slc16a-8

Overview
Nameslc16a-8 (AKN21503.1)
Smed IDSMED30019793
Length (bp)3569
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc16a-8 (SMED30019793) t-SNE clustered cells

Violin plots show distribution of expression levels for slc16a-8 (SMED30019793) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc16a-8 (SMED30019793) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc16a-8 (SMED30019793) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019793

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30019793SMESG000026692.1 dd_Smed_v4_1284_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019793SMESG000026692.1 dd_Smed_v4_1284_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019793SMESG000026692.1 dd_Smed_v4_1284_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30019793SMESG000026692.1 dd_Smed_v4_1284_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019793SMESG000026692.1 dd_Smed_v4_1284_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019793SMESG000026692.1 dd_Smed_v4_1284_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30019793SMESG000026692.1 dd_Smed_v4_1284_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019793SMESG000026692.1 Contig49692newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019793SMESG000026692.1 Contig49692uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc16a-8 vs. Ensembl Human
Match: SLC16A14 (solute carrier family 16 member 14 [Source:HGNC Symbol;Acc:HGNC:26417])

HSP 1 Score: 53.5286 bits (127), Expect = 2.170e-6
Identity = 40/128 (31.25%), Postives = 56/128 (43.75%), Query Frame = 2
Query: 1967 RLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTL-VSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFS---NKSEEG 2338
            R    IG  +  L  + SA   N H+LF+T  V  G GS +      ++V  YF K   R  LA  L  +G    + +      YL  +YGWR A +I G +   +NL  C    R  S   N ++ G
Sbjct:  100 RQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQK---RRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVS--LNLCVCGALMRPLSPGKNPNDPG 222          
BLAST of slc16a-8 vs. Ensembl Human
Match: SLC16A14 (solute carrier family 16 member 14 [Source:HGNC Symbol;Acc:HGNC:26417])

HSP 1 Score: 53.1434 bits (126), Expect = 2.319e-6
Identity = 40/128 (31.25%), Postives = 56/128 (43.75%), Query Frame = 2
Query: 1967 RLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTL-VSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFS---NKSEEG 2338
            R    IG  +  L  + SA   N H+LF+T  V  G GS +      ++V  YF K   R  LA  L  +G    + +      YL  +YGWR A +I G +   +NL  C    R  S   N ++ G
Sbjct:  100 RQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQK---RRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVS--LNLCVCGALMRPLSPGKNPNDPG 222          
BLAST of slc16a-8 vs. Ensembl Human
Match: SLC16A14 (solute carrier family 16 member 14 [Source:HGNC Symbol;Acc:HGNC:26417])

HSP 1 Score: 53.1434 bits (126), Expect = 2.767e-6
Identity = 40/128 (31.25%), Postives = 56/128 (43.75%), Query Frame = 2
Query: 1967 RLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTL-VSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFS---NKSEEG 2338
            R    IG  +  L  + SA   N H+LF+T  V  G GS +      ++V  YF K   R  LA  L  +G    + +      YL  +YGWR A +I G +   +NL  C    R  S   N ++ G
Sbjct:  100 RQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQK---RRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAV--SLNLCVCGALMRPLSPGKNPNDPG 222          
BLAST of slc16a-8 vs. Ensembl Human
Match: SLC16A4 (solute carrier family 16 member 4 [Source:HGNC Symbol;Acc:HGNC:10925])

HSP 1 Score: 51.9878 bits (123), Expect = 5.564e-6
Identity = 54/201 (26.87%), Postives = 90/201 (44.78%), Query Frame = 2
Query: 1760 LVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEE--GLSKKSS 2356
            +V+ F  +NV F+ G  + F IF       EF  TS  ++ WIG   ++L + +  L    I+      +    +GAF++    L S+   +  +L +T  +L G GS+ +     ++  +YF K   R  L+T +   G   + +   F  +LI  Y W  A ++ G I   +NL    +  R    KSE   G+  K S
Sbjct:   23 IVIHFFLVNV-FVMGMTKTFAIFFVVFQE-EFEGTS-EQIGWIGSIMSSLRFCAGPL--VAIICDILGEKTTSILGAFVVTGGYLISSWATSIPFLCVTMGLLPGLGSAFLYQVAAVVTTKYFKK---RLALSTAIARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAI--ALNLVPSSMLLRPIHIKSENNSGIKDKGS 213          
BLAST of slc16a-8 vs. Ensembl Zebrafish
Match: slc16a6b (solute carrier family 16 member 6b [Source:ZFIN;Acc:ZDB-GENE-110208-3])

HSP 1 Score: 52.7582 bits (125), Expect = 2.647e-6
Identity = 47/162 (29.01%), Postives = 80/162 (49.38%), Query Frame = 2
Query: 1790 IFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNR-RYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIV-FVQFYAYLIVDYGWRKAFVILGLI 2269
            +F  G  + FGIF+ DL   EF+ T+ + ++W       +   +  LST L   SNR  +R    +G FLI L  +T+A+  +   +++T  ++ G G  L       I+++YF K   R  L T++ S G   S++ F      L    GWR   +++G++
Sbjct:   34 VFTYGIIKTFGIFLQDLMT-EFHETN-SRVSWAVSICVFVMAFTAPLSTLL---SNRFGHRPVVMVGGFLISLGTITTALTQSIDEMYITMGIVAGLGYCLTFLPTVTILSQYFSK---RRSLVTSIASTGECFSMLAFAPAMNALKEQIGWRYCLMVIGVL 187          
BLAST of slc16a-8 vs. Ensembl Zebrafish
Match: si:dkey-246g23.4 (si:dkey-246g23.4 [Source:ZFIN;Acc:ZDB-GENE-050419-234])

HSP 1 Score: 50.8322 bits (120), Expect = 6.972e-6
Identity = 48/208 (23.08%), Postives = 91/208 (43.75%), Query Frame = 2
Query: 1802 GKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGS-VASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARK------FSNKSEEGLSKKSSVNVCRDIKSSQIPLLI 2404
            G  ++FG+F  ++HH  + ST+    +WI     A  +I   + +AL   +   +R     G  L  +  +  +   +   L++T   L GFG +L  +    ++  YFDK  P   +A  L S G  + + +    +  ++  + WR A +ILG +   +NL  C    R       F +  EE    +  ++ C + ++   P+ +
Sbjct:   36 GVIKSFGVFFVEIHH--YFSTTATASSWITSISVATVHIGAPVGSAL--STYFGHRPVVMAGGLLSSVGMVLGSFAQDLLQLYITVGFLTGFGYALTWTPTVTMLGWYFDKRRP---VANALSSTGECLLTFILTPSFQLMVDQFSWRGAMLILGALQ--LNLCVCGALLRPLSRHDYFKDSIEE---NEHELSKCSNNRADSDPMKV 231          
BLAST of slc16a-8 vs. Ensembl Xenopus
Match: atf6b (activating transcription factor 6 beta [Source:Xenbase;Acc:XB-GENE-1013925])

HSP 1 Score: 58.151 bits (139), Expect = 7.794e-8
Identity = 41/143 (28.67%), Postives = 59/143 (41.26%), Query Frame = 2
Query: 1967 RLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTL-VSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQI 2392
            R    IG FL  L  + SA  PN H+LF +  V  G GS ++     + V  YF K   R  LA  L  +G    + +      YL  + GWR A +I G +   +NL  C    R   +  E     + +    +D K   +
Sbjct:  101 RKTAMIGGFLTSLGWVLSAYAPNVHFLFFSFGVTAGIGSGMVYLPAVVTVGHYFQK---RRALAQGLSTTGTGFGTFLITVLLKYLCRELGWRNAMIIQGAV--TLNLCVCGALMRPLDHDEEHLKDHEEAAVDPKDAKEGAL 238          
BLAST of slc16a-8 vs. Ensembl Mouse
Match: Slc16a7 (solute carrier family 16 (monocarboxylic acid transporters), member 7 [Source:MGI Symbol;Acc:MGI:1330284])

