Rho GTPase-activating protein

Overview
NameRho GTPase-activating protein
Smed IDSMED30019778
Length (bp)2929
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho GTPase-activating protein (SMED30019778) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho GTPase-activating protein (SMED30019778) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho GTPase-activating protein (SMED30019778) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho GTPase-activating protein (SMED30019778) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019778

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30019778SMESG000037897.1 SmedASXL_014810SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30019778 SmedASXL_031909SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30019778SMESG000037897.1 dd_Smed_v4_11121_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30019778SMESG000037897.1 dd_Smed_v6_11121_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30019778SMESG000037897.1 OX_Smed_1.0.06712ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: SYDE2 (synapse defective Rho GTPase homolog 2 [Source:HGNC Symbol;Acc:HGNC:25841])

HSP 1 Score: 193.741 bits (491), Expect = 7.621e-50
Identity = 113/358 (31.56%), Postives = 194/358 (54.19%), Query Frame = 3
Query: 1344 FSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECF-EWDEVFEIEILNNTCLSILLYQWDPRFR-HRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFL-NCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNA---HELHKTSN-----TSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSK---------SILDPSLQSEIFQFIMTIWP 2357
             SG++ +H      L       KD++C I+ D++ KAR+ + T    F + D  F IEI N   L ++++ W+P  R +R+C  G + L +L   +R+  T   +LA++LEP+G++Y+++  +   E + H  G        IFG  ++ ++  E   +++P +++ C+ EI  RG +VVG+YRL GS  +K +L++ F+R+   + +  +  PDI+ IT VLKD+LRELP PL T+  Y+ +++A     L  +SN         K  +++LDCLP   +  L  L+DHL  + +  E NKM   +L+  FGP+L     E S+  ++         S LD     E+  +++ +WP
Sbjct:  678 ISGLMSVHFYGAEDLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRKNRVCCHGTVVLPTL---FRV--TKTHQLAVKLEPRGLIYVKVTLMEQWENSLH--GLDINQEPIIFGVDIQKVVEKENIGLMVPLLIQKCIMEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKAVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSNGCENDPGDSKYTVDLLDCLPEIEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQRQEPSTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWP 1028          
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:HGNC Symbol;Acc:HGNC:25824])

HSP 1 Score: 172.94 bits (437), Expect = 4.771e-44
Identity = 116/375 (30.93%), Postives = 184/375 (49.07%), Query Frame = 3
Query: 1350 GMLVIHLIAGVGLNSSHSVI-KDLYCVIETDALRKARS-MIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFR-HRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHK----TSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQS--------EIFQFIMTIWPSNIGLSRSSKYTHESLSRKSQKEM 2429
            G L +HL    GL  +     +DL C+++ D   +AR+  +R   +    D  F +E+     L  L+  WDP  R HR C  G + L ++           ++LA++LEP+G+LY ++     +E        T  PR +FG  L  L+  E+ P  +P I++ CV +I  RG  VVG+YRL GS  +K +L+D F+R+   + +S D  PDI+ IT +LKD+LRELP PL T+  Y++++ A            T G +    +L CLP   +  L  L+DHL  + +    N+M   +L+  FGP+L  P+ +  ++       P L S        E+  +++  WP +  L R S      L  K Q  +
Sbjct:  266 GRLSLHLYGLGGLRPAPGATPRDLCCLLQVDGEARARTGPLRGGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTVFR-----GCQAQQLAVRLEPQGLLYAKLTLSEQQEA-----PATAEPR-VFGLPLPLLVERERPPGQVPLIIQKCVGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLRELPTPLITQPLYKVVLEAMARDPPNRVPPTTEGTR---GLLSCLPDVERATLTLLLDHLRLVSSFHAYNRMTPQNLAVCFGPVLL-PARQAPTRPRARSSGPGLASAVDFKHHIEVLHYLLQSWP-DPRLPRQSPDVAPYLRPKRQPPL 624          
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:HGNC Symbol;Acc:HGNC:25824])

HSP 1 Score: 171.785 bits (434), Expect = 6.850e-44
Identity = 116/375 (30.93%), Postives = 184/375 (49.07%), Query Frame = 3
Query: 1350 GMLVIHLIAGVGLNSSHSVI-KDLYCVIETDALRKARS-MIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFR-HRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHK----TSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQS--------EIFQFIMTIWPSNIGLSRSSKYTHESLSRKSQKEM 2429
            G L +HL    GL  +     +DL C+++ D   +AR+  +R   +    D  F +E+     L  L+  WDP  R HR C  G + L ++           ++LA++LEP+G+LY ++     +E        T  PR +FG  L  L+  E+ P  +P I++ CV +I  RG  VVG+YRL GS  +K +L+D F+R+   + +S D  PDI+ IT +LKD+LRELP PL T+  Y++++ A            T G +    +L CLP   +  L  L+DHL  + +    N+M   +L+  FGP+L  P+ +  ++       P L S        E+  +++  WP +  L R S      L  K Q  +
Sbjct:  199 GRLSLHLYGLGGLRPAPGATPRDLCCLLQVDGEARARTGPLRGGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTVFR-----GCQAQQLAVRLEPQGLLYAKLTLSEQQEA-----PATAEPR-VFGLPLPLLVERERPPGQVPLIIQKCVGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLRELPTPLITQPLYKVVLEAMARDPPNRVPPTTEGTR---GLLSCLPDVERATLTLLLDHLRLVSSFHAYNRMTPQNLAVCFGPVLL-PARQAPTRPRARSSGPGLASAVDFKHHIEVLHYLLQSWP-DPRLPRQSPDVAPYLRPKRQPPL 557          
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: BCR (BCR activator of RhoGEF and GTPase [Source:HGNC Symbol;Acc:HGNC:1014])

HSP 1 Score: 139.813 bits (351), Expect = 7.650e-33
Identity = 111/353 (31.44%), Postives = 171/353 (48.44%), Query Frame = 3
Query: 1320 IPIT------RGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQ----------WDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGM-LYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDP 2312
            IP+T         G  G L + + +  G   S     +LYC +E D+    + KA++ +   T    W+E FEIE+  +  L IL Y+           D     RL   G + LD       + + + ++  + +   G+ + L ++F + E +  R  ++      +FG  +K  ++ ++    +P IV+ CV+EI  RG E VGIYR+SG +   IQ LK  FD     +++    + D++AI   LK + RELPEPLFT+ FY        L  +   + E  MLN+L  LP  N    LFL+DHL ++  K   NKM L +L+ +FGP L  PS E  SKL  +   P
Sbjct:  895 IPLTINKEDDESPGLYGFLNVIVHSATGFKQS----SNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQA----LQDRDWQRTVIAM--NGIEVKLSVKFNSREFSLKRMPSRKQT--GVFG--VKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSG-VATDIQALKAAFDVNNKDVSVMMSEM-DVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIAL--SDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPS-EKESKLPANPSQP 1228          
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:HGNC Symbol;Acc:HGNC:25824])

HSP 1 Score: 131.724 bits (330), Expect = 2.646e-32
Identity = 89/277 (32.13%), Postives = 141/277 (50.90%), Query Frame = 3
Query: 1635 NTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHK----TSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQS--------EIFQFIMTIWPSNIGLSRSSKYTHESLSRKSQKEM 2429
                ++LA++LEP+G+LY ++     +E        T  PR +FG  L  L+  E+ P  +P I++ CV +I  RG  VVG+YRL GS  +K +L+D F+R+   + +S D  PDI+ IT +LKD+LRELP PL T+  Y++++ A            T G +    +L CLP   +  L  L+DHL  + +    N+M   +L+  FGP+L  P+ +  ++       P L S        E+  +++  WP +  L R S      L  K Q  +
Sbjct:   16 GCQAQQLAVRLEPQGLLYAKLTLSEQQEA-----PATAEPR-VFGLPLPLLVERERPPGQVPLIIQKCVGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLRELPTPLITQPLYKVVLEAMARDPPNRVPPTTEGTR---GLLSCLPDVERATLTLLLDHLRLVSSFHAYNRMTPQNLAVCFGPVLL-PARQAPTRPRARSSGPGLASAVDFKHHIEVLHYLLQSWP-DPRLPRQSPDVAPYLRPKRQPPL 281          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: syd-1 (Rho GTPase-activating protein syd-1 [Source:UniProtKB/Swiss-Prot;Acc:Q86NH1])

HSP 1 Score: 209.92 bits (533), Expect = 8.988e-57
Identity = 118/360 (32.78%), Postives = 205/360 (56.94%), Query Frame = 3
Query: 1338 SGFSGMLVIHLIAGVGLN---SSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKL-ALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPR--SIFGRSLKDLIILEK--SPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEK-LMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFY------P-SLEGSSKLSK-SILDPSLQSEIFQFIMTIWPSNI 2366
            S  +G+L +H++ G GL        + +++YCV+E D   +AR+ + T  + F+W E F I+++N T  +  +Y W P+FRH+LC+ G+L    L+  + +   N++++ AL LEP+G L + I F + +  F R    T+NPR   +FG SL  L+  E+  +PI++  +++    EI  RG +  G+Y L GS++ K  L+   +       ++++++PD + I  ++KDFLRELPEPL +   + M++ A  +   ++    + L+L I+DCL +  +N LL ++DHL  ++  S  N +    LS IF PLLF+      P ++  +SK++    LD +  S   Q I++IWPS +
Sbjct:  346 SSLTGILYVHIVEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSL---KLLEAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRR----TVNPRLNGVFGISLSRLVQRERRDTPIVLTRLIQ----EIEKRGVDYSGLYVLCGSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVLKIIDCLQLSAKNCLLLVLDHLSTVLCSSPHNGLTPTRLSLIFAPLLFFCLDTFSPYTISPTSKMAAVRTLDINQASSSLQMILSIWPSRV 694          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: syd-1 (Rho GTPase-activating protein syd-1 [Source:UniProtKB/Swiss-Prot;Acc:Q86NH1])

HSP 1 Score: 209.92 bits (533), Expect = 6.621e-56
Identity = 118/360 (32.78%), Postives = 205/360 (56.94%), Query Frame = 3
Query: 1338 SGFSGMLVIHLIAGVGLN---SSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKL-ALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPR--SIFGRSLKDLIILEK--SPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEK-LMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFY------P-SLEGSSKLSK-SILDPSLQSEIFQFIMTIWPSNI 2366
            S  +G+L +H++ G GL        + +++YCV+E D   +AR+ + T  + F+W E F I+++N T  +  +Y W P+FRH+LC+ G+L    L+  + +   N++++ AL LEP+G L + I F + +  F R    T+NPR   +FG SL  L+  E+  +PI++  +++    EI  RG +  G+Y L GS++ K  L+   +       ++++++PD + I  ++KDFLRELPEPL +   + M++ A  +   ++    + L+L I+DCL +  +N LL ++DHL  ++  S  N +    LS IF PLLF+      P ++  +SK++    LD +  S   Q I++IWPS +
Sbjct:  544 SSLTGILYVHIVEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSL---KLLEAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRR----TVNPRLNGVFGISLSRLVQRERRDTPIVLTRLIQ----EIEKRGVDYSGLYVLCGSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVLKIIDCLQLSAKNCLLLVLDHLSTVLCSSPHNGLTPTRLSLIFAPLLFFCLDTFSPYTISPTSKMAAVRTLDINQASSSLQMILSIWPSRV 892          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: syd-1 (Rho GTPase-activating protein syd-1 [Source:UniProtKB/Swiss-Prot;Acc:Q86NH1])

HSP 1 Score: 210.305 bits (534), Expect = 6.949e-56
Identity = 118/360 (32.78%), Postives = 205/360 (56.94%), Query Frame = 3
Query: 1338 SGFSGMLVIHLIAGVGLN---SSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKL-ALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPR--SIFGRSLKDLIILEK--SPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEK-LMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFY------P-SLEGSSKLSK-SILDPSLQSEIFQFIMTIWPSNI 2366
            S  +G+L +H++ G GL        + +++YCV+E D   +AR+ + T  + F+W E F I+++N T  +  +Y W P+FRH+LC+ G+L    L+  + +   N++++ AL LEP+G L + I F + +  F R    T+NPR   +FG SL  L+  E+  +PI++  +++    EI  RG +  G+Y L GS++ K  L+   +       ++++++PD + I  ++KDFLRELPEPL +   + M++ A  +   ++    + L+L I+DCL +  +N LL ++DHL  ++  S  N +    LS IF PLLF+      P ++  +SK++    LD +  S   Q I++IWPS +
Sbjct:  612 SSLTGILYVHIVEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSL---KLLEAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRR----TVNPRLNGVFGISLSRLVQRERRDTPIVLTRLIQ----EIEKRGVDYSGLYVLCGSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVLKIIDCLQLSAKNCLLLVLDHLSTVLCSSPHNGLTPTRLSLIFAPLLFFCLDTFSPYTISPTSKMAAVRTLDINQASSSLQMILSIWPSRV 960          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 87.4261 bits (215), Expect = 2.513e-18
Identity = 53/171 (30.99%), Postives = 93/171 (54.39%), Query Frame = 3
Query: 1752 PRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFY 2264
            P  +FG +L  +   E S  L+P  +++  + I  +G E  GIYR+SG++    +++   D++ Y   +S +   DIH +T  LK F REL +PLF  + ++   +A ++   + T+  K    +L  LP  N+  L  L+ HL ++ + S  N+M   +L+ +FGP LF+
Sbjct:   88 PEPVFGSTLSAICQHENS--LVPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALVSEE---DIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQM--PNATTRFKKFEELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLFH 251          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 89.7373 bits (221), Expect = 5.667e-18
Identity = 53/171 (30.99%), Postives = 92/171 (53.80%), Query Frame = 3
Query: 1752 PRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFY 2264
            P  +FG +L  +   E S  L+P  +++  + I  +G E  GIYR+SG++    +++   D++ Y   +S +   DIH +T  LK F REL +PLF  + ++   +A ++     T+  K    +L  LP  N+  L  L+ HL ++ + S  N+M   +L+ +FGP LF+
Sbjct:  607 PEPVFGSTLSAICQHENS--LVPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALVSEE---DIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQMPNA--TTRFKKFEELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLFH 770          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0304595)

HSP 1 Score: 269.24 bits (687), Expect = 2.899e-74
Identity = 133/360 (36.94%), Postives = 217/360 (60.28%), Query Frame = 3
Query: 1323 PITRGSGFSGMLVIHLIAGVGL---------NSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINP--RSIFGRSLKDLIILEK--SP--ILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSG-EKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIW 2354
            PI    G SGML IHL+AG GL          ++    +DLYCVIE D + KAR+++R+    F+WDE FE++++ N  L +L+Y WDP+ RH+LCY G ++L S++    ++     +LAL++EP+G +Y+ ++  +    + R G  ++     ++FG  L+ ++  E   +P    +P +++ CV+E+  RG +++G+YRL GS   K  L++ F+R    + ++ + VPDI+ IT VLKD+LRELPEPLFT   +QM V+A  +    +  G  KLML+ILDCLP  N+  L+FL+DHL  +++ SE NKM   +L+ + GP L    L  +S    + +D +    + ++++ IW
Sbjct:  780 PIVDIGGISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLH-----QLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFGADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLM---LHSASAQPGADIDHAQPIAVLKYLLQIW 1131          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0309829)

