Oxalate:formate antiporter

Overview
NameOxalate:formate antiporter
Smed IDSMED30019784
Length (bp)2648
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Oxalate:formate antiporter (SMED30019784) t-SNE clustered cells

Violin plots show distribution of expression levels for Oxalate:formate antiporter (SMED30019784) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Oxalate:formate antiporter (SMED30019784) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Oxalate:formate antiporter (SMED30019784) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019784

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30019784SMESG000069668.1 dd_Smed_v4_10829_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019784SMESG000069669.1 dd_Smed_v4_9243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Oxalate:formate antiporter vs. Ensembl Celegans
Match: Y59A8B.21 (pep chromosome:WBcel235:V:17986260:17994546:1 gene:WBGene00013353.1 transcript:Y59A8B.21.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y59A8B.21)

HSP 1 Score: 101.679 bits (252), Expect = 2.496e-22
Identity = 101/421 (23.99%), Postives = 194/421 (46.08%), Query Frame = 2
Query: 1238 NQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQDSII-----------YKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQN-------------YSPE-ASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTL-KVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLV 2422
            N+  +I+ GA  I LT+G ++T GN+ P + ++M+N++    SV +E+ +WI          A+ +GG       P  +  IG ++++ ++ L    ++   ++  I YGL+ G G G+AY  ++ T + + P   G+I GIV +G   SS IF  +Q  I+           Y  +  +++R+P  F  L  IY ++Q +  I++       ++ RS+++               P   +D D  +     ++L +P             F+ L+  +F  SF  ++  +L+  Y    + +  F + +  +IA + N   RI WG+  D+ SF++ +   T   S  +  +P+   L K++     F  W +     +  T ++F     K FG ++   NYG L  S +  G +++ +
Sbjct:   22 NRICVILFGAVSIHLTIGTYHTFGNMLPYMASYMRNFT--DPSVRIEHMMWI-PTFQGCFPFAMVIGGLTSSTFSPRVSAFIGCFLVTSSVALSAYAIQHSFALFFIVYGLLFGLGSGIAYVTAVSTAINWAPDKIGVISGIVAAGFGLSSSIFAPIQTMIVNPLNLPATKDGYFLQPELLHRVPALFTKLAVIYGIMQAMALIVVCD--PPFRKSRSTESILEEDDEDMDEDYERPVFDNDEDTTIQMTSSEMLKSP------------TFYCLFASLFCCSFYANMFYNLYKTYGESFIEDDMF-MAMAFSIASVANAIARIGWGYLTDRTSFQIALSTATCLASVFLLTMPMTRELGKMA-----FLFWLVGTFICMGATHALFITATVKCFGNRHKANNYGYLILSTTTSGILLAAI 419          

HSP 2 Score: 59.6918 bits (143), Expect = 6.236e-9
Identity = 41/163 (25.15%), Postives = 84/163 (51.53%), Query Frame = 1
Query:   19 RMYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIP---GLVLFGTGASLSLGGFIEKKIGPSLTILVGGWXXXXXXXXXXXXXXXYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDLM 498
            R+ + + G   +++T+G +++ G+   ++ +YM+N +     + +  + WIP   G   F    ++ +GG       P ++  +G +L++ +  L++  I     +  I YGL+ G G GIAY       + W P   G++ G+V +G+G+S  +F  IQ ++
Sbjct:   23 RICVILFGAVSIHLTIGTYHTFGNMLPYMASYMRNFTDPSVRIEH--MMWIPTFQGCFPF----AMVIGGLTSSTFSPRVSAFIGCFLVTSSVALSAYAIQHSFALFFIVYGLLFGLGSGIAYVTAVSTAINWAPDKIGVISGIVAAGFGLSSSIFAPIQTMI 179          
BLAST of Oxalate:formate antiporter vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 94.7449 bits (234), Expect = 4.716e-20
Identity = 105/445 (23.60%), Postives = 195/445 (43.82%), Query Frame = 2
Query: 1163 CFF*STANSFYVNEVI*RKDMFIEK----NQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQ--NYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQDSII----YK-------GKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVS-WHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPE 2443
            CF   T +SF+    +   D  +++     + + +++G     +T G  YT GN+ P +V++ +   Y   +T       +W+   LL G+   + +GG +E + G     L+G  + +  +   F +++   +  +++ G I   G  +AY   L T  ++FP   GL  GI++ G    + I   +Q + I    Y+        +E ++ R+P  F+++   ++V Q +G I + +   D   E  +   +      +Q   +P+L+                  F +L++ +  N+  V L + L+  Y    + ++ F L +I +I+ IFN   R+FWG   D  S++  M I+    + +   +P++  +      L T  + F  I     GTFSIFP +  K F    F   YG L  + SV G I  L+      E
Sbjct:    3 CF---TCSSFFGRLPMETDDPILKRLPRGARPWAVLVGGVMCMVTFGIVYTCGNLLPYLVSYFRWKMYPDMRTG----QLIWL-QTLLSGLPMGMVIGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVNDQGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPEGDIHVETENLIGTNSEIRVEQARVWPQLRTTT---------------FLVLFLSLTCNAVWVQLTSGLYKAYGQQFI-DSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSIVCSLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCI----GGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSE 419          

HSP 2 Score: 62.7734 bits (151), Expect = 7.160e-10
Identity = 43/134 (32.09%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  810 RIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLS---GIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVSSSLLLIAFMLT 1202
            R+FWG I D  +++ ++ I+C    +   ++PL+ ++S        VL+LA +  M S   G F+IFP I  K F   +F   YG +    SV G I  LIS        L +  +  LFIV    +L +  LT
Sbjct:  318 RVFWGAIADTTSYQFSMSIVCSLGAVLAFSMPLVKMVSND------VLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLIS-----THALSEIGFEYLFIVCGCFMLTSLFLT 440          
BLAST of Oxalate:formate antiporter vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 94.3597 bits (233), Expect = 5.563e-20
Identity = 99/415 (23.86%), Postives = 183/415 (44.10%), Query Frame = 2
Query: 1241 QNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQ--NYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQDSII----YK-------GKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVS-WHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPE 2443
            + + +++G     +T G  YT GN+ P +V++ +   Y   +T       +W+   LL G+   + +GG +E + G     L+G  + +  +   F +++   +  +++ G I   G  +AY   L T  ++FP   GL  GI++ G    + I   +Q + I    Y+        +E ++ R+P  F+++   ++V Q +G I + +   D   E  +   +      +Q   +P+L+                  F +L++ +  N+  V L + L+  Y    + ++ F L +I +I+ IFN   R+FWG   D  S++  M I+    + +   +P++  +      L T  + F  I     GTFSIFP +  K F    F   YG L  + SV G I  L+      E
Sbjct:   16 RPWAVLVGGVMCMVTFGIVYTCGNLLPYLVSYFRWKMYPDMRTG----QLIWL-QTLLSGLPMGMVIGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVNDQGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPEGDIHVETENLIGTNSEIRVEQARVWPQLRTTT---------------FLVLFLSLTCNAVWVQLTSGLYKAYGQQFI-DSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSIVCSLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCI----GGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSE 405          

