Malate dehydrogenase

Overview
NameMalate dehydrogenase
Smed IDSMED30019773
Length (bp)1390
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019773

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30019773SMESG000034865.1 Contig6380_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Malate dehydrogenase vs. Ensembl Celegans
Match: VF13D12L.3 (pep chromosome:WBcel235:II:11705989:11713608:1 gene:WBGene00012149.1 transcript:VF13D12L.3.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:VF13D12L.3)

HSP 1 Score: 343.584 bits (880), Expect = 8.055e-115
Identity = 176/350 (50.29%), Postives = 239/350 (68.29%), Query Frame = 1
Query:   61 IIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXXXXXXXXXX-XYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPL 1107
            ++  +E++RF V+C+   GA   HA  LA+V++  D RGH+SHGLNRL  Y++D+++ +     EP ++KE   TA VDGNN LGPVVGNF M LA++KAK  GIGWVVA  SNHYGIAGWY+++A+++G++GMS TNTSP+  PT S   ALGTNPIS+AAPG   +DS ++DMA++ VA+GK+E+  R ++ +PL W     GK T DP K L GG L   G  E   GYKGYGL  M+EIFCG+L+ + +G +VRKW S ++ A+LGQCFVAIDP+AF  GF +R+    Q MR LP ++ +  V V GD ER H    + L GIPY    I  +++L  +L VK +
Sbjct:   48 VVAKDEMKRFMVECMTKVGATESHATQLALVLLEGDIRGHYSHGLNRLDMYVRDIEQNVCKGDGEPIILKEKAGTAWVDGNNLLGPVVGNFCMDLAIEKAKNAGIGWVVAKGSNHYGIAGWYALRAMKKGMLGMSMTNTSPISFPTRSAVPALGTNPISLAAPGT-GDDSFVLDMASTTVAIGKVELAARKENPVPLSWGVGEGGKETTDPTKVLYGGGLLPLGGVEVSGGYKGYGLSSMIEIFCGILAGAHWGPHVRKWMSTKSEADLGQCFVAIDPEAFAPGFADRLQDFMQTMRALPTSSPSFKVEVAGDMERRHEALVEQLGGIPYHKNQITFVNDLAAKLGVKTV 396          
BLAST of Malate dehydrogenase vs. Ensembl Celegans
Match: VF13D12L.3 (pep chromosome:WBcel235:II:11706009:11713610:1 gene:WBGene00012149.1 transcript:VF13D12L.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:VF13D12L.3)

HSP 1 Score: 343.584 bits (880), Expect = 8.055e-115
Identity = 176/350 (50.29%), Postives = 239/350 (68.29%), Query Frame = 1
Query:   61 IIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXXXXXXXXXX-XYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPL 1107
            ++  +E++RF V+C+   GA   HA  LA+V++  D RGH+SHGLNRL  Y++D+++ +     EP ++KE   TA VDGNN LGPVVGNF M LA++KAK  GIGWVVA  SNHYGIAGWY+++A+++G++GMS TNTSP+  PT S   ALGTNPIS+AAPG   +DS ++DMA++ VA+GK+E+  R ++ +PL W     GK T DP K L GG L   G  E   GYKGYGL  M+EIFCG+L+ + +G +VRKW S ++ A+LGQCFVAIDP+AF  GF +R+    Q MR LP ++ +  V V GD ER H    + L GIPY    I  +++L  +L VK +
Sbjct:   48 VVAKDEMKRFMVECMTKVGATESHATQLALVLLEGDIRGHYSHGLNRLDMYVRDIEQNVCKGDGEPIILKEKAGTAWVDGNNLLGPVVGNFCMDLAIEKAKNAGIGWVVAKGSNHYGIAGWYALRAMKKGMLGMSMTNTSPISFPTRSAVPALGTNPISLAAPGT-GDDSFVLDMASTTVAIGKVELAARKENPVPLSWGVGEGGKETTDPTKVLYGGGLLPLGGVEVSGGYKGYGLSSMIEIFCGILAGAHWGPHVRKWMSTKSEADLGQCFVAIDPEAFAPGFADRLQDFMQTMRALPTSSPSFKVEVAGDMERRHEALVEQLGGIPYHKNQITFVNDLAAKLGVKTV 396          
BLAST of Malate dehydrogenase vs. Ensembl Celegans
Match: F36A2.3 (pep chromosome:WBcel235:I:8798785:8801694:1 gene:WBGene00009453.1 transcript:F36A2.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F36A2.3)