HSP 1 Score: 269.24 bits (687), Expect = 2.903e-74
Identity = 133/360 (36.94%), Postives = 217/360 (60.28%), Query Frame = 3
Query: 1323 PITRGSGFSGMLVIHLIAGVGL---------NSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINP--RSIFGRSLKDLIILEK--SP--ILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSG-EKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIW 2354
            PI    G SGML IHL+AG GL          ++    +DLYCVIE D + KAR+++R+    F+WDE FE++++ N  L +L+Y WDP+ RH+LCY G ++L S++    ++     +LAL++EP+G +Y+ ++  +    + R G  ++     ++FG  L+ ++  E   +P    +P +++ CV+E+  RG +++G+YRL GS   K  L++ F+R    + ++ + VPDI+ IT VLKD+LRELPEPLFT   +QM V+A  +    +  G  KLML+ILDCLP  N+  L+FL+DHL  +++ SE NKM   +L+ + GP L    L  +S    + +D +    + ++++ IW
Sbjct:  783 PIVDIGGISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLH-----QLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFGADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLM---LHSASAQPGADIDHAQPIAVLKYLLQIW 1134          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0302181)

HSP 1 Score: 268.855 bits (686), Expect = 3.052e-74
Identity = 133/360 (36.94%), Postives = 217/360 (60.28%), Query Frame = 3
Query: 1323 PITRGSGFSGMLVIHLIAGVGL---------NSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINP--RSIFGRSLKDLIILEK--SP--ILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSG-EKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIW 2354
            PI    G SGML IHL+AG GL          ++    +DLYCVIE D + KAR+++R+    F+WDE FE++++ N  L +L+Y WDP+ RH+LCY G ++L S++    ++     +LAL++EP+G +Y+ ++  +    + R G  ++     ++FG  L+ ++  E   +P    +P +++ CV+E+  RG +++G+YRL GS   K  L++ F+R    + ++ + VPDI+ IT VLKD+LRELPEPLFT   +QM V+A  +    +  G  KLML+ILDCLP  N+  L+FL+DHL  +++ SE NKM   +L+ + GP L    L  +S    + +D +    + ++++ IW
Sbjct:  793 PIVDIGGISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLH-----QLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFGADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLM---LHSASAQPGADIDHAQPIAVLKYLLQIW 1144          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0302180)

HSP 1 Score: 268.855 bits (686), Expect = 3.237e-74
Identity = 133/360 (36.94%), Postives = 217/360 (60.28%), Query Frame = 3
Query: 1323 PITRGSGFSGMLVIHLIAGVGL---------NSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINP--RSIFGRSLKDLIILEK--SP--ILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSG-EKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIW 2354
            PI    G SGML IHL+AG GL          ++    +DLYCVIE D + KAR+++R+    F+WDE FE++++ N  L +L+Y WDP+ RH+LCY G ++L S++    ++     +LAL++EP+G +Y+ ++  +    + R G  ++     ++FG  L+ ++  E   +P    +P +++ CV+E+  RG +++G+YRL GS   K  L++ F+R    + ++ + VPDI+ IT VLKD+LRELPEPLFT   +QM V+A  +    +  G  KLML+ILDCLP  N+  L+FL+DHL  +++ SE NKM   +L+ + GP L    L  +S    + +D +    + ++++ IW
Sbjct:  782 PIVDIGGISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLH-----QLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFGADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLM---LHSASAQPGADIDHAQPIAVLKYLLQIW 1133          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0343538)

HSP 1 Score: 268.855 bits (686), Expect = 3.464e-74
Identity = 133/360 (36.94%), Postives = 217/360 (60.28%), Query Frame = 3
Query: 1323 PITRGSGFSGMLVIHLIAGVGL---------NSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINP--RSIFGRSLKDLIILEK--SP--ILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSG-EKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIW 2354
            PI    G SGML IHL+AG GL          ++    +DLYCVIE D + KAR+++R+    F+WDE FE++++ N  L +L+Y WDP+ RH+LCY G ++L S++    ++     +LAL++EP+G +Y+ ++  +    + R G  ++     ++FG  L+ ++  E   +P    +P +++ CV+E+  RG +++G+YRL GS   K  L++ F+R    + ++ + VPDI+ IT VLKD+LRELPEPLFT   +QM V+A  +    +  G  KLML+ILDCLP  N+  L+FL+DHL  +++ SE NKM   +L+ + GP L    L  +S    + +D +    + ++++ IW
Sbjct:  793 PIVDIGGISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLH-----QLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFGADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLM---LHSASAQPGADIDHAQPIAVLKYLLQIW 1144          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: SYDE2 (synapse defective 1, Rho GTPase, homolog 2 (C. elegans) [Source:NCBI gene;Acc:100333199])

HSP 1 Score: 190.66 bits (483), Expect = 4.621e-50
Identity = 113/358 (31.56%), Postives = 195/358 (54.47%), Query Frame = 3
Query: 1344 FSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECF-EWDEVFEIEILNNTCLSILLYQWD--PRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHK-------TSNTSGE-KLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILD-PSLQS--------EIFQFIMTIWP 2357
             SG++ +H      L       +D+YC I+ D++ KAR+ + T    F + D  F IE+ N   L ++++ W+  PR R+R+C  G + L  L   +R+  T+  +LA++LEP+GM+Y+++  +   E    S +       +FG   + ++  E S +++P +++ C+ EI  RG +VVG+YRL GS  +K +L++ F+R+ + + +S    PDI+ IT VLKD+LRELP PL T+  Y+ ++ A              NT  + +L +++LD LP   +  L  L+DHL ++ +  E NKM   +L+  FGP+L     E SS+  +  +D   L S        E+  +++ +WP
Sbjct:  162 ISGLMSLHFYGAEDLKLPRVDSRDIYCAIQVDSVNKARTALLTCRTSFLDMDHTFNIELENAQHLKLVVFSWESTPR-RNRVCCHGTVVLPGL---FRVSKTH--QLAVRLEPRGMIYVKLSLM---EQRQNSLDGDHPQMQVFGVEARHVVEREASGLMVPLLIEKCISEIERRGCQVVGLYRLCGSAAVKKELREAFERDSHSVELSESNYPDINVITGVLKDYLRELPHPLITQQLYECVLEAMMKRPLLMGNAGCENTPADSQLTVSLLDILPDVEKASLKKLLDHLKRVASHHELNKMPCQNLAVCFGPVLLSQRQEASSQAKRVFIDSEELASALHFKKHIEVLHYLLQLWP 510          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:NCBI gene;Acc:568166])

HSP 1 Score: 192.2 bits (487), Expect = 7.129e-50
Identity = 102/326 (31.29%), Postives = 181/326 (55.52%), Query Frame = 3
Query: 1344 FSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKAR-SMIRTSTECFEWDEVFEIEILNNTCLSILLY------QWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEI----QFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKT----SNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLE 2276
             SG+L +HL+    L  ++   K+++C I+ D + +AR S++     C   +  F +E+     L +++             R+R+C  G + + +L    R     ++ L ++LEP+G+LY+++    QF++    F R G+  + P ++FG  L+ L+  E + + +P I++ CV EI  RG  VVG+YRL GS  +K +L+D F+R+   + ++ +  PD++ IT +LKD+LRELP PL T   Y++++ A  +       S+    +  +++L CLP   +  L FL+DHL  + + S+SN+M   +L+  FGP+L  PS E
Sbjct:  435 LSGLLTVHLLGVEELLRANKASKEVFCAIQVDGVTRARTSLLTCRGACLPLNHTFNLELERARLLKLVILTPATANASSAPARNRVCCVGAVAIPALFKACR-----SQHLCVRLEPRGLLYVKLTLLEQFVS---PFPRPGD--LPPPAVFGVELRPLVEKESTALRVPLIIQKCVSEIQRRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVTLNEELYPDVNVITGILKDYLRELPSPLITRTLYEVVLEAMTVRPAYRNDSDAQKSQSTVSLLHCLPEPERATLCFLLDHLSLVASYSDSNRMTCQNLAVCFGPVLLTPSQE 750          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: bcr (BCR activator of RhoGEF and GTPase [Source:ZFIN;Acc:ZDB-GENE-040724-43])

HSP 1 Score: 137.117 bits (344), Expect = 3.481e-32
Identity = 105/341 (30.79%), Postives = 171/341 (50.15%), Query Frame = 3
Query: 1338 SGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQ----------WDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGM-LYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDP 2312
            +G  G L + + +  GL  S     +LYC +E D+    + KA++ +   T   +W+E FEIE+  +  L +L Y+           D     R+   G + LD  +    +   + ++  + +   G+ + + ++F + E +  R  ++   P  +FG ++  +   E+S   +P IV+ C++EI  RG E VGIYR+SG +   IQ LK  FD     +++    + D++AI   LK + RELPEPLFT+  Y        L  + + + E  MLN+L  LP  N    LFL+DHL +I  K   NKM L +L+ +FGP L  P+ E  SK+  +   P
Sbjct:  977 TGLYGFLNVIVHSASGLKQS----LNLYCTLEVDSFGIFVNKAKTRVYRYTTEPKWNEEFEIELEGSHTLRLLCYEKSYNKAKVNKEDGESTDRIMGKGQMPLDPQM----LQGKDWQRTVIPM--NGIEVKISMKFTSREFSLKRMPSR--KPMGVFGVNISTVTKRERS--KVPYIVRQCLEEIERRGMEEVGIYRVSG-VATDIQALKTAFDTNNKDVSVMMSEM-DVNAIAGTLKLYFRELPEPLFTDELYPNFAGGIAL--SDSVAKESCMLNLLLSLPEPNLVTFLFLLDHLKRIAEKECVNKMSLHNLATVFGPTLLRPA-EKDSKIPTNPTQP 1298          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: bcr (BCR activator of RhoGEF and GTPase [Source:ZFIN;Acc:ZDB-GENE-040724-43])

HSP 1 Score: 130.954 bits (328), Expect = 2.357e-30
Identity = 109/366 (29.78%), Postives = 168/366 (45.90%), Query Frame = 3
Query: 1338 SGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQ----------WDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLE-----------------IQFLNCE---------ETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDP 2312
            +G  G L + + +  GL  S     +LYC +E D+    + KA++ +   T   +W+E FEIE+  +  L +L Y+           D     R+   G + LD  +    +   + ++  + +    +LYL                  I FL  E           F      +  P  +FG ++  +   E+S   +P IV+ C++EI  RG E VGIYR+SG +   IQ LK  FD     +++    + D++AI   LK + RELPEPLFT+  Y        L  + + + E  MLN+L  LP  N    LFL+DHL +I  K   NKM L +L+ +FGP L  P+ E  SK+  +   P
Sbjct:  977 TGLYGFLNVIVHSASGLKQS----LNLYCTLEVDSFGIFVNKAKTRVYRYTTEPKWNEEFEIELEGSHTLRLLCYEKSYNKAKVNKEDGESTDRIMGKGQMPLDPQM----LQGKDWQRTVIPMNGVSVLYLHLLLFCYPVIQHLIYSIYICFLKIEVKISMKFTSREFSLKRMPSRKPMGVFGVNISTVTKRERS--KVPYIVRQCLEEIERRGMEEVGIYRVSG-VATDIQALKTAFDTNNKDVSVMMSEM-DVNAIAGTLKLYFRELPEPLFTDELYPNFAGGIAL--SDSVAKESCMLNLLLSLPEPNLVTFLFLLDHLKRIAEKECVNKMSLHNLATVFGPTLLRPA-EKDSKIPTNPTQP 1327          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: si:dkey-91m11.5 (si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-932])

HSP 1 Score: 129.413 bits (324), Expect = 7.878e-30
Identity = 107/358 (29.89%), Postives = 168/358 (46.93%), Query Frame = 3
Query: 1320 IPIT------RGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGM----------------LYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDP 2312
            IP+T        +G  G L + + +  GL  S     +LYC +E D+    + KA++ +   T    W+E FEIE+  +  L +L Y      + + C      +D ++           K  +QL+P+ +                + L ++F + E +  R  ++  +   +FG  +  +   E S +  P IV+ CV+EI  RG E VGIYR+SG +   IQ LK  FD     +++    + D++AI   LK + RELPEPLFT+  Y        L  + + + E  MLN+L  LP  N    LFL+DHL ++      NKM   +L+ +FGP L  PS E  SK+  +   P
Sbjct:  918 IPLTVNKDDDESTGLCGFLNVIVHSATGLKQSL----NLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRLLCYS-----KIKQCRDDGENIDRVM----------AKGQIQLDPQSLQGKDWQRTVISMNGIEVKLSMRFTSREFSLKRMPSRKQS--GVFGVKIGAVTKREHSKV--PLIVRQCVEEIERRGMEEVGIYRVSG-VATDIQALKAAFDANNKDVSVIMSEM-DVNAIAGTLKLYFRELPEPLFTDELYINFTEGIAL--SDSVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENEIVNKMSFHNLATVFGPTLLRPS-EKDSKIPSNPTQP 1247          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: il6 (interleukin 6 [Source:Xenbase;Acc:XB-GENE-480186])

HSP 1 Score: 192.586 bits (488), Expect = 2.554e-49
Identity = 112/360 (31.11%), Postives = 195/360 (54.17%), Query Frame = 3
Query: 1344 FSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECF-EWDEVFEIEILNNTCLSILLYQWDPRFR-HRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFL-NCEETFHRSG--NKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVN--AHELHKTSNTSGE------KLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSK---------SILDPSLQSEIFQFIMTIWP 2357
             SG++ +H      L       KD++C I+ D++ KAR+ + T    F + D  F IE+ N   L ++++ WDP  R +R+C  G + L +L   +R+  T   +LA++LEP+G++Y+++  +   E +  R G   + I    +FG   + ++  E + +++P ++  C+ EI  RG +VVG+YRL GS  +K +L++ F+R+   + +     PDI+ IT VLKD+LRELP PL T+  Y+ ++   A +  K +++  E      +  +++LDCLP   +  L  L+DHL  + +  E NKM   +L+  FGP+L     E SS  ++         S LD     E+  +++ +WP
Sbjct: 1040 ISGLMSLHFYGAEDLKPPKIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIELENAQHLKLVVFSWDPTPRKNRVCCHGTVVLPAL---FRV--TKTHQLAVKLEPRGLIYVKLNLMEQWENSLDRPGVDREPI----VFGVEARKVVEKENAGLMVPLLMDKCITEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKSVGLCESQYPDINVITGVLKDYLRELPSPLITKHLYEAVLKAMAEKPLKMASSGCENDSRDSENTVSLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQRQETSSHNNRVFIDSEELASALDFKKHIEVLHYLLQLWP 1390          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: il6 (interleukin 6 [Source:Xenbase;Acc:XB-GENE-480186])