HSP 2 Score: 62.7734 bits (151), Expect = 7.156e-10
Identity = 43/134 (32.09%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  810 RIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLS---GIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVSSSLLLIAFMLT 1202
            R+FWG I D  +++ ++ I+C    +   ++PL+ ++S        VL+LA +  M S   G F+IFP I  K F   +F   YG +    SV G I  LIS        L +  +  LFIV    +L +  LT
Sbjct:  304 RVFWGAIADTTSYQFSMSIVCSLGAVLAFSMPLVKMVSND------VLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLIS-----THALSEIGFEYLFIVCGCFMLTSLFLT 426          
BLAST of Oxalate:formate antiporter vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693542:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 94.3597 bits (233), Expect = 5.563e-20
Identity = 99/415 (23.86%), Postives = 183/415 (44.10%), Query Frame = 2
Query: 1241 QNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQ--NYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQDSII----YK-------GKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVS-WHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPE 2443
            + + +++G     +T G  YT GN+ P +V++ +   Y   +T       +W+   LL G+   + +GG +E + G     L+G  + +  +   F +++   +  +++ G I   G  +AY   L T  ++FP   GL  GI++ G    + I   +Q + I    Y+        +E ++ R+P  F+++   ++V Q +G I + +   D   E  +   +      +Q   +P+L+                  F +L++ +  N+  V L + L+  Y    + ++ F L +I +I+ IFN   R+FWG   D  S++  M I+    + +   +P++  +      L T  + F  I     GTFSIFP +  K F    F   YG L  + SV G I  L+      E
Sbjct:   16 RPWAVLVGGVMCMVTFGIVYTCGNLLPYLVSYFRWKMYPDMRTG----QLIWL-QTLLSGLPMGMVIGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVNDQGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPEGDIHVETENLIGTNSEIRVEQARVWPQLRTTT---------------FLVLFLSLTCNAVWVQLTSGLYKAYGQQFI-DSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSIVCSLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCI----GGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSE 405          

HSP 2 Score: 62.7734 bits (151), Expect = 7.156e-10
Identity = 43/134 (32.09%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  810 RIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLS---GIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVSSSLLLIAFMLT 1202
            R+FWG I D  +++ ++ I+C    +   ++PL+ ++S        VL+LA +  M S   G F+IFP I  K F   +F   YG +    SV G I  LIS        L +  +  LFIV    +L +  LT
Sbjct:  304 RVFWGAIADTTSYQFSMSIVCSLGAVLAFSMPLVKMVSND------VLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLIS-----THALSEIGFEYLFIVCGCFMLTSLFLT 426          
BLAST of Oxalate:formate antiporter vs. UniProt/SwissProt
Match: sp|P37662|YHJX_ECOLI (Uncharacterized MFS-type transporter YhjX OS=Escherichia coli (strain K12) OX=83333 GN=yhjX PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 5.358e-9
Identity = 92/403 (22.83%), Postives = 175/403 (43.42%), Query Frame = 2
Query: 1235 KNQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKS-YLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQDSIIYKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVI-----VTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVG---GTIIS 2416
            +   +L ++G    Q  LG  YT         +      S++    +    + FG+L LG+  + S+ G ++ + G  +  +  G ++       F+T  S  L ++ +S G++ G   G  Y ++L   +K+FP+ KGLI    +      S+ F  +   ++    E +   L  +F+I G I  ++ + G+ LMK   K +           + S+G  + D+   + +  P             +W+L  +MFL + C+S    L+    A  + ++  +L V+     VT+  I N  GR+  G   DK     +  I  +TI  +I ++ + + L    +  TF      + F   GT ++FP +  + FG+     NYG+++    +G   G+II+
Sbjct:    7 QRTRWLTLIGTIITQFALGSVYT--------WSLFNGALSAKLDAPVSQVAFSFGLLSLGLAISSSVAGKLQERFGVKRVTMASGILLGLG---FFLTAHSDNLMMLWLSAGVLVGLADGAGYLLTLSNCVKWFPERKGLISAFAIGSYGLGSLGFKFIDTQLL----ETV--GLEKTFVIWGAIALLMIVFGATLMKDAPKQE----------VKTSNGVVEKDYTLAESMRKP------------QYWML-AVMFLTA-CMS---GLYVIGVAKDIAQSLAHLDVVSAANAVTVISIANLSGRLVLGILSDK-----IARIRVITIGQVISLVGMAALLFAPLNAVTFFAAIACVAFNFGGTITVFPSLVSEFFGLNNLAKNYGVIYLGFGIGSICGSIIA 360          
BLAST of Oxalate:formate antiporter vs. UniProt/SwissProt
Match: sp|Q51330|OXLT_OXAFO (Oxalate:formate antiporter OS=Oxalobacter formigenes OX=847 GN=oxlT PE=1 SV=3)

HSP 1 Score: 53.1434 bits (126), Expect = 7.474e-6
Identity = 40/159 (25.16%), Postives = 69/159 (43.40%), Query Frame = 2
Query: 1913 KLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTS 2389
            K +I+    +  +  +L    FW+LW   F  +F   L+ +    Y   L    +  L + V+I  +FN   R FWGF  DK      M ++    + ++ + P I+ L     +   A+ F    F   G++++FP     +FG  Y   NYG  + +
Sbjct:  201 KKQIVVTDKDFNSGEMLRTPQFWVLWTAFFSVNFGGLLLVANSVPYGRSL-GLAAGVLTIGVSIQNLFNGGCRPFWGFVSDKIGRYKTMSVVFGINAVVLALFPTIAALGDVAFIAMLAIAF----FTWGGSYALFPSTNSDIFGTAYSARNYGFFWAA 354          
BLAST of Oxalate:formate antiporter vs. TrEMBL
Match: A0A0H3YF10 (Slc16a-10 OS=Schmidtea mediterranea OX=79327 GN=slc16a-10 PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 4.040e-55
Identity = 139/423 (32.86%), Postives = 229/423 (54.14%), Query Frame = 2
Query: 1232 EKNQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSV-WIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQ----DSIIYKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPP--ELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPV------ISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPEFSSTPL 2461
             K   Y+ V G F + ++LGG +T G++ P I+ +M N + +   V     V WI G+   G GA++SLGGFIE ++G + T++ GG++MSF   L + T+  ++  V +SYGLI G G G+AYGV++  P ++FPK  GL+ GI++SG    S+ FD +     D  I     +  +R+P+SF+ +G IY +IQL+ + L+K+   +  EE  +QN                L I       EL+ H L+F ++FWI+W+   LNS   SL+  L  +     +  +   L +      IF+ FGRI WG+  D+  +K+++   TL  + M     +      +ST   +     + +W I++ F +SG FSIFP +C K+FG+++F  N+G+L+T  S    I  ++++ VF +  +  L
Sbjct:    8 SKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYM-NLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPGLLSGIILSGFGIGSVGFDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKR--PETVEESVNQN---------------NLNIFGETTKIELKPHQLIFYVNFWIIWITYALNS-AFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQDTKTL 411          