HSP 1 Score: 53.5286 bits (127), Expect = 1.388e-6
Identity = 47/194 (24.23%), Postives = 89/194 (45.88%), Query Frame = 2
Query: 1811 RAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQI 2392
            +A  +F  D+    FN+TS +++ WI     A+ Y    +S+ L+  +N   R    +G  L  +  + ++   +   L+LT   + G G +  L     I+ +YF +  P  +     ++G  V       F  YL  +YGW+ +F+ILG I+    ++ C +     S  +++  SK  S +     K+S++
Sbjct:   39 KAVTVFFKDIQE-IFNTTS-SQIAWISSIMLAVMYAGGPISSVLV--NNYGSRPVVIVGGLLCCIGMILASYSNSVIELYLTVGFIGGLGLAFNLQPALTIIGKYFYRRRP--LANGCAMAGSPVFLSTLAPFNQYLFNNYGWKGSFLILGGIFLHSCVAGCLMRPVGPSPNTKKSKSKVGSRHDSTLKKASKV 226          
BLAST of slc16a-8 vs. Ensembl Mouse
Match: Slc16a7 (solute carrier family 16 (monocarboxylic acid transporters), member 7 [Source:MGI Symbol;Acc:MGI:1330284])

HSP 1 Score: 53.5286 bits (127), Expect = 1.388e-6
Identity = 47/194 (24.23%), Postives = 89/194 (45.88%), Query Frame = 2
Query: 1811 RAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQI 2392
            +A  +F  D+    FN+TS +++ WI     A+ Y    +S+ L+  +N   R    +G  L  +  + ++   +   L+LT   + G G +  L     I+ +YF +  P  +     ++G  V       F  YL  +YGW+ +F+ILG I+    ++ C +     S  +++  SK  S +     K+S++
Sbjct:   39 KAVTVFFKDIQE-IFNTTS-SQIAWISSIMLAVMYAGGPISSVLV--NNYGSRPVVIVGGLLCCIGMILASYSNSVIELYLTVGFIGGLGLAFNLQPALTIIGKYFYRRRP--LANGCAMAGSPVFLSTLAPFNQYLFNNYGWKGSFLILGGIFLHSCVAGCLMRPVGPSPNTKKSKSKVGSRHDSTLKKASKV 226          
BLAST of slc16a-8 vs. Ensembl Mouse
Match: Slc16a7 (solute carrier family 16 (monocarboxylic acid transporters), member 7 [Source:MGI Symbol;Acc:MGI:1330284])

HSP 1 Score: 53.5286 bits (127), Expect = 1.388e-6
Identity = 47/194 (24.23%), Postives = 89/194 (45.88%), Query Frame = 2
Query: 1811 RAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQI 2392
            +A  +F  D+    FN+TS +++ WI     A+ Y    +S+ L+  +N   R    +G  L  +  + ++   +   L+LT   + G G +  L     I+ +YF +  P  +     ++G  V       F  YL  +YGW+ +F+ILG I+    ++ C +     S  +++  SK  S +     K+S++
Sbjct:   39 KAVTVFFKDIQE-IFNTTS-SQIAWISSIMLAVMYAGGPISSVLV--NNYGSRPVVIVGGLLCCIGMILASYSNSVIELYLTVGFIGGLGLAFNLQPALTIIGKYFYRRRP--LANGCAMAGSPVFLSTLAPFNQYLFNNYGWKGSFLILGGIFLHSCVAGCLMRPVGPSPNTKKSKSKVGSRHDSTLKKASKV 226          
BLAST of slc16a-8 vs. Ensembl Mouse
Match: Slc16a7 (solute carrier family 16 (monocarboxylic acid transporters), member 7 [Source:MGI Symbol;Acc:MGI:1330284])

HSP 1 Score: 53.5286 bits (127), Expect = 1.388e-6
Identity = 47/194 (24.23%), Postives = 89/194 (45.88%), Query Frame = 2
Query: 1811 RAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQI 2392
            +A  +F  D+    FN+TS +++ WI     A+ Y    +S+ L+  +N   R    +G  L  +  + ++   +   L+LT   + G G +  L     I+ +YF +  P  +     ++G  V       F  YL  +YGW+ +F+ILG I+    ++ C +     S  +++  SK  S +     K+S++
Sbjct:   39 KAVTVFFKDIQE-IFNTTS-SQIAWISSIMLAVMYAGGPISSVLV--NNYGSRPVVIVGGLLCCIGMILASYSNSVIELYLTVGFIGGLGLAFNLQPALTIIGKYFYRRRP--LANGCAMAGSPVFLSTLAPFNQYLFNNYGWKGSFLILGGIFLHSCVAGCLMRPVGPSPNTKKSKSKVGSRHDSTLKKASKV 226          
BLAST of slc16a-8 vs. Ensembl Mouse
Match: Slc16a4 (solute carrier family 16 (monocarboxylic acid transporters), member 4 [Source:MGI Symbol;Acc:MGI:2385183])

HSP 1 Score: 51.2174 bits (121), Expect = 7.784e-6
Identity = 60/253 (23.72%), Postives = 108/253 (42.69%), Query Frame = 2
Query: 1760 LVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKS----------------EEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLAD 2470
            +VL F  +NV F+ G  + F IF       EF  TS  ++ WIG   ++L + +  L  A I+      +    +G FL+    + S+      +L +T  +L G GS+ +     +++ +YF K   R  L+T +   G   + +   F  +LI  Y W  A ++ G I  ++NL    +  R   ++S                E   S K+  + C++   +Q P +   T+ +      T  +L N ++
Sbjct:   23 VVLHFFLVNV-FVMGMTKTFAIFFVVFQE-EFEGTS-EQIGWIGSIMSSLRFSAGPL--AAIICDVLGEKATSILGTFLVSGGYVISSWATGIPFLCVTMGLLPGLGSAFLYQVAAVVITKYFKK---RLGLSTAIARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAI--ILNLVPSSMLLRPIHSQSNNNSDIENKGSILSATEPEASYKTETSKCKE---TQEPFIKDSTMKKSEQPTTTLTVLGNQSE 262          
BLAST of slc16a-8 vs. UniProt/SwissProt
Match: sp|O70451|MOT2_MOUSE (Monocarboxylate transporter 2 OS=Mus musculus OX=10090 GN=Slc16a7 PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 9.712e-6
Identity = 47/194 (24.23%), Postives = 89/194 (45.88%), Query Frame = 2
Query: 1811 RAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQI 2392
            +A  +F  D+    FN+TS +++ WI     A+ Y    +S+ L+  +N   R    +G  L  +  + ++   +   L+LT   + G G +  L     I+ +YF +  P  +     ++G  V       F  YL  +YGW+ +F+ILG I+    ++ C +     S  +++  SK  S +     K+S++
Sbjct:   39 KAVTVFFKDIQE-IFNTTS-SQIAWISSIMLAVMYAGGPISSVLV--NNYGSRPVVIVGGLLCCIGMILASYSNSVIELYLTVGFIGGLGLAFNLQPALTIIGKYFYRRRP--LANGCAMAGSPVFLSTLAPFNQYLFNNYGWKGSFLILGGIFLHSCVAGCLMRPVGPSPNTKKSKSKVGSRHDSTLKKASKV 226          
BLAST of slc16a-8 vs. TrEMBL
Match: A0A0H3YK67 (Slc16a-8 OS=Schmidtea mediterranea OX=79327 GN=slc16a-8 PE=2 SV=1)