HSP 1 Score: 191.815 bits (486), Expect = 3.163e-49
Identity = 111/358 (31.01%), Postives = 193/358 (53.91%), Query Frame = 3
Query: 1344 FSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECF-EWDEVFEIEILNNTCLSILLYQWDPRFR-HRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFL-NCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVN--AHELHKTSNTSGE------KLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSK---------SILDPSLQSEIFQFIMTIWP 2357
             SG++ +H      L       KD++C I+ D++ KAR+ + T    F + D  F IE+ N   L ++++ WDP  R +R+C  G + L +L   +R+  T   +LA++LEP+G++Y+++  +   E +  R G        +FG   + ++  E + +++P ++  C+ EI  RG +VVG+YRL GS  +K +L++ F+R+   + +     PDI+ IT VLKD+LRELP PL T+  Y+ ++   A +  K +++  E      +  +++LDCLP   +  L  L+DHL  + +  E NKM   +L+  FGP+L     E SS  ++         S LD     E+  +++ +WP
Sbjct:  813 ISGLMSLHFYGAEDLKPPKIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIELENAQHLKLVVFSWDPTPRKNRVCCHGTVVLPAL---FRV--TKTHQLAVKLEPRGLIYVKLNLMEQWENSLDRPG--VDREPIVFGVEARKVVEKENAGLMVPLLMDKCITEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKSVGLCESQYPDINVITGVLKDYLRELPSPLITKHLYEAVLKAMAEKPLKMASSGCENDSRDSENTVSLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQRQETSSHNNRVFIDSEELASALDFKKHIEVLHYLLQLWP 1163          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:100170543])

HSP 1 Score: 131.339 bits (329), Expect = 2.724e-30
Identity = 107/344 (31.10%), Postives = 168/344 (48.84%), Query Frame = 3
Query: 1338 SGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDP-RFR----------HRLCYFGNLTLDS---LINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDP 2312
            SG  G L + + +  G   S     +L+C +E D+    + KA++ +  +T    W+E FEIE+  +  L IL Y+    R R           R+   G + L+S   L   W     +   +++ +E K    L ++F + E +  R  ++      +FG  +K  ++ ++    +P IV+ CV+EI  RG E VGIYR+SG +   IQ LK+ FD     +++    + D++AI   LK + RELP PLFT+  Y        L  +   + E  MLN+L  LP  N    LFL+DHL ++      NKM L +L+ +FGP L  PS E  SK+  +   P
Sbjct:  794 SGLYGFLNVIVHSATGFQQS----SNLFCTLEVDSFGYFVNKAKTRVYRNTTEPNWNEEFEIELEGSQTLRILCYEKSCNRNRPMKEDGGDSSERMVAKGQVQLESQLALGKDWHRSVVSMNGVSILIEVK----LSMKFTSREFSLKRLPSRKQT--GVFG--VKIAVVTKRERSKVPYIVRQCVEEIERRGLEEVGIYRVSG-VATDIQALKNAFDANNKDVSVMMSDM-DVNAIAGTLKLYFRELPAPLFTDELYPNFAEGIAL--SDPVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENESQNKMSLHNLATVFGPTLLRPS-EKDSKIPVNPTQP 1120          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:100170543])

HSP 1 Score: 129.798 bits (325), Expect = 6.768e-30
Identity = 105/339 (30.97%), Postives = 165/339 (48.67%), Query Frame = 3
Query: 1338 SGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGN-LTLDSLINHWRMYNTNNEKLALQ-------LEPKGM-LYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDP 2312
            SG  G L + + +  G   S     +L+C +E D+    + KA++ +  +T    W+E FEIE+  +  L IL Y+       + C     +  D   +  RM      +LAL        +   G+ + L ++F + E +  R  ++      +FG  +K  ++ ++    +P IV+ CV+EI  RG E VGIYR+SG +   IQ LK+ FD     +++    + D++AI   LK + RELP PLFT+  Y        L  +   + E  MLN+L  LP  N    LFL+DHL ++      NKM L +L+ +FGP L  PS E  SK+  +   P
Sbjct:  771 SGLYGFLNVIVHSATGFQQS----SNLFCTLEVDSFGYFVNKAKTRVYRNTTEPNWNEEFEIELEGSQTLRILCYE-------KSCNRNRPMKEDGGDSSERMVAKGQVQLALGKDWHRSVVSMNGIEVKLSMKFTSREFSLKRLPSRKQT--GVFG--VKIAVVTKRERSKVPYIVRQCVEEIERRGLEEVGIYRVSG-VATDIQALKNAFDANNKDVSVMMSDM-DVNAIAGTLKLYFRELPAPLFTDELYPNFAEGIAL--SDPVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENESQNKMSLHNLATVFGPTLLRPS-EKDSKIPVNPTQP 1089          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: abr (ABR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:779766])

HSP 1 Score: 127.487 bits (319), Expect = 3.556e-29
Identity = 107/339 (31.56%), Postives = 161/339 (47.49%), Query Frame = 3
Query: 1341 GFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNE-------KLALQLEPKGM----------------LYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHI-NISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPS 2270
            G  G L  H+I       SHS   +LYC +E D+    + KA++ +   T   EW+E FEIE+  + CL IL Y+         CY          +  ++   NNE       K  +QL+P+ +                +   ++F + + +  R+ +K      +FG  +  +   E+S +  P IV+ C++E+  RG E VGIYR+SG +   IQ LK  FD     I  + SD   DI+AI   LK + RELPEPL T+  Y   +    L  +   + E  M+++L  LP  N    LFL+ HL ++  K   NKM L +L+ +FGP L  PS
Sbjct:  661 GLYGFL--HVIVKSAKGFSHS--SNLYCTLEVDSFGYFVSKAKTRVFRDTTEPEWNEEFEIELEGSQCLRILCYE--------KCY----------DKSKLNKDNNEIVDKIMGKGQIQLDPQVVQSKNWHDDVIEMNGIKVEFSMKFSSRDMSLKRTPSKKQT--GVFGVKISVVTKRERSKV--PYIVRQCIEEVEKRGIEEVGIYRISG-VATDIQALKASFDANSKDILMMLSDM--DINAIAGTLKLYFRELPEPLLTDRLYLAFMEGIAL--SDPAAKENCMMHLLRSLPDPNLMTFLFLLQHLKRVAEKEPINKMSLHNLATVFGPTLLRPS 968          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Syde2 (synapse defective 1, Rho GTPase, homolog 2 (C. elegans) [Source:MGI Symbol;Acc:MGI:3036264])

HSP 1 Score: 197.208 bits (500), Expect = 3.347e-51
Identity = 112/358 (31.28%), Postives = 197/358 (55.03%), Query Frame = 3
Query: 1344 FSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECF-EWDEVFEIEILNNTCLSILLYQWDPR-FRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFL-NCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELH--KTSNTSGE------KLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSK---------SILDPSLQSEIFQFIMTIWP 2357
             SG++ +H     GL       KD++C I+ D++ KAR+ + T    F + D  F IEI N   L ++++ W+P   R+R+C  G + L +L   +R+  T   +LA++LEP+G++Y+++  +   E + H  G        +FG  ++ ++  E   +++P +++ C+ EI  RG +VVG+YRL GS  +K +L++ F+++   + +  +  PDI+ IT VLKD+LRELP PL T+  Y+ +++A      K S++  E      +L +++LDCLP   +  L  L+DHL  + +  E NKM   +L+  FGP+L     E S+  ++         S LD     E+  +++ +WP
Sbjct:  531 ISGLMSVHFYGAEGLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRRNRVCCHGTVVLPAL---FRV--TKTHQLAVKLEPRGLIYVKVTLMEQWENSLH--GLDKNREAVMFGVDIQKVVEKENVGLMVPLLIQKCIVEIEKRGCQVVGLYRLCGSAAVKKELREAFEKDSKTVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSSGCENEPSDSRLTVDLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLNQRQEASTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWP 881          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Syde2 (synapse defective 1, Rho GTPase, homolog 2 (C. elegans) [Source:MGI Symbol;Acc:MGI:3036264])

HSP 1 Score: 197.208 bits (500), Expect = 3.480e-51
Identity = 112/358 (31.28%), Postives = 197/358 (55.03%), Query Frame = 3
Query: 1344 FSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECF-EWDEVFEIEILNNTCLSILLYQWDPR-FRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFL-NCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELH--KTSNTSGE------KLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSK---------SILDPSLQSEIFQFIMTIWP 2357
             SG++ +H     GL       KD++C I+ D++ KAR+ + T    F + D  F IEI N   L ++++ W+P   R+R+C  G + L +L   +R+  T   +LA++LEP+G++Y+++  +   E + H  G        +FG  ++ ++  E   +++P +++ C+ EI  RG +VVG+YRL GS  +K +L++ F+++   + +  +  PDI+ IT VLKD+LRELP PL T+  Y+ +++A      K S++  E      +L +++LDCLP   +  L  L+DHL  + +  E NKM   +L+  FGP+L     E S+  ++         S LD     E+  +++ +WP
Sbjct:  532 ISGLMSVHFYGAEGLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRRNRVCCHGTVVLPAL---FRV--TKTHQLAVKLEPRGLIYVKVTLMEQWENSLH--GLDKNREAVMFGVDIQKVVEKENVGLMVPLLIQKCIVEIEKRGCQVVGLYRLCGSAAVKKELREAFEKDSKTVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSSGCENEPSDSRLTVDLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLNQRQEASTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWP 882          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Syde2 (synapse defective 1, Rho GTPase, homolog 2 (C. elegans) [Source:MGI Symbol;Acc:MGI:3036264])

HSP 1 Score: 196.823 bits (499), Expect = 5.822e-51
Identity = 111/358 (31.01%), Postives = 194/358 (54.19%), Query Frame = 3
Query: 1344 FSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECF-EWDEVFEIEILNNTCLSILLYQWDPR-FRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFL-NCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELH--KTSNTSGE------KLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSK---------SILDPSLQSEIFQFIMTIWP 2357
             SG++ +H     GL       KD++C I+ D++ KAR+ + T    F + D  F IEI N   L ++++ W+P   R+R+C  G + L +L        T   +LA++LEP+G++Y+++  +   E + H  G        +FG  ++ ++  E   +++P +++ C+ EI  RG +VVG+YRL GS  +K +L++ F+++   + +  +  PDI+ IT VLKD+LRELP PL T+  Y+ +++A      K S++  E      +L +++LDCLP   +  L  L+DHL  + +  E NKM   +L+  FGP+L     E S+  ++         S LD     E+  +++ +WP
Sbjct:  799 ISGLMSVHFYGAEGLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRRNRVCCHGTVVLPALFR-----VTKTHQLAVKLEPRGLIYVKVTLMEQWENSLH--GLDKNREAVMFGVDIQKVVEKENVGLMVPLLIQKCIVEIEKRGCQVVGLYRLCGSAAVKKELREAFEKDSKTVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSSGCENEPSDSRLTVDLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLNQRQEASTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWP 1149          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Syde1 (synapse defective 1, Rho GTPase, homolog 1 (C. elegans) [Source:MGI Symbol;Acc:MGI:1918959])

HSP 1 Score: 183.341 bits (464), Expect = 1.568e-47
Identity = 113/347 (32.56%), Postives = 181/347 (52.16%), Query Frame = 3
Query: 1350 GMLVIHLIAGVGLNSSHSVI-KDLYCVIETDALRKARS-MIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFR-HRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNA-HELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLF-------YPSLEGSSKLSKSILDPSLQSEIFQFIMTIWP 2357
            G L +HL    GL  S     +DL C+++ D + +AR+  +R+  +    D  F +E+     L  L+  WDP  R HR C  G + L ++           ++LA++LEP+G+LY ++     +E        T  PR +FG  L+ L+  E+SP  +P I++ CV +I  RG  VVG+YRL GS  +K +L+D F+++   + +S D  PDI+ IT +LKD+LRELP PL T+  YQ+++ A  + H +  + G +    +L CLP   +  L  L+DHL  + +    N+M   +L+  FGP+L         P L  S     S +D     E+  +++  WP
Sbjct:  266 GRLSLHLYGLGGLRPSPGATPRDLCCLLQVDGVARARTGPLRSGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTIFR-----GCQAQQLAVRLEPQGLLYAKLTLSEQQEA-----PATAEPR-VFGLPLQLLVEREQSPGQVPLIIRKCVGQIECRGLRVVGLYRLCGSAAVKKELRDAFEQDSAAVCLSEDVYPDINVITGILKDYLRELPTPLITQPLYQVVLEAMAQGHPSRASLGPEGTRGLLRCLPDVERATLTLLLDHLRLVSSFHTHNRMTPQNLAVCFGPVLLPARQTPSRPRLRSSGPGVTSAVDFKRHIEVLHYLLQSWP 601          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Bcr (BCR activator of RhoGEF and GTPase [Source:MGI Symbol;Acc:MGI:88141])

HSP 1 Score: 142.124 bits (357), Expect = 9.738e-34
Identity = 113/366 (30.87%), Postives = 171/366 (46.72%), Query Frame = 3
Query: 1317 YIPIT------RGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNE-------KLALQLEPKGM----------------LYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDP 2312
            +IP+T         G  G L + + +  G   S     +LYC +E D+    + KA++ +   T    W+E FEIE+  +  L IL Y+         CY          N  +M   + E       K  +QL+P+ +                + L ++F + E +  R  ++      +FG  +K  ++ ++    +P IV+ CV+EI  RG E VGIYR+SG +   IQ LK  FD     +++    + D++AI   LK + RELPEPLFT+ FY        L  +   + E  MLN+L  LP  N    LFL+DHL ++  K   NKM L +L+ +FGP L  PS E  SKL  +   P
Sbjct:  893 HIPLTINKEDDESPGLYGFLHVIVHSATGFKQSS----NLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRILCYE--------KCY----------NKMKMTKEDGESADKLMGKGQVQLDPQTLQDRDWQRTVIDMNGIEVKLSVKFTSREFSLKRMPSRKQT--GVFG--VKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSG-VATDIQALKAAFDVNNKDVSVMMSEM-DVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIAL--SDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLHNLATVFGPTLLRPS-EKESKLPANPSQP 1227          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|Q9V9S7|SYDE_DROME (Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2)

HSP 1 Score: 268.855 bits (686), Expect = 3.059e-73
Identity = 133/360 (36.94%), Postives = 217/360 (60.28%), Query Frame = 3
Query: 1323 PITRGSGFSGMLVIHLIAGVGL---------NSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINP--RSIFGRSLKDLIILEK--SP--ILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSG-EKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIW 2354
            PI    G SGML IHL+AG GL          ++    +DLYCVIE D + KAR+++R+    F+WDE FE++++ N  L +L+Y WDP+ RH+LCY G ++L S++    ++     +LAL++EP+G +Y+ ++  +    + R G  ++     ++FG  L+ ++  E   +P    +P +++ CV+E+  RG +++G+YRL GS   K  L++ F+R    + ++ + VPDI+ IT VLKD+LRELPEPLFT   +QM V+A  +    +  G  KLML+ILDCLP  N+  L+FL+DHL  +++ SE NKM   +L+ + GP L    L  +S    + +D +    + ++++ IW
Sbjct:  793 PIVDIGGISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLH-----QLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFGADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLM---LHSASAQPGADIDHAQPIAVLKYLLQIW 1144          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|Q86NH1|SYD1_CAEEL (Rho GTPase-activating protein syd-1 OS=Caenorhabditis elegans OX=6239 GN=syd-1 PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 8.840e-55
Identity = 118/360 (32.78%), Postives = 205/360 (56.94%), Query Frame = 3
Query: 1338 SGFSGMLVIHLIAGVGLN---SSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKL-ALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPR--SIFGRSLKDLIILEK--SPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEK-LMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFY------P-SLEGSSKLSK-SILDPSLQSEIFQFIMTIWPSNI 2366
            S  +G+L +H++ G GL        + +++YCV+E D   +AR+ + T  + F+W E F I+++N T  +  +Y W P+FRH+LC+ G+L    L+  + +   N++++ AL LEP+G L + I F + +  F R    T+NPR   +FG SL  L+  E+  +PI++  +++    EI  RG +  G+Y L GS++ K  L+   +       ++++++PD + I  ++KDFLRELPEPL +   + M++ A  +   ++    + L+L I+DCL +  +N LL ++DHL  ++  S  N +    LS IF PLLF+      P ++  +SK++    LD +  S   Q I++IWPS +
Sbjct:  612 SSLTGILYVHIVEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSL---KLLEAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRR----TVNPRLNGVFGISLSRLVQRERRDTPIVLTRLIQ----EIEKRGVDYSGLYVLCGSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVLKIIDCLQLSAKNCLLLVLDHLSTVLCSSPHNGLTPTRLSLIFAPLLFFCLDTFSPYTISPTSKMAAVRTLDINQASSSLQMILSIWPSRV 960          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|Q61CA4|SYD1_CAEBR (Rho GTPase-activating protein syd-1 OS=Caenorhabditis briggsae OX=6238 GN=syd-1 PE=3 SV=2)