HSP 2 Score: 126.331 bits (316), Expect = 5.119e-27
Identity = 75/168 (44.64%), Postives = 111/168 (66.07%), Query Frame = 1
Query:   16 YRMYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWXXXXXXXXXXXXXXXYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDLMKMYYIEE 519
            Y  Y+AV GGFLV+I+LGG ++ GS   +I+ YM  +  +   VH   + WI G+  FG GAS+SLGGFIE ++G S TI+ GG+++S   +LT  TI+ ++  V + YGL+ G G GIAYGV   +P +WFPK+ GL+ G++ SG+GI  + F    DL+  Y+I++
Sbjct:   10 YACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPGLLSGIILSGFGIGSVGF----DLIHSYFIDD 173          

HSP 3 Score: 90.8929 bits (224), Expect = 2.894e-15
Identity = 67/205 (32.68%), Postives = 101/205 (49.27%), Query Frame = 3
Query:  591 QNEFNL------SEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNXXXXXXXXXXXXXXGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKIC------RIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVS 1169
            QN  N+       E+KPHQLIF  +FWI+W+ +AL      L   L   +  +L I +   L    I +    IF   GRI WG + DR  +KI I    L   +   T  +   + K+       R  + ++W+ I+ F++SG F+IFP ICAK+F  +HF  N+G++YTG S    I  +I    F      D + + LF+ +
Sbjct:  220 QNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLL----IATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVF-----ADQDTKTLFLTT 415          
BLAST of Oxalate:formate antiporter vs. TrEMBL
Match: A0A2C9L5X0 (MFS domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106066483 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.722e-53
Identity = 134/415 (32.29%), Postives = 225/415 (54.22%), Query Frame = 2
Query: 1229 IEKNQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQDSII---------------YKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEER---SSQNYSPEASDGDQKLDFPK--------LKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWH--LPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTS 2389
            I++ +  L+V G   I L+LG  YT GN+ P I ++M+NY S+ +S+T     W+F +  +G GA++++GG IE +IGP  T L+GGW MS  + L +  +K   ++ II+YG + GFG+G+AY + L   +++FP+ KGL+ G+VV+G    + IF+ VQ + I               Y G+  I++++P  FL+LG  Y+ +QL+GS+L+      ++EE+   +S    P     +  +D            + +N  P      +L    F+I+W I  LN   +  +T+L+  Y    +++ SF L ++   A +FN FGRI WG   D+ SF++ ML +    +       ++ TL+++ +     F V+  ++    SG+F++ P    K FG KY   NYGL+FTS
Sbjct:    8 IKRWRGMLVVAGGILIHLSLGTVYTFGNLNPYITSYMRNYGSA-SSLTYTECSWVFALGAMGQGASMAVGGVIERKIGPKLTALLGGWCMSLGVMLTYFAVKQSFALTIITYGAVFGFGIGIAYAIPLACCMRWFPERKGLVNGLVVAGFGGGAFIFNQVQTAFINPDNLQADKEVNGEKYFGEASILDQVPYVFLLLGGCYAGMQLIGSLLLCNPPASEEEEKIINNSHTQPPFKESKNIAIDKSSREQQEEQNDEEVNFTPA----QMLKSKYFYIIWFIFLLNGQGIVFLTTLYKAYGQTFISDDSF-LALVGAFAAVFNAFGRIMWGSIADRWSFRVAMLTVCTAFT------ALMLTLQLAPYGGKALFFVYICLLFGSFSGSFALLPTATAKCFGRKYLSINYGLVFTS 410          

HSP 2 Score: 110.923 bits (276), Expect = 8.032e-22
Identity = 66/158 (41.77%), Postives = 98/158 (62.03%), Query Frame = 1
Query:   16 YRMYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWXXXXXXXXXXXXXXXYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQ 489
            +R  L V GG L++++LG  Y+ G+   +I +YM+N+  S +++      W+  L   G GAS+++GG IE+KIGP LT L+GGW +SL  +LT   +     + +I YG V GFGIGIAY +     M+WFP+ KGLV GLV +G+G    +F  +Q
Sbjct:   11 WRGMLVVAGGILIHLSLGTVYTFGNLNPYITSYMRNYG-SASSLTYTECSWVFALGAMGQGASMAVGGVIERKIGPKLTALLGGWCMSLGVMLTYFAVKQSFALTIITYGAVFGFGIGIAYAIPLACCMRWFPERKGLVNGLVVAGFGGGAFIFNQVQ 167          

HSP 3 Score: 70.4774 bits (171), Expect = 9.545e-9
Identity = 56/200 (28.00%), Postives = 98/200 (49.00%), Query Frame = 3
Query:  621 PHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNXXXXXXXXXXXXXXGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVSSSLLLIAFMLTKLYKER 1220
            P Q++    F+I+W IF L    +  +T+LY  +     I +++ L    ++ +F A+F+  GRI WG I DR +F++A+  +C      + TL L P   K     +  +++ ++    SG F + P   AK F  K+   NYG+V+T   V   + + +SQ     T      +  LF + S    +AF+LT ++  +
Sbjct:  269 PAQMLKSKYFYIIWFIFLLNGQGIVFLTTLYKAYGQTF-ISDDSFL---ALVGAFAAVFNAFGRIMWGSIADRWSFRVAMLTVCTAFTALMLTLQLAPYGGKA----LFFVYICLLFGSFSGSFALLPTATAKCFGRKYLSINYGLVFTSQIVTAPLGAFLSQ-----TLKSSIGWTGLFFMVSGFSFVAFLLTVIFNAK 455          
BLAST of Oxalate:formate antiporter vs. TrEMBL
Match: A0A2C9L632 (MFS domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106066483 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 2.920e-53
Identity = 134/436 (30.73%), Postives = 226/436 (51.83%), Query Frame = 2
Query: 1229 IEKNQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQDSII---------------YKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEER-----SSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLD---------------------------FWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWH--LPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTS 2389
            I++ +  L+V G   I L+LG  YT GN+ P I ++M+NY S+ +S+T     W+F +  +G GA++++GG IE +IGP  T L+GGW MS  + L +  +K   ++ II+YG + GFG+G+AY + L   +++FP+ KGL+ G+VV+G    + IF+ VQ + I               Y G+  I++++P  FL+LG  Y+ +QL+GS+L+      ++EE+        + S + SD +  + + + K               V+D                           F+I+W I  LN   +  +T+L+  Y    +++ SF L ++   A +FN FGRI WG   D+ SF++ ML +    +       ++ TL+++ +     F V+  ++    SG+F++ P    K FG KY   NYGL+FTS
Sbjct:    8 IKRWRGMLVVAGGILIHLSLGTVYTFGNLNPYITSYMRNYGSA-SSLTYTECSWVFALGAMGQGASMAVGGVIERKIGPKLTALLGGWCMSLGVMLTYFAVKQSFALTIITYGAVFGFGIGIAYAIPLACCMRWFPERKGLVNGLVVAGFGGGAFIFNQVQTAFINPDNLQADKEVNGEKYFGEASILDQVPYVFLLLGGCYAGMQLIGSLLLCNPPASEEEEKLLDNEKKSHVSDDESDAESAVIYSREKETKMDENGLKEEQKTVIDKSSREQQEEQNDEEVNFTPAQMLKSKYFYIIWFIFLLNGQGIVFLTTLYKAYGQTFISDDSF-LALVGAFAAVFNAFGRIMWGSIADRWSFRVAMLTVCTAFT------ALMLTLQLAPYGGKALFFVYICLLFGSFSGSFALLPTATAKCFGRKYLSINYGLVFTS 435          