HSP 1 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 473/473 (100.00%), Postives = 473/473 (100.00%), Query Frame = 2
Query: 1691 MIKYYMDIENXXXXXXXXXXXXYLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYXXXXXXXXXXXXFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCLASICVLLMGGSKHSKSFNIHDDSSDKKVLLXXXXXXXXXXXNTSPGKKSIEDDLLTVIRNR 3109
            MIKYYMDIENKKPVKQVVKFFPYLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYLIGTIITGLTKKFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCLASICVLLMGGSKHSKSFNIHDDSSDKKVLLDEEDSESDEKENTSPGKKSIEDDLLTVIRNR
Sbjct:    1 MIKYYMDIENKKPVKQVVKFFPYLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYLIGTIITGLTKKFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCLASICVLLMGGSKHSKSFNIHDDSSDKKVLLDEEDSESDEKENTSPGKKSIEDDLLTVIRNR 473          
BLAST of slc16a-8 vs. TrEMBL
Match: A0A267F2B9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001059g2 PE=4 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 1.224e-166
Identity = 259/389 (66.58%), Postives = 312/389 (80.21%), Query Frame = 2
Query: 1757 YLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNST-SLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVC----RDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYXXXXXXXXXXXXFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIF 2908
            +L+LG +A NVIFLGGKRRAFG+FVA LH  EFN T SLAELNWIGDSYAA+GY++TTLST++IL S RR++ FQ +G   ILLAC+TSA VPN HWLFLTHTV HG GSSLILSTVGL+VNE+FDK HP HILATTLVSGGS+ASI+FVQ YAYLI  Y WR AF+ILG+IYF VN+S    F ++      E L   SS   C     +++ S++P L+ W +DR+MTSIVTYGMLLNLADY+RR ES LT S+ LT+LFA+GEASTY I  ++   TK F   RLKYIL V+TF+MA SLVYWE V+SNK LS +LA++SGFC+GPSITFLFPAGEEMTTLPGH+AYPFSL GMG+GMA+SP +TA+IA+ ++Y +FF+IQG LIF
Sbjct:   25 WLILGCAATNVIFLGGKRRAFGVFVAQLH-AEFNGTISLAELNWIGDSYAAVGYMTTTLSTSVILSSGRRFQFFQMLGTLAILLACITSAFVPNPHWLFLTHTVFHGVGSSLILSTVGLVVNEHFDKQHPYHILATTLVSGGSIASILFVQLYAYLIELYTWRNAFIILGVIYFFVNISGSIFFTKR------EELPPYSSNKQCFGAFWEVERSKVPYLLLWFLDRVMTSIVTYGMLLNLADYVRRRESSLTKSSHLTLLFASGEASTYAIAAVLAIATKDFLKGRLKYILSVTTFIMACSLVYWEVVASNKTLSYILAYISGFCMGPSITFLFPAGEEMTTLPGHLAYPFSLAGMGVGMALSPSVTAMIAERYEYRYFFVIQGFLIF 406          
BLAST of slc16a-8 vs. TrEMBL
Match: A0A267F2P5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017080g1 PE=4 SV=1)

HSP 1 Score: 511.531 bits (1316), Expect = 1.552e-166
Identity = 259/389 (66.58%), Postives = 312/389 (80.21%), Query Frame = 2
Query: 1757 YLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNST-SLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVC----RDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYXXXXXXXXXXXXFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIF 2908
            +L+LG +A NVIFLGGKRRAFG+FVA LH  EFN T SLAELNWIGDSYAA+GY++TTLST++IL S RR++ FQ +G   ILLAC+TSA VPN HWLFLTHTV HG GSSLILSTVGL+VNE+FDK HP HILATTLVSGGS+ASI+FVQ YAYLI  Y WR AF+ILG+IYF VN+S    F ++      E L   SS   C     +++ S++P L+ W +DR+MTSIVTYGMLLNLADY+RR ES LT S+ LT+LFA+GEASTY I  ++   TK F   RLKYIL V+TF+MA SLVYWE V+SNK LS +LA++SGFC+GPSITFLFPAGEEMTTLPGH+AYPFSL GMG+GMA+SP +TA+IA+ ++Y +FF+IQG LIF
Sbjct:   18 WLILGCAATNVIFLGGKRRAFGVFVAQLH-AEFNGTISLAELNWIGDSYAAVGYMTTTLSTSVILSSGRRFQFFQMLGTLAILLACITSAFVPNPHWLFLTHTVFHGVGSSLILSTVGLVVNEHFDKQHPYHILATTLVSGGSIASILFVQLYAYLIELYTWRNAFIILGVIYFFVNISGSIFFTKR------EELPPYSSNKQCFGAFWEVERSKVPYLLLWFLDRVMTSIVTYGMLLNLADYVRRRESSLTKSSHLTLLFASGEASTYAIAAVLAIATKDFLKGRLKYILSVTTFIMACSLVYWEVVASNKTLSYILAYISGFCMGPSITFLFPAGEEMTTLPGHLAYPFSLAGMGVGMALSPSVTAMIAERYEYRYFFVIQGFLIF 399          
BLAST of slc16a-8 vs. TrEMBL
Match: A0A5J4NSI4 (MFS domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0008634 PE=4 SV=1)

HSP 1 Score: 511.531 bits (1316), Expect = 8.875e-166
Identity = 275/457 (60.18%), Postives = 344/457 (75.27%), Query Frame = 2
Query: 1757 YLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYXXXXXXXXXXXXFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCLASICVLL---MGGSK---HSKSFNIHDDSSDKKVLLXXXXXXXXXXXNTSPGKKSIEDDLLTVIRNR 3109
            +L+L  SAL+V+FLGGKRRAFGIFVA LH  EFN TSLAELNWIGDSYAALGY++T+LST+LIL + RR+ + Q  GA  ILLAC+TSA VPN HWLF+THT+LHG GSSL+LST GL+VNE+FD+NH  HILATTLVSGGSVA+IVFV+FYAYLI  +GWRKAF+ILG+IYF+V L    VF  K +NK +   S+K  +   R +   +  LLI W +DRIMTS+VTYGMLLNLADYM R E+ L  S  LT LFAAGEASTYLIG ++TG+T+  F NRL++IL+V++ +MA+SL  WEF + N++LSR LAF+ GFCLGPSITFLFPAGEE+T LPGHMAYPFSL GMG+GMA+SP+L+ALIAQ+F Y WFFL+QG L++IK  CL S  ++L   M G     H+   N+ +D   +   +     E  E   +S G +++  +   V RNR
Sbjct:    8 WLILVISALSVVFLGGKRRAFGIFVAQLH-AEFNRTSLAELNWIGDSYAALGYLTTSLSTSLILATGRRFWVSQMFGAIAILLACITSAYVPNPHWLFITHTILHGIGSSLVLSTAGLVVNEHFDENHRYHILATTLVSGGSVAAIVFVEFYAYLIEAFGWRKAFIILGVIYFLVLLIGALVF-EKNANKPDYR-SEKCVLLAQRQLSIRRSSLLILWFVDRIMTSVVTYGMLLNLADYMYRRETSLRRSALLTTLFAAGEASTYLIGAVVTGITRNLFKNRLRFILIVTSCIMALSLTLWEFTADNRNLSRFLAFLCGFCLGPSITFLFPAGEELTMLPGHMAYPFSLGGMGVGMALSPVLSALIAQMFTYRWFFLVQGSLMYIKCACLISSTLILRSMMSGETPYVHTALHNMEEDDGHQTPPV-----ECIENSQSSKGWENLAANKFHVSRNR 456          
BLAST of slc16a-8 vs. TrEMBL
Match: A0A3S5B7D0 (MFS domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS29338 PE=4 SV=1)