HSP 1 Score: 209.92 bits (533), Expect = 1.160e-54
Identity = 123/387 (31.78%), Postives = 212/387 (54.78%), Query Frame = 3
Query: 1338 SGFSGMLVIHLIAGVGLN---SSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKL-ALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPR--SIFGRSLKDLIILEK--SPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEK-LMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSI---------LDPSLQSEIFQFIMTIWPSNIGLSRSSKYTHESLSRKSQKEMAASTY 2444
            S  +G+L +H++ G GL        + +++YCV+E D   +AR+ + T  + F+W E F I+++N T  +  +Y W P+FRH+LC+ G+L    L+  + +   N++++ AL LEP+G L + I F + +  F R    T+NPR   +FG  L  L+  E+  +PI++  +++    EI  RG ++ G+Y L GS++ K  L+   +      +++++ +PD + I  ++KDFLRELPEPL +   + M++ A  +   ++    + L+L I+DCL +  +N LL ++DHL  I+  S  N +    LS IF PLLF+  L+  S  + S          LD +  S   Q I++IWPS +    +S+   +S +   QK     +Y
Sbjct:  586 SSLTGILYVHILEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSL---KLLEAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRR----TVNPRLNGVFGVPLGRLVQRERRDTPIVLTRLIQ----EIEKRGVDLSGLYVLCGSVEKKKMLRAQLESNPLGTDLNAENIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAATVALPNDVQANRTLVLKIIDCLQLSAKNCLLLVLDHLSTILCSSPHNGLTPTRLSLIFAPLLFF-CLDAISPYTTSPTSKMAAVRSLDMNQASSSLQMILSIWPSRV----NSESGSDSPATSGQKGGGGVSY 956          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|Q5VT97|SYDE2_HUMAN (Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 3.660e-49
Identity = 113/358 (31.56%), Postives = 194/358 (54.19%), Query Frame = 3
Query: 1344 FSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECF-EWDEVFEIEILNNTCLSILLYQWDPRFR-HRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFL-NCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNA---HELHKTSN-----TSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSK---------SILDPSLQSEIFQFIMTIWP 2357
             SG++ +H      L       KD++C I+ D++ KAR+ + T    F + D  F IEI N   L ++++ W+P  R +R+C  G + L +L   +R+  T   +LA++LEP+G++Y+++  +   E + H  G        IFG  ++ ++  E   +++P +++ C+ EI  RG +VVG+YRL GS  +K +L++ F+R+   + +  +  PDI+ IT VLKD+LRELP PL T+  Y+ +++A     L  +SN         K  +++LDCLP   +  L  L+DHL  + +  E NKM   +L+  FGP+L     E S+  ++         S LD     E+  +++ +WP
Sbjct:  678 ISGLMSVHFYGAEDLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRKNRVCCHGTVVLPTL---FRV--TKTHQLAVKLEPRGLIYVKVTLMEQWENSLH--GLDINQEPIIFGVDIQKVVEKENIGLMVPLLIQKCIMEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKAVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSNGCENDPGDSKYTVDLLDCLPEIEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQRQEPSTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWP 1028          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|D3ZZN9|SYDE1_RAT (Rho GTPase-activating protein SYDE1 OS=Rattus norvegicus OX=10116 GN=Syde1 PE=1 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 3.516e-47
Identity = 114/347 (32.85%), Postives = 184/347 (53.03%), Query Frame = 3
Query: 1350 GMLVIHLIAGVGLNSSHSVI-KDLYCVIETDALRKARS-MIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFR-HRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNA-HELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLF----YPS---LEGSSKLSKSILDPSLQSEIFQFIMTIWP 2357
            G L +HL    GL  +     +DL C+++ D + +AR+  +R+  +    D  F +E+     L  L+  WDP  R HR C  G + L ++           ++LA++LEP+G+LY ++     +E        T+ PR +FG  L+ L+  E+SP  +P I++ CV +I  RG  VVG+YRL GS  +K +L+D F+++   + +S D  PDI+ IT +LKD+LRELP PL T+  YQ+++ A  + H +  + G +    +L CLP   +  L  L+DHL  + +    N+M   +L+  FGP+L      PS   L GS     S +D     E+  +++  WP
Sbjct:  266 GRLSLHLYGLGGLRPTPGATPRDLCCLLQVDGVARARTGPLRSGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTIFR-----GCQAQQLAVRLEPQGLLYAKLTLSEQQEA-----PATVEPR-VFGLPLQLLVEREQSPGQVPLIIRKCVGQIECRGLRVVGLYRLCGSAAVKKELRDAFEQDSAAVCLSEDVYPDINVITGILKDYLRELPTPLITQPLYQVVLEAMAQGHPSRASLGPEGTRGLLSCLPDVERATLTLLLDHLRLVSSFHTHNRMTPQNLAVCFGPVLLPARQTPSRTRLRGSGPGVSSAVDFKRHIEVLHYLLQSWP 601          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267GUS3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013375g2 PE=4 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 2.175e-103
Identity = 192/459 (41.83%), Postives = 270/459 (58.82%), Query Frame = 3
Query:  993 VYYEPSQLSDHSYFSAIKASYNNVNAQIPSKTRPEKKSHRLDNSNLNSSSVFTRENFKKLGVKASTFSIKDWEIAQFTSKIDVNEFRHITTEHTDXXXXXXXXXXXXXYIPITRG-SGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNT-SGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIWPSN 2363
             Y  P+ L+ HS  S+ + S+    A   ++T  E      D  NL                 A  F +KDWE+A+F+SK++  EFR  +++ +                P   G +G  G+L +H+IAGVGL+SS S+++DLYC++E D+ R ARSMIRTST+CFEWDE F+I       L  LLYQWDPR +HRLC++GN+ L SL++ +R     +EK+AL LEPKG LY E+ F    E F R   +      +FG  L  L   EKS   IP +V+ C+DE+  RG EV GIYRL GS + K  ++D  DR     ++S++ VPDIHA+T VLKDFL ELPEPLFT A Y+M+++A ++    +   G KLML+ILDCLP  NQ  LL L+DHL ++ AK++ NKM    L+   GPLL +PS + + ++   IL     S++ ++I+ IW  N
Sbjct:  517 AYALPAGLARHSTASSTQTSHPPPVAATAARTTKE------DVLNLKG---------------AQKFRVKDWELARFSSKVNKLEFRPCSSDRSAKS-------------PAQLGLAGVDGVLRVHVIAGVGLHSSQSLLRDLYCLLELDSTRVARSMIRTSTDCFEWDEQFDIFCSGARGLGFLLYQWDPRSKHRLCFYGNVNLVSLLSSFRQRYIKSEKIALSLEPKGQLYFEVTFAEVHEVFCREPAQRSG---VFGVPLDLLARREKS--SIPMLVRKCIDEVERRGLEVAGIYRLCGSSRNKQPVRDALDRSAAEADVSAEKVPDIHAVTGVLKDFLCELPEPLFTNALYRMMLDALQVRLPGDPKGGAKLMLSILDCLPPANQETLLLLLDHLKRVAAKADVNKMTTGQLATCLGPLLLFPSPDAARQMDPEILRLGRMSDVLKYILEIWTEN 936          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267F832 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013375g1 PE=4 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 4.436e-103
Identity = 191/459 (41.61%), Postives = 271/459 (59.04%), Query Frame = 3
Query:  993 VYYEPSQLSDHSYFSAIKASYNNVNAQIPSKTRPEKKSHRLDNSNLNSSSVFTRENFKKLGVKASTFSIKDWEIAQFTSKIDVNEFRHITTEHTDXXXXXXXXXXXXXYIPITRG-SGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNT-SGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIWPSN 2363
             Y  P+ L+ HS  S+ + S+    A   ++T  E      D  NL                 A  F +KDWE+A+F+SK++  EFR  +++ +                P   G +G  G+L +H+IAGVGL+SS S+++DLYC++E D+ R ARSMIRTST+CFEWDE F+I       L  LLYQWDPR +HRLC++GN+ L SL++ +R     +EK+AL LEPKG LY E+ F    + F R   + I    +FG  L  L   EKS   IP +V+ C+DE+  RG EV GIYRL GS + K  +++  DR     ++S++ VPDIHA+T VLKDFL ELPEPLFT A Y+M+++A ++    +   G KLML+ILDCLP  NQ  LL L+DHL ++ AK++ NKM    L+   GPLL +PS + + ++   IL     S++ ++I+ IW  N
Sbjct:  517 AYALPAGLARHSTASSTQTSHPPPVAATAARTTKE------DVLNLKG---------------AQKFRVKDWELARFSSKVNKLEFRPCSSDRSAKS-------------PAQLGLAGVDGVLRVHVIAGVGLHSSQSLLRDLYCLLELDSTRVARSMIRTSTDCFEWDEQFDIFCSGARGLGFLLYQWDPRSKHRLCFYGNVNLVSLLSSFRQRYIKSEKIALSLEPKGQLYFEVTFAEVPDVFCREPAQRIG---VFGVPLDLLARREKS--SIPMLVRKCIDEVERRGLEVAGIYRLCGSSRNKQPVREALDRSAAEADVSAEKVPDIHAVTGVLKDFLCELPEPLFTNALYRMMLDALQVRLPGDPKGGAKLMLSILDCLPPANQETLLLLLDHLKRVAAKADVNKMTTGQLATCLGPLLLFPSPDAARQMDPEILRLDRMSDVLKYILEIWTEN 936          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267FC53 (Rho-GAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001957g1 PE=4 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 7.703e-99
Identity = 177/444 (39.86%), Postives = 262/444 (59.01%), Query Frame = 3
Query: 1050 SYNNVNAQIPSKTRPEKKSHRLDNSNLNSSSVFTRENFKKLGVKASTFSIKDWEIAQFTSKIDVNEFRHITTEHTDXXXXXXXXXXXXXYIPITRGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRS-GNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYH-------INISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNT-SGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIW 2354
            +YN+   Q   + RP     R D +NL +S+V               F +KDWE+A+F +K++  EFR   TE                 +P     G  G++ +H+IAGVGL+SSH+V++DLYC+ E D+ R ARSMIRTST+CFEWDE F++       L  LLYQWDP+ +HRLC++G+++L  L    R   T +EKLAL LEP+G LY+E+      E   R+  ++     S FG  ++  +  ++    +P+IV+ C+DE+  RG +V GIYRL GS K K+ L++ F+++          +++S++ VPDIHA+T VLKD+LRE+PEPLFT A Y+M+++A  +    +   G KLML+ILDCLP  NQ  LL L+DHL ++  +S  NKM +  LS    P+L YPS + + ++   +L      E+ +FIM IW
Sbjct:  348 TYNHHQQQ--QQLRPTPPPSRQDVANLGASAV-------------QKFRVKDWELARFAAKVNRLEFRPCPTERRQTAQQQQFG------LPAAELPGVDGVIRVHVIAGVGLHSSHAVLRDLYCLTELDSARTARSMIRTSTDCFEWDEQFDLFASGARTLGFLLYQWDPKCKHRLCFYGSISLSGLFVALRQRGTRSEKLALGLEPRGELYVELTHFTIGEVMCRTQPHRAAAAASSFGSPIE--LAAKRDRQSVPSIVRRCIDEVENRGLDVPGIYRLCGSNKSKMALREAFEQQQQQQQPRSSGVDLSAEKVPDIHAVTGVLKDYLREMPEPLFTNALYRMLIDALAVQIPGDPRGGAKLMLSILDCLPPVNQETLLLLLDHLKRVALRSSVNKMTIDQLSTCLAPMLLYPSPQAARQMDPRLLQLDRMIEVLRFIMQIW 768          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267GK95 (Rho-GAP domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000078g1 PE=4 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 9.390e-99
Identity = 173/431 (40.14%), Postives = 254/431 (58.93%), Query Frame = 3
Query: 1089 RPEKKSHRLDNSNLNSSSVFTRENFKKLGVKASTFSIKDWEIAQFTSKIDVNEFRHITTEHTDXXXXXXXXXXXXXYIPITRGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRS-GNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDR-------EGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNT-SGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIW 2354
            RP     R D +NL +S+V               F +KDWE+A+F +K++  EFR   TE                 +P     G  G++ +H+IAGVGL+SSH+V++DLYC+ E D+ R ARSMIRTST+CFEWDE F++       L  LLYQWDP+ +HRLC++G+++L  L    R   T +EKLAL LEP+G LY+E+      E   R+  ++     S FG  ++  +  ++    +P+IV+ C+DE+  RG +V GIYRL GS K K+ L++ F++           +++S++ VPDIHA+T VLKD+LRE+PEPLFT A Y+M+++A  +    +   G KLML+ILDCLP  NQ  LL L+DHL ++  +S  NKM +  LS    P+L YPS + + ++   +L      E+ + IM IW
Sbjct:   88 RPTPPPSRQDVANLGASAV-------------QKFRVKDWELARFAAKVNRLEFRPCPTERRQTAQQQQFG------LPAAELPGVDGVIRVHVIAGVGLHSSHAVLRDLYCLTELDSARTARSMIRTSTDCFEWDEQFDLFASGARTLGFLLYQWDPKCKHRLCFYGSISLGGLFVALRQRGTRSEKLALGLEPRGELYVELTHFTIGEVMCRTQPHRAAAAASSFGSPIE--LAAKRDRQSVPSIVRRCIDEVEKRGLDVPGIYRLCGSNKSKMALREAFEQQQQQQQPRSTGVDLSAEKVPDIHAVTGVLKDYLREMPEPLFTNALYRMLIDALAVQIPGDPRGGAKLMLSILDCLPPVNQETLLLLLDHLKRVALRSSVNKMTIDQLSTCLAPMLLYPSPQAARQMDPRLLQLDRMIEVLRLIMQIW 497          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267FNT3 (Rho-GAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006817g1 PE=4 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 4.706e-98
Identity = 174/431 (40.37%), Postives = 256/431 (59.40%), Query Frame = 3
Query: 1089 RPEKKSHRLDNSNLNSSSVFTRENFKKLGVKASTFSIKDWEIAQFTSKIDVNEFRHITTEHTDXXXXXXXXXXXXXYIPITRGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRS-GNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYH-------INISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNT-SGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIW 2354
            RP     R D +NL +S+V               F +KDWE+A+F +K++  EFR   TE                 +P     G  G++ +H+IAGVGL+SSH+V++DLYC+ E D+ R ARSMIRTST+CFEWDE F++       L  LLYQWDP+ +HRLC++G+++L  L    R   T +EKLAL LEP+G LY+E+      E   R+  ++     S FG  ++  +  ++    +P+IV+ C+DE+  RG +V GIYRL GS K K+ L++ F+++          +++S++ VPDIHA+T VLKD+LRE+PEPLFT A Y+M+++A  +    +   G KLML+ILDCLP  NQ  LL L+DHL ++  +S  NKM +  LS    P+L YPS + + ++   +L      E+ +FIM IW
Sbjct:  372 RPTPPPSRQDVANLGASAV-------------QKFRVKDWELARFAAKVNRLEFRPCPTERRQTAQQQQFG------LPAAELPGVDGVIRVHVIAGVGLHSSHAVLRDLYCLTELDSARTARSMIRTSTDCFEWDEQFDLFASGARTLGFLLYQWDPKCKHRLCFYGSISLSGLFVALRQRGTRSEKLALGLEPRGELYVELTHFTIGEVMCRTQPHRAAAAASSFGSPIE--LAAKRDRQSVPSIVRRCIDEVENRGLDVPGIYRLCGSNKSKMALREAFEQQQQQQQPRSSGVDLSAEKVPDIHAVTGVLKDYLREMPEPLFTNALYRMLIDALAVQIPGDPRGGAKLMLSILDCLPPVNQETLLLLLDHLKRVALRSSVNKMTIDQLSTCLAPMLLYPSPQAARQMDPRLLQLDRMIEVLRFIMQIW 781          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: SYDE2 (synapse defective Rho GTPase homolog 2 [Source:NCBI gene;Acc:103025539])