HSP 2 Score: 111.694 bits (278), Expect = 5.575e-22
Identity = 66/158 (41.77%), Postives = 98/158 (62.03%), Query Frame = 1
Query:   16 YRMYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWXXXXXXXXXXXXXXXYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQ 489
            +R  L V GG L++++LG  Y+ G+   +I +YM+N+  S +++      W+  L   G GAS+++GG IE+KIGP LT L+GGW +SL  +LT   +     + +I YG V GFGIGIAY +     M+WFP+ KGLV GLV +G+G    +F  +Q
Sbjct:   11 WRGMLVVAGGILIHLSLGTVYTFGNLNPYITSYMRNYG-SASSLTYTECSWVFALGAMGQGASMAVGGVIERKIGPKLTALLGGWCMSLGVMLTYFAVKQSFALTIITYGAVFGFGIGIAYAIPLACCMRWFPERKGLVNGLVVAGFGGGAFIFNQVQ 167          

HSP 3 Score: 71.2478 bits (173), Expect = 5.052e-9
Identity = 56/200 (28.00%), Postives = 98/200 (49.00%), Query Frame = 3
Query:  621 PHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNXXXXXXXXXXXXXXGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVSSSLLLIAFMLTKLYKER 1220
            P Q++    F+I+W IF L    +  +T+LY  +     I +++ L    ++ +F A+F+  GRI WG I DR +F++A+  +C      + TL L P   K     +  +++ ++    SG F + P   AK F  K+   NYG+V+T   V   + + +SQ     T      +  LF + S    +AF+LT ++  +
Sbjct:  294 PAQMLKSKYFYIIWFIFLLNGQGIVFLTTLYKAYGQTF-ISDDSFL---ALVGAFAAVFNAFGRIMWGSIADRWSFRVAMLTVCTAFTALMLTLQLAPYGGKA----LFFVYICLLFGSFSGSFALLPTATAKCFGRKYLSINYGLVFTSQIVTAPLGAFLSQ-----TLKSSIGWTGLFFMVSGFSFVAFLLTVIFNAK 480          
BLAST of Oxalate:formate antiporter vs. TrEMBL
Match: A0A1I8HL50 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 6.891e-51
Identity = 128/420 (30.48%), Postives = 217/420 (51.67%), Query Frame = 2
Query: 1256 VLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXX----------XXXXXXXXXDAVQDSIIYKGKE------IIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDG----DQKLD--FPKLKIL-------NNPPELQT--HHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLV 2422
            V+G F I  TLG  YT GN+ P +V++M+ +S S+  +   ++ WIFG+ + G GA+++ GG IE +IG   T L+G W+MS  + L +  +KS+L +++++YGL+ G G G+AY V++   + +FP  +GL+ GIVV+                I  D V+ ++   G E       I++R+P  F+ LG IY+++Q VG  L+++ T  + EER  Q    EA D     +  LD   P   +        N   EL +    ++    FW+LW    +NS  V  I + +  +  +        L ++ ++A  FN   R+ WG   D+ +++ LM +++       G+  ++ST  +S     + +W   +    +G F++FP  C KL+G      NYGLLFT+ +  G I +L+
Sbjct:   11 VIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSHSKW-IGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEER--QELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGELDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSF-GLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSF------GMAVLMSTFTLSGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALL 420          

HSP 2 Score: 110.923 bits (276), Expect = 9.050e-22
Identity = 68/155 (43.87%), Postives = 99/155 (63.87%), Query Frame = 1
Query:   31 AVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWXXXXXXXXXXXXXXXYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDL 495
            AV+GGFL++ TLG  Y+ G+   ++V+YM+ HS S   +      WI GL +FG GAS++ GG IEK+IG  LT L+G W++SL  LL+   + +++ ++V+ YGL+ G G GIAY V     M WFP  +GLV G+V +G+G   L+F   Q L
Sbjct:   10 AVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSHSKW-IGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTL 163          

HSP 3 Score: 69.707 bits (169), Expect = 1.479e-8
Identity = 57/246 (23.17%), Postives = 114/246 (46.34%), Query Frame = 3
Query:  480 NNSRFDENVLY*RNQETEARPISLSSTSTEIGFWNSFQNEFNLSEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNXXXXXXXXXXXXXXGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDA-EYRNLFIVSSSLLLIAFMLTKLYK 1214
            +++   E  L   ++ + ++P+++ ++           N     +  P Q++    FW+LW  F +    V  I + Y  F    G+ ++     + I+ S  A F+ + R+ WG + DR+A++       L   L  G   LM   +     +  +LW+  +  + +G F +FP  CAKL+   +   NYG+++T  +  G I +L++      T LKDA  +  LF++ ++   +  + T L++
Sbjct:  234 DDTAAQETAL---DEGSPSKPVAMETSE--------HGNRGGELDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKGLNDHY----LAIVGSLAAAFNAASRVMWGHLHDRVAYR------ALMFVLSFGMAVLMSTFTLSGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLT------TVLKDAIGWLGLFLLGAAFSTLGAVFTLLFE 452          
BLAST of Oxalate:formate antiporter vs. TrEMBL
Match: A0A267H5U2 (MFS domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000477g2 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 7.002e-51
Identity = 128/420 (30.48%), Postives = 217/420 (51.67%), Query Frame = 2
Query: 1256 VLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXX----------XXXXXXXXXDAVQDSIIYKGKE------IIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDG----DQKLD--FPKLKIL-------NNPPELQT--HHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLV 2422
            V+G F I  TLG  YT GN+ P +V++M+ +S S+  +   ++ WIFG+ + G GA+++ GG IE +IG   T L+G W+MS  + L +  +KS+L +++++YGL+ G G G+AY V++   + +FP  +GL+ GIVV+                I  D V+ ++   G E       I++R+P  F+ LG IY+++Q VG  L+++ T  + EER  Q    EA D     +  LD   P   +        N   EL +    ++    FW+LW    +NS  V  I + +  +  +        L ++ ++A  FN   R+ WG   D+ +++ LM +++       G+  ++ST  +S     + +W   +    +G F++FP  C KL+G      NYGLLFT+ +  G I +L+
Sbjct:   13 VIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSHSKW-IGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEER--QELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGELDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSF-GLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSF------GMAVLMSTFTLSGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALL 422          

HSP 2 Score: 110.538 bits (275), Expect = 1.004e-21
Identity = 68/155 (43.87%), Postives = 99/155 (63.87%), Query Frame = 1
Query:   31 AVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWXXXXXXXXXXXXXXXYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDL 495
            AV+GGFL++ TLG  Y+ G+   ++V+YM+ HS S   +      WI GL +FG GAS++ GG IEK+IG  LT L+G W++SL  LL+   + +++ ++V+ YGL+ G G GIAY V     M WFP  +GLV G+V +G+G   L+F   Q L
Sbjct:   12 AVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSHSKW-IGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTL 165          