HSP 1 Score: 498.049 bits (1281), Expect = 4.790e-161
Identity = 260/391 (66.50%), Postives = 310/391 (79.28%), Query Frame = 2
Query: 1757 YLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRD-IKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYXXXXXXXXXXXXFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCL 2926
            + +L  +ALNVIFLGGKRRAFG+FVA L   EFN+TSLAELNWIGDSYAA+GY++TTLST+LIL+  RRY LFQF GA  +L AC++SA VPN HWLFLTHTVLHG GSSLILST GL+VNE+FDK+H  HILATTLVSGGSVASIVFVQFYA+L+  YGWR A +ILG++YF V  SA  VF +        G+S+   V+  R+ +   QIPLL+ WT+DRI+TSIVTYGMLLNL D+M R E  LT S  LT LFA+GEASTYL+G + TGLTK    NRLKYIL+V+T LM+ SL  WE  +SN  +S +LA++ GFCLGPSITFLFPAGEEMT LPGH+AYPFSL GMG+GM++SP+L+ALIAQIF Y WFFL+Q GL+ IK  CL
Sbjct:   10 WFILSSAALNVIFLGGKRRAFGVFVAQLRD-EFNATSLAELNWIGDSYAAIGYLTTTLSTSLILKLGRRYGLFQFAGACFVLFACVSSAYVPNPHWLFLTHTVLHGIGSSLILSTAGLVVNEHFDKSHRYHILATTLVSGGSVASIVFVQFYAFLVESYGWRHAMIILGVVYFFVIASASLVFRKSVQTT---GVSEGRLVHSWREHLVGRQIPLLVLWTVDRIITSIVTYGMLLNLTDFMHRIEPSLTKSAVLTTLFASGEASTYLLGAMTTGLTKNLLKNRLKYILIVTTLLMSASLAAWEAWASNLLMSHILAYICGFCLGPSITFLFPAGEEMTRLPGHLAYPFSLGGMGLGMSLSPLLSALIAQIFLYKWFFLVQAGLMAIKLICL 396          
BLAST of slc16a-8 vs. Ensembl Cavefish
Match: si:dkey-246g23.4 (monocarboxylate transporter 2-like [Source:NCBI gene;Acc:103034909])

HSP 1 Score: 58.9214 bits (141), Expect = 1.778e-8
Identity = 50/204 (24.51%), Postives = 91/204 (44.61%), Query Frame = 2
Query: 1811 RAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGS-VASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSE-----------EGLSKKSSVNVCRDIKSS 2386
            ++FG+F  ++H   +  T+    +WI     A  +I   + +A+   +   +R    +G  L  +  +  A   N   L++T   + GFG +L  +    ++  YF+K  P   LA  L S G  + + +F  F+  L+ +Y WR A ++LG +   +NL  C    R  ++  +           EGLS+  +     D+K S
Sbjct:   37 KSFGVFYVEIHR--YFGTTATACSWITSISVATVHIGAPVGSAM--SACVGHRAVVMLGGLLSSVGMVAGAFAQNLLQLYITVGFISGFGYALTWTPTVTMLGCYFEKRRP---LANALASTGECIITFLFTPFFQLLVDEYSWRGAMLVLGAVQ--LNLCVCGALLRPLNDPVKMRPAEQDRLELEGLSQTDT-----DLKKS 226          
BLAST of slc16a-8 vs. Ensembl Cavefish
Match: si:dkey-246g23.4 (monocarboxylate transporter 2-like [Source:NCBI gene;Acc:103034909])

HSP 1 Score: 58.9214 bits (141), Expect = 2.027e-8
Identity = 52/204 (25.49%), Postives = 93/204 (45.59%), Query Frame = 2
Query: 1811 RAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGS-VASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSE-----------EGLSKKSSVNVCRDIKSS 2386
            ++FG+F  ++H   F +T+ A  +WI     A  +I   + +A+   +   +R    +G  L  +  +  A   N   L++T   + GFG +L  +    ++  YF+K  P   LA  L S G  + + +F  F+  L+ +Y WR A ++LG +   +NL  C    R  ++  +           EGLS+  +     D+K S
Sbjct:   37 KSFGVFYVEIHR-YFGTTATA-CSWITSISVATVHIGAPVGSAM--SACVGHRAVVMLGGLLSSVGMVAGAFAQNLLQLYITVGFISGFGYALTWTPTVTMLGCYFEKRRP---LANALASTGECIITFLFTPFFQLLVDEYSWRGAMLVLGAVQ--LNLCVCGALLRPLNDPVKMRPAEQDRLELEGLSQTDT-----DLKKS 226          
BLAST of slc16a-8 vs. Ensembl Cavefish
Match: zgc:114041 (monocarboxylate transporter 13-like [Source:NCBI gene;Acc:103030368])

HSP 1 Score: 56.6102 bits (135), Expect = 1.097e-7
Identity = 52/205 (25.37%), Postives = 94/205 (45.85%), Query Frame = 2
Query: 1811 RAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNK-SEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDR 2422
            R FG+F   LH   + S   + ++W+  +  A  ++   ++ AL +   +R  +   IGA L     + ++   +  W++L+  VL G G S        +V+ YF +  P     ++  SG  V S+ F  F+ +LI  Y W+ A +I+G +   +NL  C    R  + K S +G   + S  + +   S + P    W++ R
Sbjct:   33 RNFGLFF--LHIQNYYSVPTSTVSWVTSTGIATFHLGAPVAGALSVYLTQRGVIM--IGAALAASGMIIASFGLSLPWMYLSIGVLQGLGVSFCWMPTNSMVSHYFKRWRPVAFSISS--SGECVFSMAFSPFFQWLIEAYSWQGALLIIGGLQ--LNLWVCGALMRPLTPKASPQGKLMEDSKELDQSGPSKKAPFQ--WSLIR 227          
BLAST of slc16a-8 vs. Ensembl Cavefish
Match: zgc:114041 (monocarboxylate transporter 13-like [Source:NCBI gene;Acc:103030368])

HSP 1 Score: 56.6102 bits (135), Expect = 1.097e-7
Identity = 52/205 (25.37%), Postives = 94/205 (45.85%), Query Frame = 2
Query: 1811 RAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNK-SEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDR 2422
            R FG+F   LH   + S   + ++W+  +  A  ++   ++ AL +   +R  +   IGA L     + ++   +  W++L+  VL G G S        +V+ YF +  P     ++  SG  V S+ F  F+ +LI  Y W+ A +I+G +   +NL  C    R  + K S +G   + S  + +   S + P    W++ R
Sbjct:   33 RNFGLFF--LHIQNYYSVPTSTVSWVTSTGIATFHLGAPVAGALSVYLTQRGVIM--IGAALAASGMIIASFGLSLPWMYLSIGVLQGLGVSFCWMPTNSMVSHYFKRWRPVAFSISS--SGECVFSMAFSPFFQWLIEAYSWQGALLIIGGLQ--LNLWVCGALMRPLTPKASPQGKLMEDSKELDQSGPSKKAPFQ--WSLIR 227          
BLAST of slc16a-8 vs. Ensembl Cavefish
Match: zgc:114041 (monocarboxylate transporter 13-like [Source:NCBI gene;Acc:103030368])

HSP 1 Score: 56.6102 bits (135), Expect = 1.097e-7
Identity = 52/205 (25.37%), Postives = 94/205 (45.85%), Query Frame = 2
Query: 1811 RAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNK-SEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDR 2422
            R FG+F   LH   + S   + ++W+  +  A  ++   ++ AL +   +R  +   IGA L     + ++   +  W++L+  VL G G S        +V+ YF +  P     ++  SG  V S+ F  F+ +LI  Y W+ A +I+G +   +NL  C    R  + K S +G   + S  + +   S + P    W++ R
Sbjct:   33 RNFGLFF--LHIQNYYSVPTSTVSWVTSTGIATFHLGAPVAGALSVYLTQRGVIM--IGAALAASGMIIASFGLSLPWMYLSIGVLQGLGVSFCWMPTNSMVSHYFKRWRPVAFSISS--SGECVFSMAFSPFFQWLIEAYSWQGALLIIGGLQ--LNLWVCGALMRPLTPKASPQGKLMEDSKELDQSGPSKKAPFQ--WSLIR 227          
BLAST of slc16a-8 vs. Ensembl Nematostella
Match: EDO46709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPB5])