HSP 1 Score: 182.956 bits (463), Expect = 1.691e-46
Identity = 105/359 (29.25%), Postives = 190/359 (52.92%), Query Frame = 3
Query: 1344 FSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECF-EWDEVFEIEILNNTCLSILLYQWD--PRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFL-NCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSG--------EKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILD-PSLQS--------EIFQFIMTIWP 2357
             SG++ +H     GL    +  + +YC I+ D++ KAR+ + T    F + D  F IE+ N   L + L+ W+  PR R+R+C  G + L  L        T   +LA++LEP+G++Y+++  +   + +     ++     ++FG     ++  E + +++P I++ C+ EI  RG +VVG+YRL GS  +K +L++ F+R+ + I +S    PDI+ IT VLKD+LRELP PL ++  Y+ ++++         SG         +  +++L+ LP   +  L  L+DHL ++ +  E NKM   +L+  FGP+L     + S   ++  +D   L S        E+  +++ +WP
Sbjct: 1031 ISGLMSLHFYGAEGLKPPRADSRHVYCAIQVDSVNKARTALLTCRTAFLDMDHTFNIELENAQHLKLALFSWEAVPR-RNRVCCHGTVVLPPLFR----TATRTHQLAVRLEPRGIIYVKLGLMEQWKNSLRGPDSEREGEANVFGVEAARVVEREGAGLMVPLIIEKCITEIERRGCQVVGLYRLCGSAAVKKELREAFERDSHAIELSESNYPDINVITGVLKDYLRELPFPLISKPLYEAVIDSMAKRPLLIGSGGCENDPAESEHTVSLLETLPEVEKMTLRKLLDHLKRVASHHEVNKMTCQNLAVCFGPVLLSQRQDASCHSNRVFVDSEELASALHFKKHIEVLHYLLQLWP 1384          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:HGNC Symbol;Acc:HGNC:25824])

HSP 1 Score: 144.05 bits (362), Expect = 1.654e-36
Identity = 87/274 (31.75%), Postives = 150/274 (54.74%), Query Frame = 3
Query: 1647 EKLALQLEPKGMLYLEIQFLNCEETFHRSGNKT--INPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTS----NTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPS-------LEGSSK--LSKSILDPSLQSEIFQFIMTIWPSNIGLSRSSKYTHESLSRKSQK 2423
            ++L ++LEP+G+LY+++  L   E +     +   + P ++FG  L+ L+  E+  + +P I++ CV EI  RG +VVG+YRL GS  +K +L+D F+++   + ++ +  PDI+ IT +LKD+LRELP  L T   Y++++ A  +        +T   +  + +L CLP   +  L FL+DHL  + + S+ N M   +L+  FGP+L  P+       L GSS      S +D     E   +++ +WP  I L   S+     L R++Q+
Sbjct:   47 QQLCVKLEPRGLLYVKLTLL---EQWEAPSPRLSELPPPAVFGVELRRLVEKEQHQLKVPLIIQKCVAEIETRGLKVVGLYRLCGSAAVKKELRDAFEKDSAVVTLNEELYPDINVITGILKDYLRELPSALITRTLYEVVLEAMCVRPAGRNDNDTQRSQSTVALLHCLPEPERATLSFLLDHLSLVASFSDCNLMTCQNLAVCFGPVLLTPTQESWRAGLPGSSSEGFGASAVDFKRHIEALHYLLQLWP--IPLHPPSQ---NPLQRRAQR 312          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: bcr (BCR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103040765])

HSP 1 Score: 133.265 bits (334), Expect = 3.928e-31
Identity = 107/354 (30.23%), Postives = 172/354 (48.59%), Query Frame = 3
Query: 1317 YIPIT------RGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQ----------WDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGM-LYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDP 2312
            +IP+T         G  G L + + +  GL  S     +LYC +E D+    + KA++ +   T   +W+E FEIE+  +  L +L Y+           D     R+   G + LD  +    +   + ++  + +   G+ + L ++F + E +  R    +     +FG  +  +   E+S   +P IV+ C++EI  RG E VGIYR+SG +   IQ LK  FD     +++    + D++AI   LK + RELPEPLFT+  Y        L  + + + E  MLN+L  LP  N    LFL+DHL ++  K   NKM L +L+ +FGP L  P+ E  SK+  +   P
Sbjct:  979 HIPLTINKEEDESPGLHGFLNVIIHSASGLKQSL----NLYCTLEVDSFGFFVNKAKTRVYRYTTEPKWNEEFEIELEGSQMLRLLCYEKSYNKSKTNKEDADSTDRIIGKGQIPLDPQM----LQGKDWQRTVIPM--NGIEVKLSMKFTSREFSLKRM--PSCKQAGVFGVKISTVTKRERS--KVPYIVRQCLEEIERRGMEEVGIYRVSG-VATDIQALKTAFDTNNKDVSVMMSEM-DVNAIAGTLKLYFRELPEPLFTDELYPNFAGGIAL--SDSVAKESCMLNLLLSLPEPNLVTFLFLLDHLKRVAEKECVNKMSLHNLATVFGPTLLRPA-EKDSKIPTNPTQP 1313          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: bcr (BCR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103040765])

HSP 1 Score: 132.88 bits (333), Expect = 5.604e-31
Identity = 107/354 (30.23%), Postives = 172/354 (48.59%), Query Frame = 3
Query: 1317 YIPIT------RGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQ----------WDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGM-LYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDP 2312
            +IP+T         G  G L + + +  GL  S     +LYC +E D+    + KA++ +   T   +W+E FEIE+  +  L +L Y+           D     R+   G + LD  +    +   + ++  + +   G+ + L ++F + E +  R    +     +FG  +  +   E+S +  P IV+ C++EI  RG E VGIYR+SG +   IQ LK  FD     +++    + D++AI   LK + RELPEPLFT+  Y        L  + + + E  MLN+L  LP  N    LFL+DHL ++  K   NKM L +L+ +FGP L  P+ E  SK+  +   P
Sbjct:  884 HIPLTINKEEDESPGLHGFLNVIIHSASGLKQSL----NLYCTLEVDSFGFFVNKAKTRVYRYTTEPKWNEEFEIELEGSQMLRLLCYEKSYNKSKTNKEDADSTDRIIGKGQIPLDPQM----LQGKDWQRTVIPM--NGIEVKLSMKFTSREFSLKRM--PSCKQAGVFGVKISTVTKRERSKV--PYIVRQCLEEIERRGMEEVGIYRVSG-VATDIQALKTAFDTNNKDVSVMMSEM-DVNAIAGTLKLYFRELPEPLFTDELYPNFAGGIAL--SDSVAKESCMLNLLLSLPEPNLVTFLFLLDHLKRVAEKECVNKMSLHNLATVFGPTLLRPA-EKDSKIPTNPTQP 1218          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103046632])

HSP 1 Score: 126.716 bits (317), Expect = 4.433e-29
Identity = 106/353 (30.03%), Postives = 171/353 (48.44%), Query Frame = 3
Query: 1320 IPIT------RGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQ--WDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGM----------------LYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHINIS-SDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSK 2288
            IP+T        SG  G L + + +  G   S     +LYC +E D+    + KA++ +   T   +W+E FEIE+  + CL IL Y+  +D   + +L    N  +D ++           K  +QL+P+ +                +   ++F + + +  R+ +K  +   +FG  +  +   E+S +  P IV+ C++E+  RG + VGIYR+SG +   IQ LK  FD     I +  SD   DI+AI   LK + RELPEPL T+  Y   +    L  +   + E  M+++L  LP  N    L L++HL ++  K   NKM L +L+ +FGP L  PS   +SK
Sbjct:  799 IPVTSNKDDEESSGLYGFLHVIVHSATGFKES----ANLYCTLEVDSFGYFVSKAKTRVFRDTAEPQWNEEFEIELEGSQCLRILCYEKCYD---KSKLNKDDNEIVDKIMG----------KGQVQLDPQTVQSKNWHVDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQS--GVFGVKISVVTKRERSKV--PYIVRQCIEEVEKRGIDEVGIYRISG-VATDIQALKAAFDTNTKDILVMLSDM--DINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIAL--SDPAAKENCMMHLLRSLPDPNLITFLTLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSESETSK 1125          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: ARHGAP15 (Rho GTPase activating protein 15 [Source:HGNC Symbol;Acc:HGNC:21030])

HSP 1 Score: 102.064 bits (253), Expect = 2.566e-22
Identity = 55/172 (31.98%), Postives = 97/172 (56.40%), Query Frame = 3
Query: 1761 IFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLE 2276
            +FG  L  L   E S  ++P  V++C+  + ++  E+ G+YR+SG+     +L+ M D +  H+++      DI+ IT  LK F RELPEPL    F++  + A ++ +  N    K M ++++ LP+ N N + FLI HL  ++A  E N+M + +++ +F P L  P ++
Sbjct:  605 VFGCPLACLCERENS--MVPLFVRMCMIALEWQRLEIDGVYRVSGNQATIQKLRIMVDHDE-HVDLDDSQWEDINVITGALKLFFRELPEPLVPYIFFEQFIAAIKIFEYHNRV--KCMKDLINILPLPNHNTMKFLIRHLKTVVAHGEKNRMSMQNMAIVFAPTLLRPEVD 771          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004676.1 (pep scaffold:Pmarinus_7.0:GL476377:189826:224778:-1 gene:ENSPMAG00000004196.1 transcript:ENSPMAT00000004676.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 2.724e-20
Identity = 63/198 (31.82%), Postives = 107/198 (54.04%), Query Frame = 3
Query: 1761 IFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKL--MLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMT 2348
            +FG  L   ++ E+    +P  V++ ++ ++ RG  + GIYR+SG++    +L+ + D E   +++      DIH IT  LK F RELPEPLF    +   ++A +L      S EKL  +   +  LP  N++ +  L +HL K+IA  ++N+M   S++ +FGP L  P  E SS     +     Q++I +FI++
Sbjct:  419 VFGCPLA--MLCERENTTVPKFVQLSIETVDKRGLCIDGIYRVSGNLATIQKLRFLVDHE-EKVSLDESHWEDIHVITGALKMFFRELPEPLFPFNQFDPFISAIKLQD----SREKLTKIKEQVQKLPKPNKDTMRALFEHLKKVIACGDANRMTTQSVAIVFGPTLLRPENESSSMAFHLV----YQNQIVEFILS 605          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004494.1 (pep scaffold:Pmarinus_7.0:GL476606:246273:272967:-1 gene:ENSPMAG00000004080.1 transcript:ENSPMAT00000004494.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 4.696e-20
Identity = 57/180 (31.67%), Postives = 95/180 (52.78%), Query Frame = 3
Query: 1740 KTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLL-KIIAKSESNKMDLVSLSNIFGPLLFYPSLE 2276
            K I    +FG  L+ L   E S   +PN  ++ V  +   G +V GIYR+SG++    +L+ + D E   +++      D+H IT  LK F RELPEPLF   F+   +NA ++   +     + M  ++  LP  N+  +  L +HL  +++A  ++N+M + +L+ +FGP L  P  E
Sbjct:  404 KGIIKEQVFGCPLQTLCEREGS--AVPNFARLSVQCVERTGLQVDGIYRVSGNLATIQKLRFIVDHE-EKLDLEEPQWDDVHVITGALKMFFRELPEPLFPFKFFPHFINAIKIKDYAEKI--RCMGKLIAILPPTNRETMKLLFNHLATRVVAHGKTNRMSVQNLAIVFGPTLLRPEQE 578          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 89.3521 bits (220), Expect = 1.324e-19
Identity = 62/201 (30.85%), Postives = 101/201 (50.25%), Query Frame = 3
Query: 1704 LNCEETFHRSGNKTI------NPR---SIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKL--MLNILDCLPIGNQNVLLFLIDHL--LKIIAKSESNKMDLVSLSNIFGPLLFYP 2267
            L+C    H+   + +      +PR    +FG  L  L+   +    +P +V++C+ EI  RG +  G+YR+SG   L  +++  FD+EG   +IS+ A  D++ IT  LK + RELP PL T   Y   V A ++    +   E+L  +   L  LP  + + L  L+ HL   ++  + + N M   +LS +FGP L  P
Sbjct:   81 LDCGLNVHKQCCRLVPTDCQPDPRRLPKVFGCDLTALVKAHRG--RLPMVVEMCIGEIEARGLKSEGLYRVSGVSDLVEEVRTAFDKEGEKADISAKAYEDVNVITGALKLYFRELPTPLVTYQAYPHFVEAAKV----SDPAERLEQLRRALQTLPPAHYDTLHCLMAHLHRRRVSQQEKHNLMSSENLSIVFGPTLMRP 275          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: arhgap21b (Rho GTPase activating protein 21b [Source:ZFIN;Acc:ZDB-GENE-030131-4944])

