drosophila) homolog-associated prote... [more]
AL928723.11.006e-1527.80discs, large (Drosophila) homolog-associated prote... [more]
AL928723.11.025e-1527.80discs, large (Drosophila) homolog-associated prote... [more]
back to top
BLAST of Disks large-associated protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k89.504e-1330.47mitogen-activated protein kinase kinase kinase 8 [... [more]
utp182.924e-1227.88UTP18 small subunit processome component [Source:X... [more]
vps4a4.549e-1127.81vacuolar protein sorting 4 homolog A [Source:Xenba... [more]
dlgap51.909e-927.27discs large homolog associated protein 5 [Source:N... [more]
dlgap52.283e-927.27discs large homolog associated protein 5 [Source:N... [more]
back to top
BLAST of Disks large-associated protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dlgap48.158e-1531.78DLG associated protein 4 [Source:MGI Symbol;Acc:MG... [more]
Dlgap48.826e-1531.78DLG associated protein 4 [Source:MGI Symbol;Acc:MG... [more]
Dlgap41.170e-1429.79DLG associated protein 4 [Source:MGI Symbol;Acc:MG... [more]
Dlgap42.244e-1431.78DLG associated protein 4 [Source:MGI Symbol;Acc:MG... [more]
Dlgap44.274e-1431.78DLG associated protein 4 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Disks large-associated protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZYZ6|DLGP1_DANRE1.402e-1327.96Disks large-associated protein 1 OS=Danio rerio OX... [more]
sp|Q9Y2H0|DLGP4_HUMAN2.498e-1331.78Disks large-associated protein 4 OS=Homo sapiens O... [more]
sp|B1AZP2|DLGP4_MOUSE3.256e-1331.78Disks large-associated protein 4 OS=Mus musculus O... [more]
sp|Q9P1A6|DLGP2_HUMAN5.306e-1329.84Disks large-associated protein 2 OS=Homo sapiens O... [more]
sp|P97839|DLGP4_RAT5.920e-1331.01Disks large-associated protein 4 OS=Rattus norvegi... [more]
back to top
BLAST of Disks large-associated protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448XKJ04.730e-2242.34Uncharacterized protein OS=Protopolystoma xenopodi... [more]
G4V8181.008e-2032.84Putative hepatoma up-regulated protein OS=Schistos... [more]
G4V8191.399e-2032.84Putative hepatoma up-regulated protein OS=Schistos... [more]
G4V8201.407e-2032.84Putative hepatoma up-regulated protein OS=Schistos... [more]
A0A094ZHN71.573e-2032.72Disks large-associated protein 1 OS=Schistosoma ha... [more]
back to top
BLAST of Disks large-associated protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlgap4b1.761e-1528.99disks large-associated protein 4-like [Source:NCBI... [more]
dlgap4b2.010e-1528.99disks large-associated protein 4-like [Source:NCBI... [more]
ENSAMXT00000001081.28.968e-1528.77disks large-associated protein 4-like [Source:NCBI... [more]
dlgap1a1.466e-1427.96disks large-associated protein 1 [Source:NCBI gene... [more]
dlgap1a1.513e-1427.96disks large-associated protein 1 [Source:NCBI gene... [more]
back to top