HSP 1 Score: 53.5286 bits (127), Expect = 3.153e-7
Identity = 48/172 (27.91%), Postives = 83/172 (48.26%), Query Frame = 2
Query: 1871 AELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGS-VASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVF---ARKFSNKSEEGLSKKSSVNVCRD 2374
            AE  WIG     L ++   L++ L  R + +     FIGA L +L    ++ V     ++LT+ +L G GSSL   +  +I+ EYF K   R  L   + + GS V S+V      YL+ + GW+    +L     ++ ++A F+F    R+ S +  +   K   +++ R+
Sbjct:   45 AETAWIGAMAMGLNFLCGPLTSILCTRYSCQAT--AFIGALLSVLGLFLTSFVQEPPKMYLTYGLLFGVGSSLSFVSSIVILGEYFQK---RLALVNGIATSGSGVGSLVTGPVMNYLLANIGWQNCMRVLSGFAMLLWIAA-FLFKPNKRRVSTRPSKDAGKLVDLSIWRN 210          
BLAST of slc16a-8 vs. Ensembl Nematostella
Match: EDO35238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM28])

HSP 1 Score: 52.373 bits (124), Expect = 8.629e-7
Identity = 53/198 (26.77%), Postives = 83/198 (41.92%), Query Frame = 2
Query: 1802 GKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGS-VASIVFVQFYAYLIVDYGWRK----------AFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVN 2362
            G    FG+   +L   EF     AE  W+G     + ++   L T L  +     RL   +G  +    CL  +V PN + + LT+ ++ G G+S+      +I+  YF+K   R  LA  L S GS V S+        +I   G R           + V++  IY  +N    F+ A K+  K +E   KK  + 
Sbjct:   40 GTMNNFGVIYVELLQ-EFK-VGKAEAAWVGSITYGMMFLLGPLGTTLCKKIG--CRLTTVVGCIIAAGGCLLGSVAPNIYIMDLTYGLMFGVGASMCYFPSVIILGTYFNK---RLSLANGLTSAGSGVGSLAMGPILQKVIEAVGMRNTMRISAAMISSIVLVSAIYRPINTP--FLNAAKYETKHQEANKKKGCLK 228          
BLAST of slc16a-8 vs. Ensembl Nematostella
Match: EDO48615 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ37])

HSP 1 Score: 50.8322 bits (120), Expect = 2.289e-6
Identity = 50/231 (21.65%), Postives = 91/231 (39.39%), Query Frame = 2
Query: 1850 EFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSN-------KSEEGLSKKSSVNVCRDIKSS--QIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSL 2515
            EFN T      W+G    ++ Y    LS    +R   R      +G     ++ + S+  P    ++  +  L G G   I ++  L   +YF K   R  LAT +V+ G+    +    Y  LI   GWR ++ I+G ++ +  +     +  K  +         E+G  ++S    C  +  +  +IP      I   + ++  Y  L +L  + R        S++L
Sbjct:   53 EFNETR-ENAAWVGSIAYSMSYFCAPLSAWCCVRFGCRRT--AIVGTLTCAVSLIISSFAPGLLMMYFIYGALFGIGGGFIHTSGLLTTTKYFYK---RRSLATGIVAAGASIGTLIGPVYQALIDGVGWRNSYRIIGALFSIACILVWVSYDPKVKDGQEDRTVSCEQGSQRRSGSCACPSLDCAVWRIPEYTVVLIAATVEAVGVYVPLAHLVKHCREIGVSAQKSSTL 277          
BLAST of slc16a-8 vs. Ensembl Nematostella
Match: EDO46207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQQ5])

HSP 1 Score: 50.0618 bits (118), Expect = 4.285e-6
Identity = 57/216 (26.39%), Postives = 99/216 (45.83%), Query Frame = 2
Query: 1757 YLVLGFSALNVIFLGGKRRAFGIFV-ADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRY--RLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHI-LATTLVSGG-SVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQ 2389
            ++V   S L +  + G   +FG+ + A L+H  F+  S A+  W+G    ++G     L + +  R   RY  R    +G   I L    ++  PN   +++T+ +L G G+SL  +   +I  +YFDK    H+ LAT +V+ G S+ ++V      +L+   GWR A  IL +    +   AC  F  +   +  E  S   +     + K  +
Sbjct:   52 WMVCAGSFLIMFIVYGIHTSFGVLLNALLNH--FHE-SKAKTAWVG----SIGLNFLFLGSPVTSRVAERYGIRTVTILGGVFISLGLFLTSYAPNIVVIYITYGLLFGSGTSLCGTMALIISVDYFDK----HLSLATGIVAAGCSIGTLVLAPTLQFLVEKLGWRYAVRILAMSGVFI---ACAGFVYRPHERRRETFSNDRATRSLNENKKCE 253          
BLAST of slc16a-8 vs. Ensembl Nematostella
Match: EDO41364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Q5])

HSP 1 Score: 47.7506 bits (112), Expect = 6.760e-6
Identity = 41/115 (35.65%), Postives = 57/115 (49.57%), Query Frame = 2
Query: 1958 RRY--RLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTL-VSGGSVASIVFVQFYAYLIVDYGWR---KAFVILGLIYFVVN 2284
            RRY  R+    GAFL  L  L ++ V     LF+T+ V  G G+S+      L++N YFDK   R  LA  + ++G  V   V     +YLI  YGWR   +   ILG+  F+  
Sbjct:   22 RRYGCRVITCCGAFLAALGLLMTSYVTQLSLLFVTYGVTWGLGASMSYFGSLLVLNSYFDK---RLSLAYGVALAGAGVGVSVVATSMSYLIGSYGWRFAVRLLAILGVFVFLCG 133          
BLAST of slc16a-8 vs. Ensembl Medaka
Match: si:dkey-246g23.4 (monocarboxylate transporter 2 [Source:NCBI gene;Acc:101159501])

HSP 1 Score: 58.9214 bits (141), Expect = 2.178e-8
Identity = 51/205 (24.88%), Postives = 97/205 (47.32%), Query Frame = 2
Query: 1802 GKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGS-VASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARK---------FSNKSEEGLSKKSSVNV-CRDIKS 2383
            G  ++FG+F  ++   ++  T+ A  +WI     A  +++  L++AL  R + R  +    G  +  +  +  +   N   L+LT   L+GFG +L  +    ++  YFDK  P   +A  L S G  + + +    +  LI  + WR A +I+G +   +NL  C +  R          ++ +S +  SKK S ++  RD+++
Sbjct:   41 GVVKSFGVFYVEIQ--QYFGTTAAGTSWITSIAVATIHVAAPLASALSSRYSHRSVVIA--GGLICSVGAILGSFGNNLVQLYLTVGFLNGFGYALTWTPTVTMLGMYFDKRRP---VANALASAGECILTFILTPMFQLLINSFSWRGALLIMGALQ--LNLCVCGLLLRPLKSTRDKELYTEESNQETSKKYSTSLRERDLRT 236          
BLAST of slc16a-8 vs. Ensembl Medaka
Match: si:dkey-246g23.4 (monocarboxylate transporter 2 [Source:NCBI gene;Acc:101159501])

HSP 1 Score: 58.5362 bits (140), Expect = 3.138e-8
Identity = 52/208 (25.00%), Postives = 96/208 (46.15%), Query Frame = 2
Query: 1802 GKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGS-VASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSN-----------KSEEGLSKKSSV-NVCRDIKSS 2386
            G  ++FG+F  ++   ++  T+ A  +WI     A  +++  L++AL   S   +R     G  +  +  +  +   N   L+LT   L+GFG +L  +    ++  YFDK  P   +A  L S G  + + +    +  LI  + WR A +I+G +   +NL  C +  R   +             E+GLS+K  + ++  ++KSS
Sbjct:   41 GVVKSFGVFYVEIQ--QYFGTTAAGTSWITSIAVATIHVAAPLASAL--SSRYSHRSVVIAGGLICSVGAILGSFGNNLVQLYLTVGFLNGFGYALTWTPTVTMLGMYFDKRRP---VANALASAGECILTFILTPMFQLLINSFSWRGALLIMGALQ--LNLCVCGLLLRPLKSTRDVTCVNEGKAEEDGLSRKMLLKDILDEVKSS 239          
BLAST of slc16a-8 vs. Ensembl Medaka
Match: SLC16A6 (solute carrier family 16 member 6 [Source:NCBI gene;Acc:101154956])