HSP 1 Score: 87.8113 bits (216), Expect = 8.101e-18
Identity = 60/192 (31.25%), Postives = 96/192 (50.00%), Query Frame = 3
Query: 1713 EETFHRSGNKTINPRSIFGRSLKDLII-----LEKSPI-----LIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLL 2258
            ++   R G ++I      GRS  D +      LE  P       +P IV++C   +  RG E  GIYR+ G+      L++  +R    I+ + D   D++ I+S+LK F R+LPEPLFT+  Y   ++A+ +   +     K +  ++  LP  + + L FL  HL  I   S  NKM+  +L+ +FGP L
Sbjct:  978 DKALWRKGIQSIMKNPFSGRSNTDAVAMFGVRLEDCPPGLHNKFLPLIVEVCCGLVEERGLESTGIYRVPGNNAAVCSLQEELNRGVTEIDTNDDKWRDLNVISSLLKSFFRKLPEPLFTDEKYYEFIDANRME--NGVERLKALKKLIHELPEHHFHTLKFLSMHLKTIAENSPKNKMEPRNLAIVFGPTL 1167          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: BEM2 (Rho GTPase activating protein (RhoGAP); involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence; potential GAP for Rho4p [Source:SGD;Acc:S000000957])

HSP 1 Score: 85.5001 bits (210), Expect = 3.078e-17
Identity = 60/183 (32.79%), Postives = 92/183 (50.27%), Query Frame = 3
Query: 1719 TFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHIN---ISSDAVPDIHAITSVLKDFLRELPEPLFTEAF---YQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFG 2249
            +FH    K      IFG  L+D  + E+   LIP IV   ++EI  RG + VG+YR+ GSI     LK+ FD EG   N   +  D   +++AI    K +LRELP+ LF+ A    +  +   ++ H   N   +++M  +L  LP      L  ++ HL K+     +NKMD  +L+ +F 
Sbjct: 1950 SFHSKKYKGKTHNKIFGVPLED--VCERENTLIPTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDEEGATDNSFTLEDDRWFEVNAIAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMVNEEYKRMMNELLQKLPTCYYQTLKRIVFHLNKVHQHVVNNKMDASNLAIVFS 2130          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 67.781 bits (164), Expect = 6.455e-12
Identity = 63/223 (28.25%), Postives = 108/223 (48.43%), Query Frame = 3
Query: 1761 IFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVP---------DIHAITSVLKDFLRELPEPLFTEAFYQMIVN---AHELHKTSNTSGEKLM----------------LNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIM 2345
            ++G SL+     EKS + I     I   E +  G  + G+YR SGS  L  ++++ F     + ++ SD +          DIHA+ SVLK +LR+LP+P+ + + Y  +++    ++L +    + +K +                L I   LP+ +Q VL  L  H+ K+   SE N M+L +LS +F P L +   +G     K I+D   ++ I +FI+
Sbjct:  785 LYGSSLQARCAYEKSTVPIIIRCCIDRIEKDDIGLNMEGLYRKSGSQTLVEEIENEF---AQNNSLHSDTLSPKLNALLNQDIHAVASVLKRYLRKLPDPVLSFSIYDALIDLVRNNQLIERLPLNNDKFLDSPQKVTIYEMVLKSLLEIFKILPVEHQEVLKVLAAHIGKVRRCSERNLMNLHNLSLVFAPSLIH-DFDG----EKDIVDMKERNYIVEFIL 999          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: RGD1 (GTPase-activating protein (RhoGAP) for Rho3p and Rho4p; possibly involved in control of actin cytoskeleton organization [Source:SGD;Acc:S000000464])

HSP 1 Score: 65.0846 bits (157), Expect = 3.203e-11
Identity = 48/169 (28.40%), Postives = 87/169 (51.48%), Query Frame = 3
Query: 1764 FGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVP----DIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLL 2258
            FG  L+ LI  E+   ++P IV+ C+  I+  G +  GIYR S ++    +LK+  D++  +I++   + P    DI+ + S+LK F   LP+ +  +A    I    ++     T+ +  M  ++  LP      L  L+ HL +++A    N+M+L +L  I+GP +
Sbjct:  470 FGVPLESLIEFEQD--MVPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPANISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQIEDP--TTRKNFMHGLIYNLPDAQYWTLRALVFHLKRVLAHEAQNRMNLRALCIIWGPTI 634          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: RGA1 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; RGA1 has a paralog, RGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000005653])

HSP 1 Score: 64.6994 bits (156), Expect = 5.740e-11
Identity = 58/205 (28.29%), Postives = 96/205 (46.83%), Query Frame = 3
Query: 1728 RSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVD-----EINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAV---PDIHAITSVLKDFLRELPEPLFTEAFYQ---MIVNAHELHKTSNTSGEKLML----------------NILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLF 2261
            + G + ++  +++G SL      E + I  P I+ +C+D     E N R     GIYR SGS  +  +++  F       N  +  +    D++ +T VLK +LR+LP P+FT   Y+    +V + ++ +     G KL L                NIL+ LP  +  VL  L +H+ K+   S  N+M L +L+ +F P L 
Sbjct:  777 KDGEEYLDGSNLYGSSLVARCNYENNEI--PMILSVCIDFIESDEENMRSE---GIYRKSGSQLVIEEIEKQFSAWKVQQNTETPNILTEQDLNVVTGVLKRYLRKLPNPIFTFQIYEPLMRLVKSKKMMENLPFVGGKLSLEAKNSDTYMSSKSALKNILEDLPREHYRVLRVLSEHIEKVTRYSHWNRMTLYNLALVFAPGLI 976          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: BEM3 (Rho GTPase activating protein (RhoGAP); involved in control of the cytoskeleton organization; targets the essential Rho-GTPase Cdc42p, which controls establishment and maintenance of cell polarity, including bud-site assembly [Source:SGD;Acc:S000006036])

HSP 1 Score: 54.6842 bits (130), Expect = 6.282e-8
Identity = 53/192 (27.60%), Postives = 101/192 (52.60%), Query Frame = 3
Query: 1758 SIFGRSLKDLIILE----KSPILIPNIVKICVDEI-NFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINI----------SSDAVPD----IHAITSVLKDFLRELPEPLF-TEAF--YQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYP 2267
            +IFG SL+  + L     ++   +P++V  C++ +   RG +  GI+RLSGS  +   L++ FD+E Y +++            +A P     ++ ++ +LK +LR+LP  LF  E F  ++ +V+ +  +    + G K ++     +P  N +++  L + L++I   S+ NKM+L +L  +F P L  P
Sbjct:  903 AIFGSSLETCLRLSSHKYQNVYDLPSVVYRCLEYLYKNRGIQEEGIFRLSGSSTVIKTLQERFDKE-YDVDLCRYNESIEAKDDEASPSLYIGVNTVSGLLKLYLRKLPHLLFGDEQFLSFKRVVDENHNNPVQISLGFKELIES-GLVPHANLSLMYALFELLVRINENSKFNKMNLRNLCIVFSPTLNIP 1092          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO47441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM51])

HSP 1 Score: 141.354 bits (355), Expect = 2.515e-34
Identity = 111/363 (30.58%), Postives = 173/363 (47.66%), Query Frame = 3
Query: 1344 FSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEV-----------------FEIEILNNTCLSILLYQWDPRF---RHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGY-HINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSS--KLSKSILDPSLQSEIFQFIMTI 2351
            F+G+L +H+  G G + S     DLYC +E D     ++KAR+ I  +T    WD+                  F++E+     L I +Y    R+   R   C  G + L        + +     + + L+ +G + L +Q+    +   R   K++N   +FG  ++   +  +    IP IV  CV EI  RG E VGIYRLSG+     +LK+ FD      + + S+A  DIHA+  + K +LR+LPEPLFT+  Y   V A+ +         + ML +   LP  N+    +L  HL K+  KSE +KM L +LS +FGP +  PS + SS   L++  LD   Q  IF + + +
Sbjct:  458 FNGVLYVHVQNGKGFHRS-----DLYCTLEVDHFGQFVKKARTKIAKTTGDPVWDQGTGGETLDTCPFINMSQDFDLEVEGTKELRIHVYS-KSRYTLQRDEECGLGRIQL----RRESLADLKKRTITIALDKQGAITLSLQYSKTRQGIER--KKSVNSVGVFGVDIE--TVTSRESCDIPLIVIGCVREIEKRGLEEVGIYRLSGASSDVKRLKEGFDENSQSALVLVSEA--DIHAVAGLFKMYLRDLPEPLFTDELYDKFVKAYAMADAEEK--RETMLELFQSLPTPNRLTACYLFQHLRKVAEKSEVHKMGLNNLSTVFGPNVLRPSPKTSSPMDLAQGTLDVMSQVGIFMYFLKL 802          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO38242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDK1])

HSP 1 Score: 115.546 bits (288), Expect = 1.736e-29
Identity = 65/169 (38.46%), Postives = 101/169 (59.76%), Query Frame = 3
Query: 1758 SIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNA--HELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLL 2258
             +FG  L     LE+S +  P +V+ CV EI  RG E VG+YR+SG+ + K +L+  FD     ++IS +  PDI+ IT +LKD+LRELPEPL TE   + +  A  +E+        +++M  +L  LP  N++ L+F+++HL  ++ K E NKMD  +LS    P++
Sbjct:   24 GVFGFRLNVTSELEQSSV--PLLVRKCVLEIEKRGLESVGLYRISGNARRKKELRGFFDENSEAVDISEENCPDINVITGILKDYLRELPEPLITEKMTEGLRKAAKNEIQDKKVDEQKQVMSELLSGLPDPNRHTLVFILNHLRHVMEKKEFNKMDARNLSVCLAPVM 190          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO49053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHX5])

HSP 1 Score: 90.8929 bits (224), Expect = 9.119e-19
Identity = 60/187 (32.09%), Postives = 91/187 (48.66%), Query Frame = 3
Query: 1812 LIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMF---DREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLF---YPSLEGSSKLSKSILDPSLQSEIFQFIMTIW 2354
            ++P IV  C+ EI  RG   VG+YR+ G+ +   +LKD F     +  H  I      DIH +  VLKDFLR L EPL T   +   VNA   +K  +      M   +  LP  N++ L  L+ HL K +++    KM + +L+ +FGP L     P++E    L ++ L P +   +    +  W
Sbjct:  381 MVPAIVVQCISEIEKRGLNEVGLYRVPGAERSIKELKDKFLHGKTQNLHETI------DIHVVCGVLKDFLRNLAEPLVTYHLWGAFVNA--ANKDDDQDSFSAMYQAVSELPQANRDTLACLVVHLQK-VSQCTDCKMPVSNLARVFGPTLVGHSSPNVEPVDMLQQTKLQPRVVERLLAMPVDYW 558          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO47995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ0])

HSP 1 Score: 81.6481 bits (200), Expect = 3.903e-16
Identity = 58/206 (28.16%), Postives = 104/206 (50.49%), Query Frame = 3
Query: 1695 IQFLNCEETFHRSGNKTINP--------------RSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLML--NILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFY 2264
            I+F+  ++ +H+S +  +                RS+FG  L++ + +++  I    +++ C+  ++    +  G++R++GS     +LK  FD     +   ++   D+HAIT VLK +LRELPEPL T A Y   + A  +      SG +L     ++D LP  N++ L +LI  L K+   SE NKM   +++ +  P + Y
Sbjct:  216 IKFIEAQQEYHKSASMILQDVLPLLKTQVESSSLRSVFGCPLEEHLKVQRRSIAF--VLEECLTYLHEEALQEQGLFRMAGSSGKIRKLKAAFDAGMVDL---TEFDCDVHAITGVLKQYLRELPEPLMTFALYDDWIQAASIQD----SGARLQAYWGLVDKLPKANKDNLRYLICFLGKLADYSEVNKMTASNIAIVIAPNIIY 412          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO47842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKY9])

HSP 1 Score: 78.9518 bits (193), Expect = 5.700e-15
Identity = 48/132 (36.36%), Postives = 71/132 (53.79%), Query Frame = 3
Query: 1875 GIYRLSGSIKLKIQLKDMFDREGYHINISSDA---VPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLF 2261
            GI+R+SG+ K+   LK  FDR+G       DA     D+ A+  +LK FLRELPEP   +A     +  HE++   N      +  +LD LP  N  +L FL   L+++    E+NKM  ++L+ +FGP  F
Sbjct:  139 GIFRVSGNHKVVESLKATFDRDG-------DADLEECDVMAVAGLLKLFLRELPEPPVPQALTTDFIKVHEVYGDDNPDCLDELRALLDKLPYLNYELLKFLCHFLVEVSMNEENNKMSTMALAIVFGPNFF 263          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: SYDE2 (synapse defective Rho GTPase homolog 2 [Source:NCBI gene;Acc:101168857])

HSP 1 Score: 179.104 bits (453), Expect = 2.808e-45
Identity = 111/398 (27.89%), Postives = 206/398 (51.76%), Query Frame = 3
Query: 1227 SKIDVNEFRHIT-TEHTDXXXXXXXXXXXXXYIPITRGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECF-EWDEVFEIEILNNTCLSILLYQWDPRF-RHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFL-NCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVN--AHELHKTSNTSGE------KLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILD-PSLQS--------EIFQFIMTIWP 2357
            +++D++ FRH + TE                YI        SG++ +H      L       +D+YC I+ D++ KAR+ + T    F + D  F IE+ N   L ++++ W+P   R+R+C  G + L S+    R +     +LA++LEP+G++Y+++  + + + +  R  +    P+ +FG     ++  E + +++P I+  C++EI  RG +VVG+YRL GS  +K +L++ F+R+ + + ++    PDI+ IT VLKD+LRELP PL  +  Y+ ++   A +  K      E      +  +++L+ LP   +  L  L++HL ++ +  + NKM   +L+  FGP+L     E S   ++  +D   L S        E+  +++ +WP
Sbjct:  996 TELDIDAFRHYSFTEQP----------KCTQYI--------SGLMSLHFYGAEDLKPPRIDSRDVYCAIQVDSVNKARTALLTCRTTFLDMDHTFNIELENAQHLKLVVFSWEPTPKRNRVCCHGTVVLPSIFRVTRFH-----QLAVKLEPRGLIYVKLSLIEHWQNSLDRGPDADREPQ-VFGVEAWRVVERENTGLMVPLIISKCINEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSHAVELNESVYPDINVITGVLKDYLRELPFPLINKPLYEAVLESMATKPLKMGAAGCEIEQADSEHTVSLLEHLPEVERMTLRTLLNHLKRVASHQDVNKMTCQNLAVCFGPVLLSQRQEASCHTNRVFIDSEELASALHFKKHIEVLHYLLQLWP 1369          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:NCBI gene;Acc:101165963])

HSP 1 Score: 152.525 bits (384), Expect = 2.869e-37
Identity = 102/334 (30.54%), Postives = 174/334 (52.10%), Query Frame = 3
Query: 1344 FSGMLVIHLIAGVGLNSSHSV-IKDLYCVIETDALRKARSMIRT-STECFEWDEVFEIEILNNTCLSIL-LYQWDPRF------------RHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGE-------KLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEG 2279
             +G+L +HL+    + +S S   KD++  I+ D   +AR+ + T        +  F +E+     L I+ L   +P              R+R+C  G +++  L    R     +++L ++LEP+G+LYL++      +T  +    T  P ++FG  L  L+  E+S + +P +++  V EI  RG +VVG+YRL GS  +K +L+D F+R    + +S D  PDI+ +T +LKD+LRELP PL T   YQ++  A  + +T+ +  E       +  + +L CLP   +  L  L+DHL  + + S  N+M   +L+  FGP+L  P+ E 
Sbjct:  430 VTGLLTVHLLGLEDMKTSRSENSKDIFVAIQIDGATRARTALLTLKGSSLTLNHTFHLELERARQLRIVVLTPANPAAGGHQPATSGGPTRNRVCCLGGVSIPPLFKGSR-----SQQLCVKLEPRGLLYLKLSLQEKWDT--QPMGDTSTPANVFGIELHQLVEKEESAVPVPLLIQKTVAEIERRGLKVVGLYRLCGSAAVKKELRDWFERNSSAVRLSEDLYPDINVVTGILKDYLRELPSPLITRTLYQVVREAMAI-RTAPSPPESPDPQLSRSTVGLLSCLPTPERATLSLLLDHLSLVASFSSFNRMTHQNLAVCFGPVLLTPTQEA 755          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: bcr (breakpoint cluster region protein [Source:NCBI gene;Acc:101174443])