BLAST of Disks large-associated protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dlgap1b4.934e-1827.36discs, large (Drosophila) homolog-associated prote... [more]
dlgap1b5.673e-1827.36discs, large (Drosophila) homolog-associated prote... [more]
ENSPMAT00000006551.16.346e-1522.49pep scaffold:Pmarinus_7.0:GL476558:405090:419728:-... [more]
back to top
BLAST of Disks large-associated protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Disks large-associated protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO429061.421e-1633.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352797.633e-1327.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Disks large-associated protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000010418.26.339e-1730.29disks large-associated protein 1-like [Source:NCBI... [more]
ENSORLT00000039798.19.029e-1730.48disks large-associated protein 1-like [Source:NCBI... [more]
ENSORLT00000016158.23.783e-1628.04disks large-associated protein 4 [Source:NCBI gene... [more]
ENSORLT00000016159.23.783e-1628.04disks large-associated protein 4 [Source:NCBI gene... [more]
dlgap1b2.900e-1427.31DLG associated protein 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Disks large-associated protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000005404.10.000e+099.49SMESG000005404.1[more]
SMESG000005404.10.000e+099.49SMESG000005404.1[more]
SMESG000005404.10.000e+097.32SMESG000005404.1[more]
SMESG000005404.10.000e+097.30SMESG000005404.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019794 ID=SMED30019794|Name=Disks large-associated protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2537bp
TTACTTTTTAAATTTGTAACTTCTCACTAATTAAAGACTAAATTTGATTT
TTCTTTTTAATTTGTTCAAATTACTCATATCATTCAAGTATATATGCGAA
TATTTAGTATTTGATAATAAATGAATATTGAAATAATGTGTGAATCTAAT
AGTCATAGTTCAAATAGCAAAATGAATATCAAAGCTGATGATTACAAGAA
AAGTAAGACGTTTAATTTGGGAAATGCAGAAAATGAACGTTTGAGTCGAG
TCGATAGTACAAATTATCCAGATGCCACAGATGATCTCGATAACCTTGCT
CAAAAAATGGGATTCAAACAAGAGAATAATAATGCTTCTTCGTGTCGAAA
TACCATAAATAAATTAAAACATTCAGAAGAAAAATTGAATCAAAAAGGCC
TTTCTAAATCATTTCAAGTCACTAATGATAAACAATTAGAGATACTACCG
AACAAGGGACGACATAAAAAAACGAGTTTCATGTTAAATATCATTCGACA
TTTGTCTGTGTCAACTCCGAAAATGTTTAAAAAGAACAAAAAATCTAAAC
TAAATGCCAATGAAAATTCTAATGAAAACCAAATTGATCATTTAAAAAAT
TCTGTATCATTGTCTCACAATGATGATAAAATTACTAATGGAGTAACCGA
TGATAAACAAACTCAATTCACACCGAAATCGAAAAGTATTAGAAAAATGC
TTCAAAAGTTGACTAAAAAGAAAGGAAAAGGAAAGTTCAATTCCGAACCT
CCAAGCAGCATCGAATCAAGGCCCTCTCTTTCAAGTGTTGCTAATCACGT
CCTTAACTATGAATCGGCCACCTCGTGCAATGATATATCCCTCAATAAAG
TCTGCAAGAATGAACTCCGAAATTTTAATTGCTCTGCTGACTGTATCCTA
GATTATAGCAAGCAAATAGAATCGAAGAAGCATCAAGAATCAGTTTCCAG
TACTTCAGAAGATCTGATGGAACATGAAGCAAAACTCAATGCTGCCCTAA
ATCATGTTTCTCATGATCAGTTCTCTGATGAATTTCCAGAAATTGAAAAA
ATTGCTGCAACATGTGATAAAGATAATATTTCTCCATTATCAATCAAAAC
TAGTGAATTTAAGTTTGAATCACAAAGGTCTTGTCATTCAACAATGTCGG
GCTCATGTCACGCGGAAAATAGCAACAATGTTAAACTTACTCTGGCATTG
TATGGATATATTAATTACGGTCTCAGCTCGACGCGTTTGGCTAGCAAGTC
ATGCATGGAATTTCGACCCGAAACGACTAAGAAGAAAATGAAGCTGTCTA