HSP 1 Score: 57.3806 bits (137), Expect = 6.845e-8
Identity = 49/159 (30.82%), Postives = 75/159 (47.17%), Query Frame = 2
Query: 1802 GKRRAFGIFVADLHH--GEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNR-RYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLI 2269
            G  +  GIF+ DL    GE NS     ++W+    A +   +  L+T L   SNR  +R    +G FL  L  ++SA   +   +++T  V+ GFG  L       I+ +YF +   R ++     SG S A   F   ++ L  D GWR   VI+G+I
Sbjct:   40 GVVKTLGIFLQDLMEEFGESNS----RVSWVISICAFIMTFTAPLATML---SNRFGFRPVVMMGGFLTCLGTISSAFTSSIKDMYITIGVISGFGYCLSFLPTVTILAQYFCRR--RSLVTAVASSGESFAVFAFAPVFSRLKEDIGWRYCLVIMGVI 189          
BLAST of slc16a-8 vs. Ensembl Medaka
Match: slc16a9a (solute carrier family 16 member 9 [Source:NCBI gene;Acc:101165170])

HSP 1 Score: 55.8398 bits (133), Expect = 2.163e-7
Identity = 39/146 (26.71%), Postives = 68/146 (46.58%), Query Frame = 2
Query: 1883 WIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFS 2320
            W+G   A +G I++ + +A +   N   R   F    ++    + SA  PN  +L  ++ ++ G G  L+ S    I  +YFDK   R +    + +G S+ + ++      LIV +G     +I+G I   +NL AC  F R  +
Sbjct:   54 WVGSLVAGVGLIASPICSACV--DNFGARPVTFFSGVMVAGGLMLSAFAPNVPFLMFSYGIVVGLGCGLVYSATLTITCQYFDKR--RGLALGIVTTGTSIGAFIYATAQNELIVFFGLDGCLLIIGAI--ALNLMACAGFMRPLN 193          
BLAST of slc16a-8 vs. Ensembl Medaka
Match: zgc:114041 (monocarboxylate transporter 13 [Source:NCBI gene;Acc:101160486])

HSP 1 Score: 50.447 bits (119), Expect = 9.491e-6
Identity = 37/131 (28.24%), Postives = 60/131 (45.80%), Query Frame = 2
Query: 1967 RLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKF-SNKSEEGLSKKSS 2356
            R+   +G  L     L +++  +  WL+ +  +L G G S    +   +VN YF +  P     T+  SG  V + +F  F+ +LI  Y WR A +I+G +   +NL  C    R   S +S  GL   + 
Sbjct:   81 RVVIMVGGLLCTFGMLLASLDLSLPWLYFSMGILEGIGLSFSWVSAMSVVNHYFARWRPIAYAITS--SGECVFAFIFSPFFKWLIEMYTWRGALLIIGGLQ--LNLCVCGALMRPLDSTESTAGLETDAD 207          
BLAST of slc16a-8 vs. Planmine SMEST
Match: SMESG000026692.1 (SMESG000026692.1)

HSP 1 Score: 863.603 bits (2230), Expect = 0.000e+0
Identity = 468/468 (100.00%), Postives = 468/468 (100.00%), Query Frame = 2
Query: 1706 MDIENXXXXXXXXXXXXYLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYXXXXXXXXXXXXFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCLASICVLLMGGSKHSKSFNIHDDSSDKKVLLXXXXXXXXXXXNTSPGKKSIEDDLLTVIRNR 3109
            MDIENKKPVKQVVKFFPYLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYLIGTIITGLTKKFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCLASICVLLMGGSKHSKSFNIHDDSSDKKVLLDEEDSESDEKENTSPGKKSIEDDLLTVIRNR
Sbjct:    1 MDIENKKPVKQVVKFFPYLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYLIGTIITGLTKKFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCLASICVLLMGGSKHSKSFNIHDDSSDKKVLLDEEDSESDEKENTSPGKKSIEDDLLTVIRNR 468          
BLAST of slc16a-8 vs. Planmine SMEST
Match: SMESG000070297.1 (SMESG000070297.1)

HSP 1 Score: 494.967 bits (1273), Expect = 6.318e-164
Identity = 264/383 (68.93%), Postives = 311/383 (81.20%), Query Frame = 2
Query: 1757 YLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYXXXXXXXXXXXXFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLI 2905
            +++L F+A+NVIFLGGKRRAFGIFVA+ HHGEF + SLAELNWIGDSYAALGY++TT+ST LIL  +RR++LFQFIGA  +LLAC+TSA+V NAHWLFLTHTV HG GSSLILST+GL+VNE+F K H  H+LATTLVSGGS+ASIVFVQFYA+LI  +GWR AF+ILG+IYF++N S   +F R   + S      + S+N    I     PLLIFWT+DRI+T+IVTYGMLLNLADY+RRSE  LT+STSLTVLFA+GEASTYLIG +IT +TK FF NRLKYILLV T  M+ SL+ WEF   NK L+  LAF SGF LGPSITFLFPAGEEMT LPGH+AYPFSL GMGIGM +SP L+A+IA  F+Y  FFLIQG LI
Sbjct:   18 WIILFFAAINVIFLGGKRRAFGIFVAEFHHGEFRNISLAELNWIGDSYAALGYLTTTISTTLILNCDRRFKLFQFIGACFVLLACITSAMVTNAHWLFLTHTVFHGIGSSLILSTIGLVVNEHFGKTHKYHLLATTLVSGGSIASIVFVQFYAFLIEHFGWRTAFIILGVIYFIINCSGSCIFQRNM-DISTSYKPNRCSLNWDEHITKKHFPLLIFWTLDRIITTIVTYGMLLNLADYLRRSEHTLTSSTSLTVLFASGEASTYLIGAVITAVTKDFFKNRLKYILLVCTGFMSFSLIVWEFFVLNKSLTHFLAFSSGFFLGPSITFLFPAGEEMTLLPGHLAYPFSLGGMGIGMLLSPTLSAVIASAFEYRGFFLIQGCLI 399          
BLAST of slc16a-8 vs. Planmine SMEST
Match: SMESG000046854.1 (SMESG000046854.1)

HSP 1 Score: 489.189 bits (1258), Expect = 5.829e-161
Identity = 265/413 (64.16%), Postives = 329/413 (79.66%), Query Frame = 2
Query: 1757 YLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYXXXXXXXXXXXXFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCLASICVLL-MGGSKHSKSFNIHDD 2992
            +++L FSALNVIFLGGKRRAFGIF+A+LH+G FN+TSLAELNWIGDSYAALGY++TT+STA+I+R +R+YR+FQFIGA  IL+ACL SA V +AHWLFLTHTV HG GSSLILS VGL+V E+FD NH  HILATTLVSGGS+ASIVFVQFYAYLI  YGWRKAFV+LG +YF++NL+   VF +K S+K+        S  + + I    + LLI WT+DRI+TSIVTYGMLLNLADY+RR+ S L  STSLT+LFAAGEA+TY+ G I++ LTKK+F ++LKY+LL+S+ LM + L  WE ++SN   S +L++ SGFCLGPSITFLFPAGEE+TTLPG +AYPFSL GMG+GM +SP+L+A+IAQ + Y WFFL+QG L+  K  CL   CV+L    S  S   NI +D
Sbjct:   37 WIILLFSALNVIFLGGKRRAFGIFIAELHNGVFNTTSLAELNWIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHGIGSSLILSVVGLVVGEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVVVFQKKSSSKASNSRLTNLSSKLRQLINKETLVLLILWTLDRIVTSIVTYGMLLNLADYLRRNSSSLNTSTSLTMLFAAGEATTYIQGAIVSALTKKWFASKLKYLLLISSLLMVICLFAWEILASNFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAGMGLGMLLSPVLSAVIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRWRSVLSIGRNIQED 449          
BLAST of slc16a-8 vs. Planmine SMEST
Match: SMESG000026519.1 (SMESG000026519.1)