HSP 3 Score: 69.707 bits (169), Expect = 1.365e-8
Identity = 57/246 (23.17%), Postives = 114/246 (46.34%), Query Frame = 3
Query:  480 NNSRFDENVLY*RNQETEARPISLSSTSTEIGFWNSFQNEFNLSEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNXXXXXXXXXXXXXXGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDA-EYRNLFIVSSSLLLIAFMLTKLYK 1214
            +++   E  L   ++ + ++P+++ ++           N     +  P Q++    FW+LW  F +    V  I + Y  F    G+ ++     + I+ S  A F+ + R+ WG + DR+A++       L   L  G   LM   +     +  +LW+  +  + +G F +FP  CAKL+   +   NYG+++T  +  G I +L++      T LKDA  +  LF++ ++   +  + T L++
Sbjct:  236 DDTAAQETAL---DEGSPSKPVAMETSE--------HGNRGGELDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKGLNDHY----LAIVGSLAAAFNAASRVMWGHLHDRVAYR------ALMFVLSFGMAVLMSTFTLSGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLT------TVLKDAIGWLGLFLLGAAFSTLGAVFTLLFE 454          
BLAST of Oxalate:formate antiporter vs. Planmine SMEST
Match: SMESG000069668.1 (SMESG000069668.1)

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 445/445 (100.00%), Postives = 445/445 (100.00%), Query Frame = 2
Query: 1223 MFIEKNQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQDSIIYKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPEFSSTPLVFRNMVIIGVIXXXXXXXXXXXYRGKSAIVIF 2557
            MFIEKNQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLIFGIVVSGISFSSIIFDAVQDSIIYKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPEFSSTPLVFRNMVIIGVILSFLAALLTLLYRGKSAIVIF
Sbjct:    1 MFIEKNQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLIFGIVVSGISFSSIIFDAVQDSIIYKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPEFSSTPLVFRNMVIIGVILSFLAALLTLLYRGKSAIVIF 445          

HSP 2 Score: 150.214 bits (378), Expect = 1.479e-38
Identity = 80/156 (51.28%), Postives = 115/156 (73.72%), Query Frame = 1
Query:   25 YLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWXXXXXXXXXXXXXXXYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQD 492
            YL VLG F + +TLGGFY+SG+ Q  IVN+M+N+S S T+V   +  WI G++L G GA++SLGGFIE +IGP+ T+L+GGW++S N  L  +T+ +Y+ +V+I YGL+ GFG+G+AYGV    P+K+FPK KGL+ G+V SG   S ++F  +QD
Sbjct:    9 YLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLIFGIVVSGISFSSIIFDAVQD 164          

HSP 3 Score: 140.198 bits (352), Expect = 2.845e-35
Identity = 88/209 (42.11%), Postives = 126/209 (60.29%), Query Frame = 3
Query:  603 NLSEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNXXXXXXXXXXXXXXGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQL---GFRNTPLKDAEYRNLFIVSSSLLLIAFMLTKLYKER 1220
            N  E++ H L+FV DFWILWMI  L  F V+LITSL   F+ +  +  N    N+ +I +   IF+  GRIFWG  ID+ +FK+ + II LT    +G LP++  +     +    +W  +I F LSG F+IFP +C KLF  K+F+ NYG+++T CSVGGTI SL+  L    F +TPL    +RN+ I+   L  +A +LT LY+ +
Sbjct:  237 NPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSL---FNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPEFSSTPL---VFRNMVIIGVILSFLAALLTLLYRGK 439          
BLAST of Oxalate:formate antiporter vs. Planmine SMEST
Match: SMESG000069669.1 (SMESG000069669.1)

HSP 1 Score: 438.728 bits (1127), Expect = 0.000e+0
Identity = 232/235 (98.72%), Postives = 234/235 (99.57%), Query Frame = 3
Query:  516 RNQETEARPISLSSTSTEIGFWNSFQNEFNLSEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNXXXXXXXXXXXXXXGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVSSSLLLIAFMLTKLYKER 1220
            +NQETEARPISLSSTSTEIGFWNSFQNEFNLSEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNINIISSFIAIFHFSGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVSSSLLLIAFMLTKLYK +
Sbjct:  200 QNQETEARPISLSSTSTEIGFWNSFQNEFNLSEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNINIISSFIAIFHFSGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVSSSLLLIAFMLTKLYKGK 434          

HSP 2 Score: 293.123 bits (749), Expect = 0.000e+0
Identity = 166/166 (100.00%), Postives = 166/166 (100.00%), Query Frame = 1
Query:   22 MYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWXXXXXXXXXXXXXXXYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDLMKMYYIEE 519
            MYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWLLSLNTLLTSLTINTYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDLMKMYYIEE
Sbjct:    1 MYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWLLSLNTLLTSLTINTYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDLMKMYYIEE 166          

HSP 3 Score: 293.123 bits (749), Expect = 4.028e-90
Identity = 186/442 (42.08%), Postives = 283/442 (64.03%), Query Frame = 2
Query: 1247 YLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQDSI-IYKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSL---FNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPEFSSTPL---VFRNMVIIGVIXXXXXXXXXXXYRGKSAIV 2551
            YL VLG F + +TLGGFY+SG+ Q  IVN+M+N+S S T+V   +  WI G++L G GA++SLGGFIE +IGP+ T+L+GGW++S N  L  +T+ +Y+ +V+I YGL+ GFG+G+AYGV    P+K+FPK KGL+ G+V SG   S ++F  +QD + +Y  +E  ++  P+ FLI G IY+++QL+G++L++   K + +E  ++  S  ++  +    +   +   N  E++ H L+FV DFWILWMI  L  F V+LITSL   F+ +  +  N    N+ +I +   IF+  GRIFWG  ID+ +FK+ + II LT    +G LP++  +     +    +W  +I F LSG F+IFP +C KLF  K+F+ NYG+++T CSVGGTI SL+  L    F +TPL    +RN+ I+   L  +A +LT LY+GK  ++
Sbjct:    2 YLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWLLSLNTLLTSLTINTYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDLMKMYYIEENFLHHFPILFLITGSIYAMLQLLGAVLVRG-PKSQNQETEARPISLSSTSTEIGF-WNSFQNEFNLSEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNINIISSFIAIFHFSGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQL---GFRNTPLKDAEYRNLFIVSSSLLLIAFMLTKLYKGKPVVL 438          
BLAST of Oxalate:formate antiporter vs. Planmine SMEST
Match: SMESG000069669.1 (SMESG000069669.1)

HSP 1 Score: 438.728 bits (1127), Expect = 0.000e+0
Identity = 232/235 (98.72%), Postives = 234/235 (99.57%), Query Frame = 3
Query:  516 RNQETEARPISLSSTSTEIGFWNSFQNEFNLSEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNXXXXXXXXXXXXXXGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVSSSLLLIAFMLTKLYKER 1220
            +NQETEARPISLSSTSTEIGFWNSFQNEFNLSEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNINIISSFIAIFHFSGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVSSSLLLIAFMLTKLYK +
Sbjct:  206 QNQETEARPISLSSTSTEIGFWNSFQNEFNLSEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNINIISSFIAIFHFSGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVSSSLLLIAFMLTKLYKGK 440          