HSP 1 Score: 137.117 bits (344), Expect = 2.956e-32
Identity = 112/348 (32.18%), Postives = 167/348 (47.99%), Query Frame = 3
Query: 1338 SGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDAL----RKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNN--EKLALQLEPKGM----------------LYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDP 2312
            SG  G L + + +  GL  S     +LYC +E D+      KA++ +   T   +W+E FEIE+  +  L +L Y+         CY  N T     N      T+    K  + LEP+ +                + L ++F + E +  R+   T  P  +FG  +  +   E+S   +P IV+ C++EI  RG E VGIYR+SG +   IQ LK  FD     +++    + D++AI   LK + RELPEPLFT+  Y        L  + + + E  MLN+L  LP  N    LFL+DHL ++  K   NKM L +L+ +FGP L  PS E  SK+  +   P
Sbjct: 1005 SGLYGFLNVIVHSASGLKQS----LNLYCTLEVDSFGFFSNKAKTRVYRYTTEPKWNEEFEIELEGSQTLRLLCYE--------KCY--NKTKQ---NKEDGDGTDRIMGKGQIPLEPQSLQGKDWQRTVIPMNGIEVKLSMKFTSREFSLKRT--PTRKPMGVFGVKISSVTKRERS--KVPYIVRQCLEEIERRGMEEVGIYRVSG-VATDIQALKTAFDTNNKDVSVMMSEM-DVNAIAGTLKLYFRELPEPLFTDELYPNFTGGITL--SDSVAKESCMLNLLLSLPEPNLVTFLFLLDHLKRVAEKESVNKMSLHNLATVFGPTLLRPS-EKDSKIPTNPTQP 1326          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: bcr (breakpoint cluster region protein [Source:NCBI gene;Acc:101174443])

HSP 1 Score: 136.346 bits (342), Expect = 4.197e-32
Identity = 109/353 (30.88%), Postives = 166/353 (47.03%), Query Frame = 3
Query: 1338 SGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDAL----RKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNE-------KLALQLEPKGM----------------LYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDP 2312
            SG  G L + + +  GL  S     +LYC +E D+      KA++ +   T   +W+E FEIE+  +  L +L Y+         CY          N  +    + +       K  + LEP+ +                + L ++F + E +  R+   T  P  +FG  +  +   E+S   +P IV+ C++EI  RG E VGIYR+SG +   IQ LK  FD     +++    + D++AI   LK + RELPEPLFT+  Y        L  + + + E  MLN+L  LP  N    LFL+DHL ++  K   NKM L +L+ +FGP L  PS E  SK+  +   P
Sbjct: 1005 SGLYGFLNVIVHSASGLKQS----LNLYCTLEVDSFGFFSNKAKTRVYRYTTEPKWNEEFEIELEGSQTLRLLCYE--------KCY----------NKTKQNKEDGDGTDRIMGKGQIPLEPQSLQGKDWQRTVIPMNGIEVKLSMKFTSREFSLKRT--PTRKPMGVFGVKISSVTKRERS--KVPYIVRQCLEEIERRGMEEVGIYRVSG-VATDIQALKTAFDTNNKDVSVMMSEM-DVNAIAGTLKLYFRELPEPLFTDELYPNFTGGITL--SDSVAKESCMLNLLLSLPEPNLVTFLFLLDHLKRVAEKESVNKMSLHNLATVFGPTLLRPS-EKDSKIPTNPTQP 1326          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:101164832])

HSP 1 Score: 119.398 bits (298), Expect = 6.821e-27
Identity = 102/342 (29.82%), Postives = 161/342 (47.08%), Query Frame = 3
Query: 1320 IPIT------RGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDA----LRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQ----------WDPRFRHRLCYFGNLTLDSLI---NHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQ-LKDMFDREGYHI-NISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPS 2270
            IP+T        SG  G L + + +  G   S     +LYC +E D+    + KA++ +   T    W+E FEIE+  +  L IL Y+           D     ++   G + LD       +W+M       + ++          ++F + + +  R+ +K  +   +FG  +  +   E+S +  P IV+ C++E+  RG + VGIYR+SG +   IQ LK  FD     I  + SD   DI+AI   LK + RELPEPL T+  Y   +    L  +   + E  M+++L  LP  N    L L+DHL ++  K   NKM L +L+ +FGP L  PS
Sbjct:  723 IPVTGNKDDEESSGLYGFLHVIVHSAKGFKES----ANLYCTLEVDSFGYFVSKAKTRVFRDTAEPSWNEEFEIELEGSQYLRILCYENCYDKSMLNKDDNEIVDKIMGKGQVQLDPQTVQSKNWQMDVIEMNGIKVEFS--------MKFTSRDLSLKRTPSKKQS--GVFGVKISVVTKRERSKV--PYIVRQCIEEVEKRGIDEVGIYRISG-VATDIQALKLAFDTNTKDILMMLSDM--DINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIAL--SDPAAKENCMMHLLRSLPEPNIMTFLTLLDHLKRVAEKEPVNKMSLHNLATVFGPTLLRPS 1043          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000037897.1 (SMESG000037897.1)

HSP 1 Score: 1437.55 bits (3720), Expect = 0.000e+0
Identity = 778/780 (99.74%), Postives = 778/780 (99.74%), Query Frame = 3
Query:  468 MLGDQRLSRINRRGMLTNEXXXXXXXXXXXXXXXXXXXXTDKSIERSYSNRYPSSGMTDHNSRLNLAPISHSMRDQSQKIVNYKSRSMSGCNSDTELANGATNNATILDSDSSSKLSVNRWRVGCRRSLSSYSSGEEDNFSSSNFPVHYDNTKDVFFEYANSHNQKGSRQNISETVYYEPSQLSDHSYFSAIKASYNNVNAQIPSKTRPEKKSHRLDNSNLNSSSVFTRENFKKLGVKASTFSIKDWEIAQFTSKIDVNEFRHITTEHTDXXXXXXXXXXXXXYIPITRGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIWPSNIGLSRSSKYTHESLSRKSQKEMAASTYKHRNRENIANSPENSRNAVPGETKAGEKPHSYSKHIRTSKSRERQSRAHKVVVSSEYYSNEPQSGRSHSKSDRGKTDXXXXXXXXXXXXXKVSDKTETHXXXXXXXXXXXXXXXXTHMPYS 2807
            MLGDQRLSRINRRGMLTNESSISFQHSNNSHNNINNNNSTDKSIERSYSNRYPSSGMTDHNSRLNLAPISHSMRDQSQKIVNYKSRSMSGCNSDTELANGATNNATILDSDSSSKLSVNRWRVGCRRSLSSYSSGEEDNFSSSNFPVHYDNTKDVFFEYANSHNQKGSRQNISETVYYEPSQLSDHSYFSAIKASYNNVNAQIPSKTRPEKKSHRLDNSNLNSSSVFTRENFKKLGVKASTFSIKDWEIAQFTSKIDVNEFRHITTEHTDGLLGLLSRRSNNSYIPITRGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIWPSNIGLSRSSKYTHESLSRKSQKEMAASTYKHRNRENIANSPENSRNAVPGE  AGEKPHSYSKHIRTSKSRERQSRAHKVVVSSEYYSNEPQSGRSHSKSDRGKTDRQRSHSRGRSQHHKVSDKTETHSRQHSQSRDRNQSRSRTHMPYS
Sbjct:    1 MLGDQRLSRINRRGMLTNESSISFQHSNNSHNNINNNNSTDKSIERSYSNRYPSSGMTDHNSRLNLAPISHSMRDQSQKIVNYKSRSMSGCNSDTELANGATNNATILDSDSSSKLSVNRWRVGCRRSLSSYSSGEEDNFSSSNFPVHYDNTKDVFFEYANSHNQKGSRQNISETVYYEPSQLSDHSYFSAIKASYNNVNAQIPSKTRPEKKSHRLDNSNLNSSSVFTRENFKKLGVKASTFSIKDWEIAQFTSKIDVNEFRHITTEHTDGLLGLLSRRSNNSYIPITRGSGFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIWPSNIGLSRSSKYTHESLSRKSQKEMAASTYKHRNRENIANSPENSRNAVPGEMTAGEKPHSYSKHIRTSKSRERQSRAHKVVVSSEYYSNEPQSGRSHSKSDRGKTDRQRSHSRGRSQHHKVSDKTETHSRQHSQSRDRNQSRSRTHMPYS 780          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000017186.1 (SMESG000017186.1)

HSP 1 Score: 401.364 bits (1030), Expect = 2.993e-121
Identity = 247/658 (37.54%), Postives = 369/658 (56.08%), Query Frame = 3
Query:  597 IERSYSNRYPSSGMTDH---NSRLNLAPISHSMRDQSQKIVNYKSRSMSGCNSDTELANGATNNATILD----SDSSSKLSVNRWRVGCRRSLSSYSSGEEDNFSSSNFPVHYDNTKD---------VFFEYANSHNQKGSRQNIS----------ETVYYEPSQLSDHSYFSAIKASYNNVNAQIPSKTRPEKKSHRLDNSNLNSSSVFTRENFKKLGVKASTFSIKDWEI---AQFTSKIDVNEFRHITTEHTDXXXXXXXXXXXXXYIPITRGSG-----------FSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLII--------LEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELH-KTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIWPSNIGLSRSSKYTHESLSRKSQK 2423
            I R     YPS  ++D    N R    P++ S   +             G NSDTEL    ++    +D    + S  K SV+R      RS  +YSSGEE+ F  +  P  Y + K          ++ + ++  + +   +N++          ET +++ +  +D SYF   +A  N +    P    P        N+  +  S  +  +F+ L   +     KD ++    Q  S++D NEFR I TE                + P+    G            SGMLVIH++AG+GLNSS +V++DLYCV+E D++R+ARSMIRTSTE FEWDE+FE+++ +N  L+ L YQWDPR RHRLC++GN+ L  LI  +R   TN+EKLAL LEPKG+L++E+ +L   E F R     +N  ++FG  L+ L+          +     +P IV+ C +E+  RG +VV IYRLSG++KLKI++++M +++    ++S+D VPDIHAIT+VL+DFLRELPEPLFT A Y+MI++A ++     N +G KLMLNILDCLPI NQ+ +L L+DHL ++ ++SE NKM   +L+   GP+LF+PS E + KL KS+LDP  Q++   +I+ IWP     S    ++ +S S++ QK
Sbjct:  555 IPRHTGPLYPSQSLSDPRMLNYRWISPPVAQSYPVEVADKGIQCGPDRHGYNSDTELK-MKSHQPFPVDMHSLNKSQVKFSVSRTAPHLHRSTVNYSSGEEEGFYQATSPSRYIDPKQSMMCSNQNMMYKQVSSQPSIEDEMRNLNIRPYMPVPMMETDFFDNATRTDLSYF---RAPNNVLEYSSPGYAFPS-------NAQNDFRSTASAPSFRSLRQPSRP---KDQQMDHGQQSVSRLDPNEFRKIQTEQ---------------WPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQR-FKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAKKLDKSLLDPKKQAQTLLYILNIWPDE---SDHQYHSRDSKSKEPQK 1179          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000039887.1 (SMESG000039887.1)

HSP 1 Score: 306.99 bits (785), Expect = 1.427e-89
Identity = 158/347 (45.53%), Postives = 225/347 (64.84%), Query Frame = 3
Query: 1341 GFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGR---SLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYH--INISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKT--SNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIWPS 2360
            G +G+LV+++IAG  L SSHS+ +DLYCV+E D++RKARSMIRTSTE FEWDE+FEI++ N+  LSILLYQWDP+  HRLC++G + L + I++++      +K+ LQLEPKG+LYLE+ FLN E +F R  N   N  S+FGR    ++ ++    +    P ++ +CV+EI  RG + VG+YRL G+ KLK  L+ +   E YH   ++SS  +PDIH ITSVLKDFLRELPEPL T A Y+ +V +   H     N  G  +M+ I + LP  N+  L++ IDHL+++  K++ NKM +  LS  F  LL  PS E  +     I     + E  Q+++T WP+
Sbjct:  583 GIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSIRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDN--SVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLL--ETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKS-SFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQWPT 924          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000069716.1 (SMESG000069716.1)