HSP 1 Score: 450.284 bits (1157), Expect = 6.222e-147
Identity = 234/397 (58.94%), Postives = 299/397 (75.31%), Query Frame = 2
Query: 1757 YLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYXXXXXXXXXXXXFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCLASICVLL 2947
            +++L F+ALNVIFLGGKRRAFG FVA++   ++ + +L ELNWIGDSYAA+GY+++ +S A+IL   RRY +FQF+GA  +L++C+TS+ VPN HWLFLTHT+ HG GSSLI+STVGL+VN++FD  HP HILATTLVSGGSVASI+FV  +A LI  YGWR AF+ILG +YF+VN SA   F RK +N+ E+   K  S      IK   IPLL  W IDR+MTS+VTYG+LLNL DYM R+E  L  ST+LT LFA+GEA TYLIG  IT +T+ FF ++L+YILL ++F M++ L+  E+      +  +L F++GF LGPSITFLFPAGEE+T LPGHMAYP SL GMG GM VSP+LTA IA+IF Y WFF +QG LI IK   + +I ++L
Sbjct:   18 WVILFFAALNVIFLGGKRRAFGSFVAEMRR-DYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFF-RKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILIL 412          
BLAST of slc16a-8 vs. Planmine SMEST
Match: SMESG000026516.1 (SMESG000026516.1)

HSP 1 Score: 437.958 bits (1125), Expect = 2.034e-142
Identity = 240/422 (56.87%), Postives = 307/422 (72.75%), Query Frame = 2
Query: 1757 YLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCR---DIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYXXXXXXXXXXXXFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGC-LASICVLLMGGSKHSKSFNIHDDSSDKKV 3010
            +++L F+A+NVIFLGGKRRAFG FVA  H  E+ + SL ELNWIGDSY+A+GY+ST+LS ++I+  NRRY LFQF+GA  +L++C+TS+ VPN HWLFLTHT+ HG GSSLI+ST GL+VNEYFDK H  HILATTLVSGGSVASI+FV  ++ LI  YGWRK F+ILG+IYFVV   A F F +   NK  + +S K  + +C+   +IKS QIPL+IFW  DRIMTS+VTYG+LLNL DY+ +    L  S+ LT++FA+GEA TYLIG++IT +TK FF  +L+YILLV++  M++ L+  E+ S    + RLL F +GF LGPSITFLFPAGEE T LPGH+AYP SL GMG GM +SP+LTA I ++ DY WFF +QG  I  K  C L +I +L     K  +   + DD     V
Sbjct:   19 WIILAFAAINVIFLGGKRRAFGSFVAQFHK-EYPNISLTELNWIGDSYSAIGYMSTSLSISIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVTLFSKLIEHYGWRKTFIILGIIYFVVCSLAAFFFKK---NKDLKEISSKGKM-LCQGQWNIKSIQIPLIIFWFTDRIMTSVVTYGLLLNLTDYVYQGHKDLMKSSILTIIFASGEAVTYLIGSVITAITKDFFKEKLRYILLVTSLSMSICLIILEYTSHIVSIRRLLCFFAGFSLGPSITFLFPAGEEFTRLPGHLAYPVSLGGMGFGMIISPLLTAKIIELLDYRWFFFVQGCFILFKSSCLLVNIIILHFFIQKIEEPPQLTDDEKSPLV 435          
The following BLAST results are available for this feature:
BLAST of slc16a-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SLC16A142.170e-631.25solute carrier family 16 member 14 [Source:HGNC Sy... [more]
SLC16A142.319e-631.25solute carrier family 16 member 14 [Source:HGNC Sy... [more]
SLC16A142.767e-631.25solute carrier family 16 member 14 [Source:HGNC Sy... [more]
SLC16A45.564e-626.87solute carrier family 16 member 4 [Source:HGNC Sym... [more]
back to top
BLAST of slc16a-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc16a6b2.647e-629.01solute carrier family 16 member 6b [Source:ZFIN;Ac... [more]
si:dkey-246g23.46.972e-623.08si:dkey-246g23.4 [Source:ZFIN;Acc:ZDB-GENE-050419-... [more]
back to top
BLAST of slc16a-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atf6b7.794e-828.67activating transcription factor 6 beta [Source:Xen... [more]
back to top
BLAST of slc16a-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc16a71.388e-624.23solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a71.388e-624.23solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a71.388e-624.23solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a71.388e-624.23solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a47.784e-623.72solute carrier family 16 (monocarboxylic acid tran... [more]
back to top
BLAST of slc16a-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|O70451|MOT2_MOUSE9.712e-624.23Monocarboxylate transporter 2 OS=Mus musculus OX=1... [more]
back to top
BLAST of slc16a-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YK670.000e+0100.00Slc16a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A267F2B91.224e-16666.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F2P51.552e-16666.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A5J4NSI48.875e-16660.18MFS domain-containing protein OS=Paragonimus weste... [more]
A0A3S5B7D04.790e-16166.50MFS domain-containing protein (Fragment) OS=Protop... [more]
back to top
BLAST of slc16a-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-246g23.41.778e-824.51monocarboxylate transporter 2-like [Source:NCBI ge... [more]
si:dkey-246g23.42.027e-825.49monocarboxylate transporter 2-like [Source:NCBI ge... [more]
zgc:1140411.097e-725.37monocarboxylate transporter 13-like [Source:NCBI g... [more]
zgc:1140411.097e-725.37monocarboxylate transporter 13-like [Source:NCBI g... [more]
zgc:1140411.097e-725.37monocarboxylate transporter 13-like [Source:NCBI g... [more]
back to top
BLAST of slc16a-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO467093.153e-727.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352388.629e-726.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486152.289e-621.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462074.285e-626.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413646.760e-635.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc16a-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-246g23.42.178e-824.88monocarboxylate transporter 2 [Source:NCBI gene;Ac... [more]
si:dkey-246g23.43.138e-825.00monocarboxylate transporter 2 [Source:NCBI gene;Ac... [more]
SLC16A66.845e-830.82solute carrier family 16 member 6 [Source:NCBI gen... [more]
slc16a9a2.163e-726.71solute carrier family 16 member 9 [Source:NCBI gen... [more]
zgc:1140419.491e-628.24monocarboxylate transporter 13 [Source:NCBI gene;A... [more]
back to top
BLAST of slc16a-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026692.10.000e+0100.00SMESG000026692.1[more]
SMESG000070297.16.318e-16468.93SMESG000070297.1[more]
SMESG000046854.15.829e-16164.16SMESG000046854.1[more]
SMESG000026519.16.222e-14758.94SMESG000026519.1[more]
SMESG000026516.12.034e-14256.87SMESG000026516.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30019793
GenBankAKN21503.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019793 ID=SMED30019793|Name=slc16a-8|organism=Schmidtea mediterranea sexual|type=transcript|length=3569bp
CTCTTCCGATCTTGTCAATTGATGAAAAAATCATTGAAATCAATACAAAA
AAATAACTTACAAAAACCAATTCTGTTTTATTGATTTTTAGAATTTTTAT
TGTGTAAAGTGCCACGATTGGTGCAGTATTGCACTGTTAATGTCTGTCGC
GAACGTGTGCAGTGCACATTCGGTTACGTCATCCGTGTGCGCGTAATGCG
ATTTTATCGCACTTTAACTTTTCTATGTTTAGTATACATTTTGTTTTTAC
AAATGCTTTCTGACATTTCAATAACTCATTTAGACATCTGCTACTCGATA
TTACTCTTAATTTACCCATTCAGTTAGCTTTTTCTTTTTAAGGTTACGTG
TAATTGGGCTTTAGAAATTTGGCAAGCAATTGATGAATGGAGTTTATTGC
ATGTACCCAGCTGTTATAGTGTTAGTTAGTGGCTCTTTGAAGCACCGACG
TCCTCCATCGGCAAAAATAGGAGCTGAAGCTCGTAAAAATTGTTCATGGC
ATTTTTAACGAAAGTTCAAAATAATCTGTAAAATGACTTTTTTAGCGGGG
AATTTTGGTTTCAGTATTTTCTACGGGTCAAACAGGTCGTTGGATTTTTA
TAGTCACATGAGATATTATATTTTCTACATGCAAAATTTAAATAGGAAAT
TTTGGTCTCAGTATTTTTAAACATAAAGCGAATATTTTTGAATAGGAAAT
TTGGAATCTTAATTAAAAACGTGTAATTAATTTATACACGCAAAATTTAT
ACGAACTTACATGTATACGCAATTTTGATTTTATTGACAACAAGAAGATT
CCATATGTTCTATAAATATATTAATACTCACTGAGCTGCAAAATCATCAG
AGTAGGTATTGTTTTTTGCATCCAATCATAACCCTAAAAGTTATTATAAT
TATTGCTTATATTCTCTTAAGATCACTTAATCAAATAGGTCTCCTTAAAA
GAACAAAACTTCCCCCTTAAGCACTGTAGAAATCTATTCAAATTTCCTTA
AATGACCCCGATTCTTCTATTTACTTATTTTAATTCCGTTATTCATTTAA
TTATAACCTTTAGTATTCATTTAAATACCCACTTGGGATTAAATCCACCC
ACTATAAACCTCTCACTGAAACTCAATACTATCCAGGCTTTTAAATACCC
TCAGAAAAATGTCTCCAATAAAGATCAAGTTATTTAAAAGATTATAAAAC
TCCTCCATTGAAATCCTCATTGTAACCTTAACAACTAAATTCAAGAGAAT
CCTCAAAAAATATCATATTGATAACCCTTTCCTAGATCATATTTCTTCAT
GATTCCTTTATGATACTCAAGAGATTATAGTCTGATATACCTTTAAAACT
TAAATTCCCCAAAATAATCACAAATGTCCGGAGATTCTAGGATGATTTGC
ATGCAAATCTCAGAAATACTTCAATAATTACTACATCATAAAACTTTGAT
AAAATTATCAAGTTTTCCATTGTTTTTTTGCAATATTTCAATTAAAAAAT
TCACTATTGAAATGTATAAATTTACTAAGGAGGAATTGCTCATTGAAGAA
GAAATTATTCTTAGAAAAGATAAAGATATTGAGAAATATCAAATTATCCG
TCAAAATTGGAAAACATTACCACCACCCAAATCCCCTAAGTTACGTTCAT
CAATACTCAACACAGGAAATAAACCTTTTTTCGAAAAAGAATGATCAAGT
ACTACATGGACATAGAAAATAAGAAACCTGTAAAGCAAGTAGTGAAATTC
TTTCCTTATTTAGTTTTAGGATTTTCCGCGTTAAATGTGATTTTCTTGGG
TGGAAAACGGCGCGCTTTTGGGATATTTGTAGCCGATTTGCACCATGGAG
AATTTAATTCAACCTCATTGGCTGAATTGAATTGGATTGGAGATTCCTAT
GCTGCGCTCGGATACATTTCTACAACTCTATCAACAGCATTAATCCTTCG
GTCAAATCGTCGATACAGATTATTTCAATTTATTGGCGCTTTTCTAATTC
TTCTTGCGTGTCTAACAAGCGCCGTAGTTCCGAATGCTCATTGGCTGTTT
CTCACGCACACCGTTCTACACGGATTCGGCTCTAGTCTCATTCTAAGCAC
AGTTGGATTGATTGTTAACGAATATTTCGATAAGAATCATCCTAGGCATA
TCTTGGCAACGACTCTCGTTTCTGGAGGTTCTGTCGCTTCGATCGTTTTT
GTTCAGTTCTACGCGTACTTGATCGTGGATTACGGCTGGCGGAAAGCTTT
CGTCATTCTCGGCTTGATTTATTTCGTTGTGAATTTGAGTGCTTGTTTTG
TATTTGCGCGAAAGTTCAGTAACAAGTCAGAAGAGGGGTTATCCAAGAAA
TCGTCAGTAAATGTATGTAGGGATATCAAATCATCACAGATCCCGTTGTT
GATCTTCTGGACAATAGATCGGATCATGACGAGCATTGTAACCTACGGAA
TGCTTCTAAACCTCGCCGATTATATGCGAAGATCGGAAAGTAAATTAACG
AACAGTACTTCTCTTACAGTTCTGTTTGCGGCTGGAGAGGCAAGCACCTA
TTTGATTGGCACTATCATCACCGGATTGACCAAGAAATTCTTTCATAATC
GACTGAAATATATTCTGTTGGTGTCGACATTTCTCATGGCGGTTTCATTG
GTCTACTGGGAGTTCGTTTCGTCCAACAAGCATCTAAGTCGACTTCTTGC
TTTTGTCAGTGGATTCTGTCTCGGACCGTCTATCACATTTTTGTTCCCAG
CCGGTGAGGAAATGACAACCTTACCCGGTCATATGGCATATCCATTCTCT
TTATTTGGGATGGGAATCGGCATGGCGGTTTCACCGATTCTTACCGCTCT
GATTGCCCAGATCTTTGATTACAATTGGTTTTTTCTGATTCAAGGAGGCC
TCATCTTCATCAAGTTCGGCTGTTTGGCGTCGATCTGTGTTCTGCTTATG
GGGGGCTCCAAACACTCGAAATCGTTCAATATCCACGATGATAGCTCGGA
TAAAAAAGTGCTTCTCGACGAAGAGGACTCAGAATCAGATGAGAAAGAGA
ATACCAGTCCCGGAAAAAAGAGCATTGAAGATGACCTGCTAACTGTGATC
AGAAATCGATAAATATTCTAGTAAAACTATGGTGACTTTTTGGGGTTTTT
TCTTTTATTATGTGAGATTTTGTGTGTGTTTGCTGGTAATTGTTGTGCTT
GGATGGATTTATTGGTGAATATTGATTGTAATCATAATGATCCCAGTTGC
CGATCAAGTATTTCACATTTGTGTTGACGCAATCTTGATCATTTCGGCAG
TAGTCTTTGGTTGGATTCATTGGTTGTCTAGTGTAACCGTTGTTAATCTT
ACTTGATAGAGTGCTACCGATGTTGATTGTGTTCACTTCTCGTCCATTTC
AACAATTGTTTTAATACATTAATTTTATTGTTTTTCATTCTGTACAATTA
GGTAATTATGTGGTAATTATTTTGTTGGGCGGGACTACATTTTTTTCAAA
CATTATTTCCTATTGTTAATAAATAAATTGTAATATTTTCAATTAAAATA
ACTATTAATTAAAACAAAT
back to top