HSP 1 Score: 333.954 bits (855), Expect = 1.629e-111
Identity = 175/351 (49.86%), Postives = 238/351 (67.81%), Query Frame = 1
Query:   52 NPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNR-SKSRLPLGWAADANGKVTDDPEKAXXXXXXX-XXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKV 1098
            + ++I  E+++ F ++CL   G   +HAQ LA  ++C+D+RGH+SHG+NRL  Y+ DL          P+V+K   STA VDGNN LGPVVGNF M+LA++KAK+ GIGWVV   SNH+GIAGWY+  A   GL+GM+FTNTSP V PTGS++ +LG+NPI +AAPG ++ DS  +DMA++ VA GKIE+ +R  ++ +P  W AD NG  T +P++ L GG L  LGGSE TGGYKG GL +MVE+ CG++  S+FG+N+R+W +    A+LGQCFVAIDP+ F  GF+ R+ +   E R L   N + P  VPGDPER H+  C +L GI Y    +  L  L + L V
Sbjct:   13 DEIVISKEKLDSFVLECLAKAGCTGDHAQQLAETLLCSDYRGHYSHGINRLHIYVHDLMMKSTAVTGTPQVLKSKGSTAWVDGNNLLGPVVGNFCMQLAVEKAKEFGIGWVVCRNSNHFGIAGWYADFACRNGLVGMAFTNTSPCVFPTGSREKSLGSNPICMAAPG-MEGDSFFLDMASTTVAYGKIEVVDRKGETYIPGSWGADKNGDETHNPKEVLDGGGLQPLGGSEITGGYKGTGLCMMVEVLCGIMGGSAFGKNIRQWQTTSKTADLGQCFVAIDPECFAPGFSNRLQEFCDETRNLNPINPSRPPQVPGDPERAHMNMCDDLGGIVYKKKQLDHLKNLADRLGV 362          
BLAST of Malate dehydrogenase vs. Ensembl Fly
Match: CG10512 (gene:FBgn0037057 transcript:FBtr0078299)

HSP 1 Score: 307.76 bits (787), Expect = 2.334e-101
Identity = 167/357 (46.78%), Postives = 230/357 (64.43%), Query Frame = 1
Query:   46 ADNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXX-XXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWD--SDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPL 1107
            A  P ++   E  RF +DC K+      HA+A A ++V ADHRGHFSHG+NRL  YI DL     +    PK++KE+ +TA VDG N LG VVGN+ M LA+ KAK  G+GWV A  SNHYG+AGWY+++A+++GL+GMS TNTSPL+ PT +K+ ALGTNP+S+ A      D  ++DMAT+AVA+GKIE++ R  + LP GWA D +G+VT+D E     G L  LGGSE T GYKGYGLG MV+I  G++S +++   VRKW     ++ A+LGQ F+A+DP  F   F ER++  +  +R     + + PVL+ GD E+  +       GI Y+   +K+   L   LK+KPL
Sbjct:    3 AAAPKLVAVAESRRFMIDCFKAVKVPQAHAEAQADLLVAADHRGHFSHGMNRLEMYINDLAINSTDGAAVPKILKETPATAWVDGLNGLGAVVGNYCMDLAIKKAKTVGVGWVCAKGSNHYGMAGWYAIRAMDQGLVGMSMTNTSPLMAPTRAKEAALGTNPLSLGANA-TNGDKFLLDMATTAVAVGKIEIQRRKGAPLPDGWAQDPSGEVTNDAELGFSTGCLMPLGGSELTSGYKGYGLGAMVDILSGVMSGANYSTQVRKWTHAGADSAADLGQVFIAVDPNCFAPNFEERMADFNSRLRGATPTDPSKPVLLAGDKEKKGMADVDAAGGIQYLENQLKTCANLAEILKIKPL 358          
BLAST of Malate dehydrogenase vs. Ensembl Fly
Match: CG10512 (gene:FBgn0037057 transcript:FBtr0078300)