HSP 2 Score: 298.516 bits (763), Expect = 0.000e+0
Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 1
Query:   16 YRMYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWXXXXXXXXXXXXXXXYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDLMKMYYIEE 519
            YRMYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWLLSLNTLLTSLTINTYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDLMKMYYIEE
Sbjct:    5 YRMYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWLLSLNTLLTSLTINTYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDLMKMYYIEE 172          

HSP 3 Score: 296.975 bits (759), Expect = 1.710e-91
Identity = 188/447 (42.06%), Postives = 286/447 (63.98%), Query Frame = 2
Query: 1232 EKNQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQDSI-IYKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSL---FNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPEFSSTPL---VFRNMVIIGVIXXXXXXXXXXXYRGKSAIV 2551
            EK + YL VLG F + +TLGGFY+SG+ Q  IVN+M+N+S S T+V   +  WI G++L G GA++SLGGFIE +IGP+ T+L+GGW++S N  L  +T+ +Y+ +V+I YGL+ GFG+G+AYGV    P+K+FPK KGL+ G+V SG   S ++F  +QD + +Y  +E  ++  P+ FLI G IY+++QL+G++L++   K + +E  ++  S  ++  +    +   +   N  E++ H L+FV DFWILWMI  L  F V+LITSL   F+ +  +  N    N+ +I +   IF+  GRIFWG  ID+ +FK+ + II LT    +G LP++  +     +    +W  +I F LSG F+IFP +C KLF  K+F+ NYG+++T CSVGGTI SL+  L    F +TPL    +RN+ I+   L  +A +LT LY+GK  ++
Sbjct:    3 EKYRMYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWLLSLNTLLTSLTINTYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDLMKMYYIEENFLHHFPILFLITGSIYAMLQLLGAVLVRG-PKSQNQETEARPISLSSTSTEIGF-WNSFQNEFNLSEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNINIISSFIAIFHFSGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQL---GFRNTPLKDAEYRNLFIVSSSLLLIAFMLTKLYKGKPVVL 444          
BLAST of Oxalate:formate antiporter vs. Planmine SMEST
Match: SMESG000069681.1 (SMESG000069681.1)

HSP 1 Score: 319.316 bits (817), Expect = 5.059e-100
Identity = 185/399 (46.37%), Postives = 268/399 (67.17%), Query Frame = 2
Query: 1223 MFIEKNQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQDSIIYKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVN-ETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIIS 2416
            +F EK + Y+++ G++ IQL+LG  +T G+IQP IV +M NYS S +SV   N+V I G L  G+GA++S+GG+ E +IGP KT+LIG W+MS NI LMF T+KSYLS+V+I+YG I G G+G AYGVSLG P+K+FP+ KGL+ GIV+SG   SS IF++VQD+ + + K   +N LP SFLIL  I++V+QL+GSIL+++ + DK EE    + S  +S     L F    I NN  E++ H ++   DFW+LW++ FLNSF V  I++ +  Y       +    LK+   I  + N  GRIF+G+ ID++ FK++M IITL+ +  IG LP +++LK ++    + V   VI FF  G +++FP VC +LFG+K FV  YG+L+TSCSV G ++S
Sbjct:    3 IFFEKYRCYIVLFGSYLIQLSLGSLFTFGHIQPEIVKYMNNYSFSGSSVNSGNTVSIIGALTFGVGASLSIGGYAEQKIGPGKTILIGAWLMSLNIGLMFFTLKSYLSVVVITYGFIAGLGLGFAYGVSLGRPIKWFPEHKGLVIGIVISGFGISSAIFNSVQDAFLDE-KNTNINSLPKSFLILAGIFAVLQLIGSILVRQNSDDKLEETLINSVSVRSSKYKPIL-FDYSSIGNN--EIEPHQIILERDFWVLWIVFFLNSFMVYFISASYALYFKTQTQIKNEIILKIYFIITSLCNGAGRIFFGYLIDRKPFKIVMYIITLSCTLFIGTLP-LTSLKNTYFPYIYGVSIGVIFFFTGGNYTVFPAVCAQLFGLKNFVFKYGILYTSCSVSGIVVS 396          

HSP 2 Score: 140.969 bits (354), Expect = 1.898e-35
Identity = 79/159 (49.69%), Postives = 113/159 (71.07%), Query Frame = 1
Query:   16 YRMYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWXXXXXXXXXXXXXXXYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQD 492
            YR Y+ + G +L+ ++LG  ++ G  Q  IV YM N+S S ++V++G+   I G + FG GASLS+GG+ E+KIGP  TIL+G WL+SLN  L   T+ +Y+ VVVI YG ++G G+G AYGV    P+KWFP++KGLVIG+V SG+GIS  +F ++QD
Sbjct:    8 YRCYIVLFGSYLIQLSLGSLFTFGHIQPEIVKYMNNYSFSGSSVNSGNTVSIIGALTFGVGASLSIGGYAEQKIGPGKTILIGAWLMSLNIGLMFFTLKSYLSVVVITYGFIAGLGLGFAYGVSLGRPIKWFPEHKGLVIGIVISGFGISSAIFNSVQD 166          

HSP 3 Score: 117.857 bits (294), Expect = 9.034e-28
Identity = 79/208 (37.98%), Postives = 117/208 (56.25%), Query Frame = 3
Query:  609 SEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLY-LPFSHHLGIPENNPLGNXXXXXXXXXXXXXXGRIFWGCIIDRIAFKIAIRIICLTSCLFVGTLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDA---EYRNLFIVSSSLLLIAFMLTKLYKER 1220
            +E++PHQ+I   DFW+LW++F L  F+V  I++ Y L F     I     L    I     ++ + +GRIF+G +IDR  FKI + II L+  LF+GTLPL  L +     YI  + + +I F   G +T+FP +CA+LF  K+F+  YG++YT CSV G + S +S      + L DA    Y   FIV  S+ LIA   T  ++ +
Sbjct:  237 NEIEPHQIILERDFWVLWIVFFLNSFMVYFISASYALYFKTQTQIKNEIIL---KIYFIITSLCNGAGRIFFGYLIDRKPFKIVMYIITLSCTLFIGTLPLTSLKNTYFP-YIYGVSIGVIFFFTGGNYTVFPAVCAQLFGLKNFVFKYGILYTSCSVSGIVVSALSA-----SFLSDATSHSYDITFIVCGSISLIAAGFTSFFRGK 435          
BLAST of Oxalate:formate antiporter vs. Planmine SMEST
Match: SMESG000069673.1 (SMESG000069673.1)