HSP 1 Score: 100.908 bits (250), Expect = 1.794e-21
Identity = 93/343 (27.11%), Postives = 160/343 (46.65%), Query Frame = 3
Query: 1341 GFSGMLVIHLIAGVGLNSSHSV------IKDLYCVIETDALRKARSMIRTSTECFE----WDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEI------QFLNCEETFHRSGNKTIN----PR-SIFGRSLKDLIIL---------EKSPILIPNIVKICVDE--INFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQ-MIVNAHELHKTSNTSGEKL---MLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLF 2261
             FSG+++  ++    L     V      I+ L C ++ ++  +    I TS+E F     WDE F +++  +  +SIL+YQ       RL Y+G L L  LIN +++ +  ++++ LQLEP+G+LY+++      + LN +  +H S +        PR S F  S+ D I +         +K  ++  NI K  V E  I    + ++ I +    I++ I                     +IH++TS++   LREL EPL    F Q +++         + +G+ L   +L++   LP  NQ  +L L  HL  +I  S SNK     ++ +F PL+F
Sbjct:  265 SFSGVIIFDILRAENLQPGSVVLPISSSIRLLQCTVKMNSDVR----IETSSEIFSDKVIWDERFFVDLRESNFISILIYQSLEGCNKRLSYYGGLNLIELINEFQVQSQYSDQIILQLEPRGLLYIQLGLIYLHELLNKQICYHLSKHTQKPSLHCPRYSNFVTSISDWIYILRWSLAAAEDKQRLMTVNIYKTNVSENKIIHLLKHIMNIRQYGNQIQIDI---------------------NIHSVTSLILLCLRELNEPLIPYEFSQRLLIILEHFFNIYDPNGQLLAGEVLSVFKSLPNQNQMAILELFQHLYLVIQNSSSNKTTCHYIALLFAPLIF 582          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000025211.1 (SMESG000025211.1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.849e-20
Identity = 88/326 (26.99%), Postives = 150/326 (46.01%), Query Frame = 3
Query: 1341 GFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALR----KARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTL-----DSLINHWR--MYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPIL----IPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDR--EGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYP 2267
            G SG+LV ++    GLN         Y  IE D+      KAR+ + T +   +W+E F+I++  +  ++IL+Y+      ++    G         D L  H    +   +NE   L LE       + + L  + +  ++G        +FG SLK ++  EK   +    +P I+  C   I   G +  GIYR+SGS   K ++ +++ +  +     IS+    D+H IT ++K +LRELPEPL     Y+ I+   +L +            ++  LP  N + ++F++ H  K++A S  N+M   +L  I GP L  P
Sbjct:  590 GVSGVLVTNIFKVDGLNPDFRY----YLSIEVDSFNLNELKARTKVCTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTG--------LFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGS---KNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSR--YNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 898          
The following BLAST results are available for this feature:
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYDE27.621e-5031.56synapse defective Rho GTPase homolog 2 [Source:HGN... [more]
SYDE14.771e-4430.93synapse defective Rho GTPase homolog 1 [Source:HGN... [more]
SYDE16.850e-4430.93synapse defective Rho GTPase homolog 1 [Source:HGN... [more]
BCR7.650e-3331.44BCR activator of RhoGEF and GTPase [Source:HGNC Sy... [more]
SYDE12.646e-3232.13synapse defective Rho GTPase homolog 1 [Source:HGN... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syd-18.988e-5732.78Rho GTPase-activating protein syd-1 [Source:UniPr... [more]
syd-16.621e-5632.78Rho GTPase-activating protein syd-1 [Source:UniPr... [more]
syd-16.949e-5632.78Rho GTPase-activating protein syd-1 [Source:UniPr... [more]
tag-3252.513e-1830.99WW domain-containing protein tag-325 [Source:UniP... [more]
tag-3255.667e-1830.99WW domain-containing protein tag-325 [Source:UniP... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RhoGAP100F2.899e-7436.94gene:FBgn0039883 transcript:FBtr0304595[more]
RhoGAP100F2.903e-7436.94gene:FBgn0039883 transcript:FBtr0309829[more]
RhoGAP100F3.052e-7436.94gene:FBgn0039883 transcript:FBtr0302181[more]
RhoGAP100F3.237e-7436.94gene:FBgn0039883 transcript:FBtr0302180[more]
RhoGAP100F3.464e-7436.94gene:FBgn0039883 transcript:FBtr0343538[more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYDE24.621e-5031.56synapse defective 1, Rho GTPase, homolog 2 (C. ele... [more]
SYDE17.129e-5031.29synapse defective Rho GTPase homolog 1 [Source:NCB... [more]
bcr3.481e-3230.79BCR activator of RhoGEF and GTPase [Source:ZFIN;Ac... [more]
bcr2.357e-3029.78BCR activator of RhoGEF and GTPase [Source:ZFIN;Ac... [more]
si:dkey-91m11.57.878e-3029.89si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-9... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
il62.554e-4931.11interleukin 6 [Source:Xenbase;Acc:XB-GENE-480186][more]
il63.163e-4931.01interleukin 6 [Source:Xenbase;Acc:XB-GENE-480186][more]
bcr2.724e-3031.10BCR, RhoGEF and GTPase activating protein [Source:... [more]
bcr6.768e-3030.97BCR, RhoGEF and GTPase activating protein [Source:... [more]
abr3.556e-2931.56ABR, RhoGEF and GTPase activating protein [Source:... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syde23.347e-5131.28synapse defective 1, Rho GTPase, homolog 2 (C. ele... [more]
Syde23.480e-5131.28synapse defective 1, Rho GTPase, homolog 2 (C. ele... [more]
Syde25.822e-5131.01synapse defective 1, Rho GTPase, homolog 2 (C. ele... [more]
Syde11.568e-4732.56synapse defective 1, Rho GTPase, homolog 1 (C. ele... [more]
Bcr9.738e-3430.87BCR activator of RhoGEF and GTPase [Source:MGI Sym... [more]
back to top
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9V9S7|SYDE_DROME3.059e-7336.94Rho GTPase-activating protein 100F OS=Drosophila m... [more]
sp|Q86NH1|SYD1_CAEEL8.840e-5532.78Rho GTPase-activating protein syd-1 OS=Caenorhabdi... [more]
sp|Q61CA4|SYD1_CAEBR1.160e-5431.78Rho GTPase-activating protein syd-1 OS=Caenorhabdi... [more]
sp|Q5VT97|SYDE2_HUMAN3.660e-4931.56Rho GTPase-activating protein SYDE2 OS=Homo sapien... [more]
sp|D3ZZN9|SYDE1_RAT3.516e-4732.85Rho GTPase-activating protein SYDE1 OS=Rattus norv... [more]
back to top
BLAST of Rho GTPase-activating protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GUS32.175e-10341.83Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F8324.436e-10341.61Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FC537.703e-9939.86Rho-GAP domain-containing protein OS=Macrostomum l... [more]
A0A267GK959.390e-9940.14Rho-GAP domain-containing protein (Fragment) OS=Ma... [more]
A0A267FNT34.706e-9840.37Rho-GAP domain-containing protein OS=Macrostomum l... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYDE21.691e-4629.25synapse defective Rho GTPase homolog 2 [Source:NCB... [more]
SYDE11.654e-3631.75synapse defective Rho GTPase homolog 1 [Source:HGN... [more]
bcr3.928e-3130.23BCR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
bcr5.604e-3130.23BCR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
ABR4.433e-2930.03ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGAP152.566e-2231.98Rho GTPase activating protein 15 [Source:HGNC Symb... [more]
ENSPMAT00000004676.12.724e-2031.82pep scaffold:Pmarinus_7.0:GL476377:189826:224778:-... [more]
ENSPMAT00000004494.14.696e-2031.67pep scaffold:Pmarinus_7.0:GL476606:246273:272967:-... [more]
chn21.324e-1930.85chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
arhgap21b8.101e-1831.25Rho GTPase activating protein 21b [Source:ZFIN;Acc... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BEM23.078e-1732.79Rho GTPase activating protein (RhoGAP); involved i... [more]
RGA26.455e-1228.25GTPase-activating protein for polarity-establishme... [more]
RGD13.203e-1128.40GTPase-activating protein (RhoGAP) for Rho3p and R... [more]
RGA15.740e-1128.29GTPase-activating protein for polarity-establishme... [more]
BEM36.282e-827.60Rho GTPase activating protein (RhoGAP); involved i... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474412.515e-3430.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382421.736e-2938.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490539.119e-1932.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479953.903e-1628.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478425.700e-1536.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYDE22.808e-4527.89synapse defective Rho GTPase homolog 2 [Source:NCB... [more]
SYDE12.869e-3730.54synapse defective Rho GTPase homolog 1 [Source:NCB... [more]
bcr2.956e-3232.18breakpoint cluster region protein [Source:NCBI gen... [more]
bcr4.197e-3230.88breakpoint cluster region protein [Source:NCBI gen... [more]
ABR6.821e-2729.82ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037897.10.000e+099.74SMESG000037897.1[more]
SMESG000017186.12.993e-12137.54SMESG000017186.1[more]
SMESG000039887.11.427e-8945.53SMESG000039887.1[more]
SMESG000069716.11.794e-2127.11SMESG000069716.1[more]
SMESG000025211.13.849e-2026.99SMESG000025211.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019778 ID=SMED30019778|Name=Rho GTPase-activating protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2929bp
GACAAATACGACAGCGTTATTAAAGAGAATATATGAAAACATTTAGATAT
CGGTTTATCAGTTTCAGTTTATTTTTTTAAAAAAAGCATTATATTTGAGT
ACGCGATTAGAGGGGACATGCCTACTTGCAGATGGGATGCAGGGATAGCT
GGATTCTGATTGGTCGTTTCTCTGGAAAAGAGAAGAGATACGTCTCCCTA
AATATAAACACGATTTACTTAGCATAATGAACTATTTTGAAAAGATCTTC
TGCCACCTGTATCTGAGTTAGTTGAGTGTCTGTCATCAACGATACCATGG
CGGTGTCTGGTTAGTGTGTAATTATACTGTCTTTCCATTTATATTCAGGT
AATCATTGTTTCTAAAGAACGATTCTGATTTGCAAATATTGATTCAATGA
TAATCATTGAAATTCATTGATCAACTACAGAAACTCAAGGTCATTAAATA
TTGATTTTCACAGTCAGATGTTAGGCGACCAGAGATTATCGAGAATTAAC
CGAAGAGGAATGCTAACCAATGAATCATCAATATCTTTTCAACACAGCAA
TAATAGCCATAATAACATTAATAATAATAATAGCACTGACAAATCTATTG
AAAGATCCTATTCAAATCGATATCCGTCTTCCGGAATGACAGATCATAAT
TCAAGATTAAATTTAGCACCGATTTCTCATTCTATGAGAGATCAAAGCCA
AAAAATTGTCAACTATAAATCGAGATCAATGTCCGGTTGTAACTCCGACA
CTGAATTAGCAAACGGTGCTACCAACAATGCGACAATTTTGGATTCTGAT
AGCTCATCTAAGCTGTCTGTTAACAGATGGCGTGTCGGATGCCGTAGGTC
ATTATCTAGCTATTCTTCTGGAGAAGAAGATAATTTTTCATCGTCGAATT
TTCCGGTTCATTATGACAACACGAAGGATGTATTTTTTGAATATGCAAAT
TCCCACAACCAGAAAGGATCGAGACAAAACATCAGTGAGACGGTGTATTA
TGAACCCAGTCAGCTATCAGACCACAGTTATTTCTCAGCAATAAAAGCTT
CTTATAATAATGTAAATGCTCAAATTCCATCAAAAACAAGGCCAGAGAAA
AAATCACATCGTCTAGATAATTCCAATCTGAATTCTTCATCTGTTTTTAC
AAGGGAAAATTTTAAAAAACTTGGTGTCAAAGCCAGTACTTTCTCTATCA
AAGATTGGGAGATTGCTCAATTCACATCAAAGATTGACGTCAACGAGTTC
CGACATATAACAACTGAACACACGGATGGCCTGCTCGGGTTGTTGTCAAG
GAGGTCAAACAATTCTTATATCCCAATCACAAGAGGATCAGGCTTCAGTG
GGATGTTAGTGATTCATTTGATTGCCGGTGTTGGCCTTAACTCGAGCCAC
AGCGTCATTAAAGATCTTTATTGTGTGATTGAAACCGATGCGCTAAGGAA
AGCCCGATCTATGATACGCACAAGCACAGAATGTTTTGAGTGGGATGAAG
TGTTTGAAATTGAAATTTTGAATAATACTTGTCTTTCTATTCTTCTTTAT
CAATGGGATCCTCGATTTAGACATAGGTTATGCTATTTTGGCAATTTAAC
TCTTGATTCGCTGATCAACCATTGGAGAATGTACAACACAAACAATGAAA
AATTAGCCTTACAACTAGAGCCAAAGGGTATGCTTTATTTAGAGATTCAA
TTTTTGAACTGTGAGGAAACATTTCATCGATCTGGTAATAAAACTATCAA
TCCTCGATCAATATTTGGGAGATCTTTGAAGGATCTCATCATTTTGGAAA
AGAGTCCAATTCTTATTCCAAATATTGTTAAAATATGTGTCGATGAAATT
AATTTTAGAGGTCGGGAAGTTGTTGGAATTTACCGTTTAAGTGGGTCAAT
CAAACTCAAAATTCAGCTCAAAGATATGTTTGACAGAGAAGGCTATCACA
TTAATATATCATCGGATGCGGTGCCAGACATTCATGCAATCACTTCAGTT
CTCAAGGACTTTCTTCGAGAGTTGCCGGAGCCGCTATTCACTGAAGCATT
CTATCAGATGATCGTCAACGCTCACGAACTTCACAAAACCAGTAATACGT
CCGGAGAAAAATTGATGCTCAATATTTTGGATTGTTTGCCGATTGGCAAC
CAGAATGTTTTGCTCTTCCTCATAGATCATTTGTTGAAGATCATCGCCAA
ATCTGAAAGCAATAAAATGGATCTTGTATCTCTCTCGAATATATTCGGAC
CCCTTCTATTTTATCCTTCCCTAGAGGGTTCCAGCAAGCTTAGTAAATCA
ATTTTAGATCCAAGTCTTCAGTCAGAGATATTTCAATTCATAATGACAAT
ATGGCCAAGTAATATTGGTTTGTCAAGATCCAGTAAATATACACATGAAA
GCCTTTCGCGGAAAAGCCAAAAGGAAATGGCGGCTTCAACCTATAAGCAT
AGAAATCGAGAAAATATTGCTAACTCTCCAGAAAACTCTAGAAATGCCGT
ACCGGGAGAAACGAAGGCCGGGGAGAAACCTCACTCATATTCAAAGCATA
TCCGAACCTCAAAATCACGAGAAAGGCAGTCACGTGCTCACAAAGTTGTC
GTCTCCTCAGAATATTATTCAAATGAACCTCAAAGTGGTCGCAGCCATTC
GAAGTCTGATCGTGGTAAAACCGATCGCCAACGTTCTCATTCTCGTGGTA
GGTCTCAACACCATAAAGTGTCTGACAAAACAGAAACTCACTCTCGCCAA
CACTCGCAAAGCAGAGATAGGAATCAATCACGCAGTCGAACTCATATGCC
TTATTCGTAATACAAAATGCTTTTTATGTATGTTTTAACCATACTCACGA
CTCGATTTGATAAAATTGACTCCTATTAATTCCAGATAAAATTGTTGGTT
TTTTATTTTAATAAATTATGACATTCTGG
back to top

protein sequence of SMED30019778-orf-1

>SMED30019778-orf-1 ID=SMED30019778-orf-1|Name=SMED30019778-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=781bp
MLGDQRLSRINRRGMLTNESSISFQHSNNSHNNINNNNSTDKSIERSYSN
RYPSSGMTDHNSRLNLAPISHSMRDQSQKIVNYKSRSMSGCNSDTELANG
ATNNATILDSDSSSKLSVNRWRVGCRRSLSSYSSGEEDNFSSSNFPVHYD
NTKDVFFEYANSHNQKGSRQNISETVYYEPSQLSDHSYFSAIKASYNNVN
AQIPSKTRPEKKSHRLDNSNLNSSSVFTRENFKKLGVKASTFSIKDWEIA
QFTSKIDVNEFRHITTEHTDGLLGLLSRRSNNSYIPITRGSGFSGMLVIH
LIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEI
LNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQL
EPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLIILEKSPILI
PNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSD
AVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKTSNTSGEKLM
LNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYP
SLEGSSKLSKSILDPSLQSEIFQFIMTIWPSNIGLSRSSKYTHESLSRKS
QKEMAASTYKHRNRENIANSPENSRNAVPGETKAGEKPHSYSKHIRTSKS
RERQSRAHKVVVSSEYYSNEPQSGRSHSKSDRGKTDRQRSHSRGRSQHHK
VSDKTETHSRQHSQSRDRNQSRSRTHMPYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000198RhoGAP_dom
IPR000008C2_dom
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 296..391
e-value: 0.0019
score: 27.5
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 448..630
e-value: 7.0E-43
score: 158.5
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 451..601
e-value: 1.8E-35
score: 122.0
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 435..633
score: 36.812
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 421..630
e-value: 8.3E-47
score: 161.2
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 429..629
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 293..420
e-value: 5.2E-8
score: 34.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 642..780
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 687..709
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 749..773
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 642..668
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 725..740
NoneNo IPR availablePANTHERPTHR46150FAMILY NOT NAMEDcoord: 26..768
NoneNo IPR availableCDDcd00030C2coord: 297..383
e-value: 6.49642E-6
score: 43.5947
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 294..415