protein sequence of SMED30019793-orf-1

>SMED30019793-orf-1 ID=SMED30019793-orf-1|Name=SMED30019793-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=474bp
MIKYYMDIENKKPVKQVVKFFPYLVLGFSALNVIFLGGKRRAFGIFVADL
HHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGA
FLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNH
PRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLS
ACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIV
TYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYLIGTIITGLTKKF
FHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITF
LFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLI
QGGLIFIKFGCLASICVLLMGGSKHSKSFNIHDDSSDKKVLLDEEDSESD
EKENTSPGKKSIEDDLLTVIRNR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 51..350
e-value: 3.3E-15
score: 55.9
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 233..422
e-value: 6.2E-8
score: 34.1
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 18..213
e-value: 8.1E-12
score: 46.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 433..463
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 24..415
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 23..412
e-value: 8.04528E-15
score: 73.3556
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 399..421
NoneNo IPR availableTMHMMTMhelixcoord: 367..389
NoneNo IPR availableTMHMMTMhelixcoord: 20..37
NoneNo IPR availableTMHMMTMhelixcoord: 154..176
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 186..205
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 336..355
NoneNo IPR availableTMHMMTMhelixcoord: 120..142
NoneNo IPR availableTMHMMTMhelixcoord: 273..295
NoneNo IPR availableTMHMMTMhelixcoord: 307..326
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 25..428
score: 11.526
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 15..413