HSP 1 Score: 310.457 bits (794), Expect = 8.056e-97
Identity = 194/444 (43.69%), Postives = 278/444 (62.61%), Query Frame = 2
Query: 1247 YLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLXXXXXXXXXXXXXXXXDAVQDSIIYKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDK----KEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIA---KIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPT--FAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPEFSSTPLVFRNMVIIGVIXXXXXXXXXXXYRGKSAIV 2551
            YL + G F + +++G FY++G+I P I  +M+N + + T        WIFG  LLGMGAA+SLGG++EM+IG + TVLIGGW+MS NICLM VTM   L++VI++YGL  GFG G+ YGV+LG PLK   K  GL  G+VVSG   S+ IFD +Q+ +           LP+SFLI+G IY+VIQL+G+IL+KK+  +     +   +S NY     +   K++F            + H +L  LDFWILW+  FLN+  V+ +T+L+N Y   L     F  + +VTI+     FNC GRIFWGF IDK+ FK+ M+I+T+  S ++ +   IS + ++  +    F + F  I+FF SG F IFP +C +L+G+KYFVCNYG+LFT+CSV  TI++++ M +  E  +   VF    + G  LS L+ L+TL+YRGKS I+
Sbjct:   11 YLPIFGGFLLHISVGYFYSAGHIMPHINKYMKNENKTST--------WIFGSTLLGMGAAMSLGGYVEMKIGSSLTVLIGGWIMSANICLMCVTMTCGLTVVILTYGLFAGFGTGLVYGVALGVPLKIVKKRVGLFLGVVVSGFGVSATIFDYLQNVLSSD-----YTNLPLSFLIMGCIYAVIQLIGAILLKKKANENDLTIQSNETSFNYFEIFLNSKSKMEF------------KPHEILLELDFWILWITFFLNAIGVNFLTTLYNEYYHEL-----FGAQHLVTISISGAAFNCLGRIFWGFIIDKKPFKITMVIMTVGTSILMALFSTISLMNLTGKMNEIVFGIIFCAINFFQSGNFCIFPFMCAQLYGVKYFVCNYGMLFTACSVACTIVNIISMNISREKDNLKFVF----VAGAALSILSTLMTLVYRGKSLII 420          

HSP 2 Score: 119.013 bits (297), Expect = 4.531e-55
Identity = 76/236 (32.20%), Postives = 130/236 (55.08%), Query Frame = 3
Query:  522 QETEARPISLSSTSTEIGFWNSFQNEFNLSEMKPHQLIFVTDFWILWMIFALTCFVVTLITSLYLPFSHHLGIPENNPLGNXXXXXXXXXXXXXXGRIFWGCIIDRIAFKIAIRIICLTSCLFVG---TLPLMPLISKICRIYILVLWLAIILFMLSGIFTIFPRICAKLFRTKHFISNYGMVYTGCSVGGTIFSLISQLGFRNTPLKDAEYRNLFIVSSSLLLIAFMLTKLYKER 1220
            ++     +++ S  T   ++  F N  +  E KPH+++   DFWILW+ F L    V  +T+LY  + H L   ++     +  IS   A F+  GRIFWG IID+  FKI + I+ + + + +    T+ LM L  K+  I   +++ AI  F  SG F IFP +CA+L+  K+F+ NYGM++T CSV  TI ++IS     N   +    + +F+  ++L +++ ++T +Y+ +
Sbjct:  191 KKANENDLTIQSNETSFNYFEIFLNSKSKMEFKPHEILLELDFWILWITFFLNAIGVNFLTTLYNEYYHELFGAQH-----LVTISISGAAFNCLGRIFWGFIIDKKPFKITMVIMTVGTSILMALFSTISLMNLTGKMNEIVFGIIFCAINFFQ-SGNFCIFPFMCAQLYGVKYFVCNYGMLFTACSVACTIVNIISM----NISREKDNLKFVFVAGAALSILSTLMTLVYRGK 416          