TGGAAAATGTTTCAGTAGACAATGTGATTAAAGGATCCAAGTCTGTTGAT
TGTCACAATAAAAGTAACTGTGTCAAAGAGTCTAATACTGAAGAAGTGGT
TCCAATGAAACCGGAAATTACTGAAACAAATGAACCACCGGTTGGACAAG
TTGTTATGAGATCTGAAGATTGTGTCGATAACTCCGAACCAGCTGTCGTT
CTTAGAAAATCACAGCGTCCAAATGATATAAAGATTCGTAAAAGCCGAGA
ACCTAGTCAGAATTTGGTAGCGAGATCATCCATGATCATGTTGGTTGTGT
CACACAATAGTCCAAGGAGTAAAATTGTGTCAAACCAGATATCAACTCCA
AACAAGGAAATCGATTTAAGTTGTAGTTTAAATAGTACAAATCAACACTT
CAACGGCACTATTCCAGCAATGAGATTAAATTTCGATAATCTCTCCATTA
TTGATAGCCAATCAAAGAACGATAAGAAATCAATTGCTGATGACGTAACA
GTTAATGATAACGACGCTACTAAACCGATTGAAAATGGATTTAAAACTAA
TGAGCCGGAAATAATCGACGGAACGTATTTTTTAAATTTAGTTTATAAAC
ATGAGGGTGAAATTCAAAAGAAAATCGATTTAGTTCAAGGATATTTGGAT
GCAGAAAATGTGAATTTTGAGGATGAAGTTTCCGGGCAACTTCTTGTTAC
AATTGGCAAAGCTAAGCTTCTCCTATCTGAAAAGCTGCTCCAGTTTAAGG
GATTATGCGAGGAAAATATTCGTGAAAGTAATGAAGATAATATTCACGAA
ATCAATGAGGAAAACAAATTGCGAACTTTACTCTCTGATTTGAATGGATT
TTGGGATATGGTTTTCGGTCAAATTGAGGATATCAACAAGAATTTTGTTC
TCGTGGAAAAGATTAGAATGAACAATTGGAAAATGATTCCATACGAGAAT
GAGAGTAAAATTGTATTGAATAAACCACCGGTGCGATCGAAACGTTCTAC
AGCGTCTTCTGGGACACCGAAAAATACACCGAAGAAAAAGGTCTCATCTG
AATCTGTGCAACAAATCAATGCAGAAAAAAGAAAGAACATGATGAAATTT
AAGCTAAGTCAAAAGTCTTCAATATCTCAGAACTCAGATCCGAACTTCTC
CAATGATATTACATTTTATTGATGTTATTCATATAAATAATTATTAATTT
CAAGATTTGCCACACTTTCACAATTCGAGTTGCTGTT
back to top

protein sequence of SMED30019794-orf-1

>SMED30019794-orf-1 ID=SMED30019794-orf-1|Name=SMED30019794-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=784bp
MNIEIMCESNSHSSNSKMNIKADDYKKSKTFNLGNAENERLSRVDSTNYP
DATDDLDNLAQKMGFKQENNNASSCRNTINKLKHSEEKLNQKGLSKSFQV
TNDKQLEILPNKGRHKKTSFMLNIIRHLSVSTPKMFKKNKKSKLNANENS
NENQIDHLKNSVSLSHNDDKITNGVTDDKQTQFTPKSKSIRKMLQKLTKK
KGKGKFNSEPPSSIESRPSLSSVANHVLNYESATSCNDISLNKVCKNELR
NFNCSADCILDYSKQIESKKHQESVSSTSEDLMEHEAKLNAALNHVSHDQ
FSDEFPEIEKIAATCDKDNISPLSIKTSEFKFESQRSCHSTMSGSCHAEN
SNNVKLTLALYGYINYGLSSTRLASKSCMEFRPETTKKKMKLSMENVSVD
NVIKGSKSVDCHNKSNCVKESNTEEVVPMKPEITETNEPPVGQVVMRSED
CVDNSEPAVVLRKSQRPNDIKIRKSREPSQNLVARSSMIMLVVSHNSPRS
KIVSNQISTPNKEIDLSCSLNSTNQHFNGTIPAMRLNFDNLSIIDSQSKN
DKKSIADDVTVNDNDATKPIENGFKTNEPEIIDGTYFLNLVYKHEGEIQK
KIDLVQGYLDAENVNFEDEVSGQLLVTIGKAKLLLSEKLLQFKGLCEENI
RESNEDNIHEINEENKLRTLLSDLNGFWDMVFGQIEDINKNFVLVEKIRM
NNWKMIPYENESKIVLNKPPVRSKRSTASSGTPKNTPKKKVSSESVQQIN
AEKRKNMMKFKLSQKSSISQNSDPNFSNDITFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005026SAPAP
Vocabulary: biological process
TermDefinition
GO:0023052signaling
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005026SAPAP familyPFAMPF03359GKAPcoord: 574..780
e-value: 1.1E-21
score: 77.9
IPR005026SAPAP familyPANTHERPTHR12353DISKS LARGE-ASSOCIATED PROTEIN DAP SAP90/PSD-95-ASSOCIATED PROTEINcoord: 54..774
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 722..752
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 717..772
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 197..219
NoneNo IPR availablePANTHERPTHR12353:SF31GUANYLATE KINASE-ASSOCIATED PROTEIN MARS-RELATEDcoord: 54..774