HSP 1 Score: 307.76 bits (787), Expect = 2.334e-101
Identity = 167/357 (46.78%), Postives = 230/357 (64.43%), Query Frame = 1
Query:   46 ADNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXX-XXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWD--SDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPL 1107
            A  P ++   E  RF +DC K+      HA+A A ++V ADHRGHFSHG+NRL  YI DL     +    PK++KE+ +TA VDG N LG VVGN+ M LA+ KAK  G+GWV A  SNHYG+AGWY+++A+++GL+GMS TNTSPL+ PT +K+ ALGTNP+S+ A      D  ++DMAT+AVA+GKIE++ R  + LP GWA D +G+VT+D E     G L  LGGSE T GYKGYGLG MV+I  G++S +++   VRKW     ++ A+LGQ F+A+DP  F   F ER++  +  +R     + + PVL+ GD E+  +       GI Y+   +K+   L   LK+KPL
Sbjct:    3 AAAPKLVAVAESRRFMIDCFKAVKVPQAHAEAQADLLVAADHRGHFSHGMNRLEMYINDLAINSTDGAAVPKILKETPATAWVDGLNGLGAVVGNYCMDLAIKKAKTVGVGWVCAKGSNHYGMAGWYAIRAMDQGLVGMSMTNTSPLMAPTRAKEAALGTNPLSLGANA-TNGDKFLLDMATTAVAVGKIEIQRRKGAPLPDGWAQDPSGEVTNDAELGFSTGCLMPLGGSELTSGYKGYGLGAMVDILSGVMSGANYSTQVRKWTHAGADSAADLGQVFIAVDPNCFAPNFEERMADFNSRLRGATPTDPSKPVLLAGDKEKKGMADVDAAGGIQYLENQLKTCANLAEILKIKPL 358          
BLAST of Malate dehydrogenase vs. Ensembl Fly
Match: CG10512 (gene:FBgn0037057 transcript:FBtr0078298)

HSP 1 Score: 308.145 bits (788), Expect = 3.793e-101
Identity = 167/358 (46.65%), Postives = 230/358 (64.25%), Query Frame = 1
Query:   46 ADNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXX-XXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWD--SDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPLQ 1110
            A  P ++   E  RF +DC K+      HA+A A ++V ADHRGHFSHG+NRL  YI DL     +    PK++KE+ +TA VDG N LG VVGN+ M LA+ KAK  G+GWV A  SNHYG+AGWY+++A+++GL+GMS TNTSPL+ PT +K+ ALGTNP+S+ A      D  ++DMAT+AVA+GKIE++ R  + LP GWA D +G+VT+D E     G L  LGGSE T GYKGYGLG MV+I  G++S +++   VRKW     ++ A+LGQ F+A+DP  F   F ER++  +  +R     + + PVL+ GD E+  +       GI Y+   +K+   L   LK+KPL 
Sbjct:   23 AAAPKLVAVAESRRFMIDCFKAVKVPQAHAEAQADLLVAADHRGHFSHGMNRLEMYINDLAINSTDGAAVPKILKETPATAWVDGLNGLGAVVGNYCMDLAIKKAKTVGVGWVCAKGSNHYGMAGWYAIRAMDQGLVGMSMTNTSPLMAPTRAKEAALGTNPLSLGANA-TNGDKFLLDMATTAVAVGKIEIQRRKGAPLPDGWAQDPSGEVTNDAELGFSTGCLMPLGGSELTSGYKGYGLGAMVDILSGVMSGANYSTQVRKWTHAGADSAADLGQVFIAVDPNCFAPNFEERMADFNSRLRGATPTDPSKPVLLAGDKEKKGMADVDAAGGIQYLENQLKTCANLAEILKIKPLS 379          
BLAST of Malate dehydrogenase vs. Ensembl Fly
Match: CG10512 (gene:FBgn0037057 transcript:FBtr0078297)

HSP 1 Score: 308.145 bits (788), Expect = 2.879e-100
Identity = 167/357 (46.78%), Postives = 230/357 (64.43%), Query Frame = 1
Query:   46 ADNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXX-XXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWD--SDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPL 1107
            A  P ++   E  RF +DC K+      HA+A A ++V ADHRGHFSHG+NRL  YI DL     +    PK++KE+ +TA VDG N LG VVGN+ M LA+ KAK  G+GWV A  SNHYG+AGWY+++A+++GL+GMS TNTSPL+ PT +K+ ALGTNP+S+ A      D  ++DMAT+AVA+GKIE++ R  + LP GWA D +G+VT+D E     G L  LGGSE T GYKGYGLG MV+I  G++S +++   VRKW     ++ A+LGQ F+A+DP  F   F ER++  +  +R     + + PVL+ GD E+  +       GI Y+   +K+   L   LK+KPL
Sbjct:   88 AAAPKLVAVAESRRFMIDCFKAVKVPQAHAEAQADLLVAADHRGHFSHGMNRLEMYINDLAINSTDGAAVPKILKETPATAWVDGLNGLGAVVGNYCMDLAIKKAKTVGVGWVCAKGSNHYGMAGWYAIRAMDQGLVGMSMTNTSPLMAPTRAKEAALGTNPLSLGANA-TNGDKFLLDMATTAVAVGKIEIQRRKGAPLPDGWAQDPSGEVTNDAELGFSTGCLMPLGGSELTSGYKGYGLGAMVDILSGVMSGANYSTQVRKWTHAGADSAADLGQVFIAVDPNCFAPNFEERMADFNSRLRGATPTDPSKPVLLAGDKEKKGMADVDAAGGIQYLENQLKTCANLAEILKIKPL 443          
BLAST of Malate dehydrogenase vs. Ensembl Fly
Match: CG18808 (gene:FBgn0042131 transcript:FBtr0073361)