HSP 3 Score: 116.701 bits (291), Expect = 4.531e-55
Identity = 71/162 (43.83%), Postives = 104/162 (64.20%), Query Frame = 1
Query:   25 YLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVHNGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWXXXXXXXXXXXXXXXYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNSGYGISPLLFITIQDLMKMYY 510
            YL + GGFL++I++G FYS+G     I  YMKN + + T        WI G  L G GA++SLGG++E KIG SLT+L+GGW++S N  L  +T+   + VV++ YGL +GFG G+ YGV   VP+K   K  GL +G+V SG+G+S  +F  +Q+++   Y
Sbjct:   11 YLPIFGGFLLHISVGYFYSAGHIMPHINKYMKNENKTST--------WIFGSTLLGMGAAMSLGGYVEMKIGSSLTVLIGGWIMSANICLMCVTMTCGLTVVILTYGLFAGFGTGLVYGVALGVPLKIVKKRVGLFLGVVVSGFGVSATIFDYLQNVLSSDY 164          
The following BLAST results are available for this feature:
BLAST of Oxalate:formate antiporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxalate:formate antiporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Y59A8B.212.496e-2223.99pep chromosome:WBcel235:V:17986260:17994546:1 gene... [more]
F10G7.54.716e-2023.60pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
F10G7.55.563e-2023.86pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
F10G7.55.563e-2023.86pep chromosome:WBcel235:II:4693542:4696408:1 gene:... [more]
back to top
BLAST of Oxalate:formate antiporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxalate:formate antiporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxalate:formate antiporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxalate:formate antiporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxalate:formate antiporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P37662|YHJX_ECOLI5.358e-922.83Uncharacterized MFS-type transporter YhjX OS=Esche... [more]
sp|Q51330|OXLT_OXAFO7.474e-625.16Oxalate:formate antiporter OS=Oxalobacter formigen... [more]
back to top
BLAST of Oxalate:formate antiporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF104.040e-5532.86Slc16a-10 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A2C9L5X01.722e-5332.29MFS domain-containing protein OS=Biomphalaria glab... [more]
A0A2C9L6322.920e-5330.73MFS domain-containing protein OS=Biomphalaria glab... [more]
A0A1I8HL506.891e-5130.48MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A267H5U27.002e-5130.48MFS domain-containing protein (Fragment) OS=Macros... [more]
back to top
BLAST of Oxalate:formate antiporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxalate:formate antiporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxalate:formate antiporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxalate:formate antiporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxalate:formate antiporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxalate:formate antiporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069668.11.479e-38100.00SMESG000069668.1[more]
SMESG000069669.14.028e-9098.72SMESG000069669.1[more]
SMESG000069669.11.710e-9198.72SMESG000069669.1[more]
SMESG000069681.15.059e-10046.37SMESG000069681.1[more]
SMESG000069673.18.056e-9743.69SMESG000069673.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019784 ID=SMED30019784|Name=Oxalate:formate antiporter|organism=Schmidtea mediterranea sexual|type=transcript|length=2648bp
TACTTCAAATTTATATATCGGATGTATTTGGCGGTGTTGGGTGGATTTCT
GGTTAACATAACTCTGGGAGGATTTTATTCATCTGGGTCAACTCAAATTT
TCATTGTAAATTATATGAAAAATCATAGTATTTCACCCACCAATGTTCAC
AACGGAAGTATCCACTGGATTCCAGGTTTGGTTTTATTTGGCACTGGCGC
TTCCCTTTCTCTTGGTGGTTTTATTGAAAAGAAAATCGGTCCATCTTTAA
CTATTTTAGTTGGAGGCTGGTTGTTGAGCTTGAATACGCTTTTAACGAGT
CTCACAATCAATACGTATGTATGGGTTGTTGTGATTTTTTACGGACTCGT
TTCTGGATTCGGAATTGGGATTGCTTATGGAGTTTGTTTCGATGTTCCCA
TGAAATGGTTCCCAAAAAATAAAGGCCTCGTAATCGGATTGGTTAATTCT
GGATATGGGATTTCCCCGCTACTATTTATAACAATTCAAGATTTGATGAA
AATGTATTATATTGAAGAAACCAAGAAACAGAAGCCAGACCAATCTCATT
GTCATCTACATCAACTGAAATCGGATTCTGGAATAGTTTTCAAAATGAAT
TCAACCTCTCTGAAATGAAGCCTCATCAACTCATTTTTGTAACTGATTTT
TGGATTCTGTGGATGATCTTTGCTTTGACTTGTTTTGTCGTCACATTAAT
CACGTCATTATATTTACCATTTTCTCACCACCTTGGAATACCGGAAAATA
ATCCGCTCGGAAATATAAACATAATATCATCATTTATTGCCATATTCCAT
TTTTCGGGAAGAATTTTCTGGGGCTGTATAATAGATAGAATAGCATTTAA
AATAGCAATAAGAATTATTTGTTTGACCAGCTGCTTATTTGTTGGAACTT
TACCCTTAATGCCATTAATTTCAAAAATATGTCGTATTTATATTTTAGTA
TTATGGCTTGCAATCATTTTATTCATGTTGTCTGGAATATTTACAATTTT
CCCAAGGATTTGTGCTAAATTATTTAGGACGAAGCATTTTATTTCTAATT
ATGGAATGGTTTATACCGGATGTTCTGTCGGAGGAACTATTTTTAGTTTG
ATTTCACAATTAGGTTTTAGAAATACACCACTAAAAGATGCAGAATACAG
AAATTTATTTATTGTTTCTTCTAGTCTACTGCTAATAGCTTTTATGTTAA
CGAAGTTATATAAAGAAAGGATATGTTTATCGAAAAAAATCAAAATTATT
TAATTGTACTTGGAGCATTTTTTATCCAGTTAACTCTTGGTGGATTTTAC
ACCTCTGGAAATATTCAACCGATTATTGTCAATTTTATGCAGAATTACAG
TAGCTCTCAAACTTCAGTTACAATGGAGAATTCTGTTTGGATATTCGGAG
TTTTGTTATTGGGTATGGGAGCAGCTATTTCTCTAGGAGGATTTATCGAA
ATGCAAATTGGGCCGACGAAAACTGTTTTAATAGGGGGGTGGGTTATGAG
CTTCAATATCTGTTTAATGTTTGTCACGATGAAAAGTTATTTATCAATTG
TAATTATTTCCTACGGTCTCATTGGTGGATTCGGAATGGGGGTGGCCTAC
GGAGTTTCGCTAGGGACGCCTTTGAAATATTTTCCAAAATGCAAAGGATT
AATATTCGGAATTGTTGTTTCGGGCATCTCTTTCTCTTCAATAATATTCG
ATGCGGTCCAGGATTCCATCATATACAAAGGCAAGGAAATAATCATGAAC
CGCTTGCCTATGTCTTTTCTCATTTTGGGTTTTATATATTCGGTTATTCA
ACTTGTCGGCTCGATTTTGATGAAAAAAAGAACCAAAGATAAAAAAGAAG
AAAGAAGCTCCCAGAACTATAGTCCAGAAGCGTCAGATGGTGATCAGAAA
CTCGATTTTCCTAAATTGAAAATTTTGAATAATCCCCCAGAACTGCAAAC
TCATCATTTACTTTTTGTGCTTGATTTTTGGATTCTTTGGATGATTATGT
TTTTAAATTCGTTTTGCGTTTCTCTCATTACGTCGCTATTCAATAGATAT
TCCGCAGTGCTAGTTAATGAGACTAGTTTTAATCTAAAAGTCATAGTTAC
CATCGCAAAGATCTTTAACTGTTTCGGGAGAATCTTTTGGGGCTTTGCTA
TTGACAAACAGTCATTTAAGATGTTAATGCTCATCATTACCTTAACAATC
TCATTTATGATTGGAATATTGCCTGTCATATCAACATTAAAAGTGTCATG
GCACTTACCAACCTTTGCCGTATGGTTTATCGTCATTCATTTCTTTTTAT
CAGGAACATTTTCTATATTTCCCATTGTTTGCTGCAAGCTTTTTGGTATG
AAGTATTTTGTATGCAATTATGGATTGCTTTTCACCTCATGTTCGGTCGG
TGGAACTATCATCAGTTTAGTTATAATGTTAGTTTTCCCAGAATTTTCAA
GTACCCCGTTGGTATTTAGAAATATGGTTATCATTGGGGTTATTTTATCT
TTTTTAGCTGCCTTATTGACCTTGCTGTATCGCGGTAAATCTGCGATTGT
CATTTTTTAATATTCAATTCTATCAGTGATGCCATTTCTCTGTGATTTTC
AGTGAATCTTAATTTTCAATTGTATTTTTGAAATAAATCTATTTTTTT
back to top

protein sequence of SMED30019784-orf-1

>SMED30019784-orf-1 ID=SMED30019784-orf-1|Name=SMED30019784-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=446bp
MFIEKNQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVT
MENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMF
VTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLIFGIVVS
GISFSSIIFDAVQDSIIYKGKEIIMNRLPMSFLILGFIYSVIQLVGSILM
KKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVL
DFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNC
FGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAV
WFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLV
IMLVFPEFSSTPLVFRNMVIIGVILSFLAALLTLLYRGKSAIVIF*
back to top

protein sequence of SMED30019784-orf-2

>SMED30019784-orf-2 ID=SMED30019784-orf-2|Name=SMED30019784-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=206bp
YFKFIYRMYLAVLGGFLVNITLGGFYSSGSTQIFIVNYMKNHSISPTNVH
NGSIHWIPGLVLFGTGASLSLGGFIEKKIGPSLTILVGGWLLSLNTLLTS
LTINTYVWVVVIFYGLVSGFGIGIAYGVCFDVPMKWFPKNKGLVIGLVNS
GYGISPLLFITIQDLMKMYYIEETKKQKPDQSHCHLHQLKSDSGIVFKMN
STSLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR020846MFS_dom
IPR011701MFS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 26..396
e-value: 9.7E-16
score: 57.6
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 4..440
e-value: 6.2E-20
score: 73.0
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 8..432
NoneNo IPR availablePANTHERPTHR11360:SF3OXALATE/FORMATE ANTIPORTERcoord: 8..432
NoneNo IPR availableCDDcd17353MFS_OFA_likecoord: 9..435
e-value: 1.03641E-47
score: 166.246
NoneNo IPR availableTMHMMTMhelixcoord: 84..103
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 347..369
NoneNo IPR availableTMHMMTMhelixcoord: 318..337
NoneNo IPR availableTMHMMTMhelixcoord: 414..436
NoneNo IPR availableTMHMMTMhelixcoord: 382..404
NoneNo IPR availableTMHMMTMhelixcoord: 252..274
NoneNo IPR availableTMHMMTMhelixcoord: 55..77
NoneNo IPR availableTMHMMTMhelixcoord: 143..162
NoneNo IPR availableTMHMMTMhelixcoord: 108..130
NoneNo IPR availableTMHMMTMhelixcoord: 177..199
NoneNo IPR availableTMHMMTMhelixcoord: 284..306
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 7..441
score: 8.634
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 20..437