HSP 1 Score: 227.639 bits (579), Expect = 5.911e-70
Identity = 123/350 (35.14%), Postives = 201/350 (57.43%), Query Frame = 1
Query:   61 IIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXXXXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPLQ 1110
            ++  +E  RF  DCL   G  P   + ++  +V AD+RG++  GLNRL  Y+ DL+ G      EP +I E+VSTA V+GN+ LG  VGNF M LA+ KA+ +GIG+VVA +S+  G+A W++ +A  +GL G+  +N++P ++   SK  ++G+N  +    G  +E   ++DMATS   +G +E    +   +P GWAA+  G  T  P  A     L        GG+KGY L  +++I CG+LS + +  ++   D ++  +NLGQ F+A+DP+ F   F ER       ++    A+++ P+ +PG+ ERMH+   ++L+ + Y + L+    E+   L VKP++
Sbjct:   33 LVLVDEARRFIQDCLLRVGVSPSKVRCISEFLVVADYRGNYGSGLNRLDYYLSDLQSGHAKVGAEPSIISETVSTAHVNGNSALGVFVGNFCMDLAVKKAEDSGIGFVVAQQSHDIGMASWFTFRAAGKGLAGIVMSNSAPTMMGPNSKSASIGSNCFAFCVKG--EEYHFVLDMATSVKDIGAVEWAWANDEYIPHGWAANEGGLSTCFPSLA-----LRTPLLFPAGGHKGYCLSAVIDILCGVLSGAQYATHITM-DQNQP-SNLGQVFIALDPEFFLPNFMERFDDFCGRIQNSQPADDSEPIRLPGELERMHMNYVEDLRALAYPNSLLTKYKEVAERLCVKPIE 373          
BLAST of Malate dehydrogenase vs. UniProt/SwissProt
Match: sp|P16142|MDH_METFV (Malate/(S)-sulfolactate dehydrogenase OS=Methanothermus fervidus (strain ATCC 43054 / DSM 2088 / JCM 10308 / V24 S) OX=523846 GN=mdh PE=1 SV=2)

HSP 1 Score: 222.246 bits (565), Expect = 1.930e-67
Identity = 136/350 (38.86%), Postives = 197/350 (56.29%), Query Frame = 1
Query:   58 VIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXXXXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFE--TGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVK 1101
            +II PEE     +  L + G   EHA+  A VIV AD +G  SHG+ R P+Y++ +K G I T    ++ KE+ S A ++GN+ LG VV    MKLA++KAK TG+G V  + SNH+GIAG+YS  A++  +IG++ TNT P V P G K   LGTNPI+++ P N  E  + +DM+T+AVA GK+    R   ++P G A D NG  T DP +A        G     GG+KGY L  M+EI  G L  + FG  V+       +   G   +AIDP  F     F   + +  +E++   +      VL+PGD ERM+I+K +  +GI     L++ L E+ +EL ++
Sbjct:    1 MIISPEEERSLIIKILNALGVSEEHAKITADVIVDADLKGFTSHGIGRFPQYVEGIKLGTIKTSGNIEIEKETDSVALINGNHLLGQVVAYKGMKLAIEKAKNTGVGIVGIHDSNHFGIAGYYSDMAMKNDMIGITMTNTEPAVAPLGGKIPVLGTNPIAISIPSN--EYYVAVDMSTAAVARGKLLEAARKNEKIPEGIAVDKNGNPTTDPNEA------LNGSILPFGGHKGYALCFMIEILAGPLVKAEFGSKVKGTVDPSQMCTKGDLLIAIDPSKFYDIEEFKRNVDEFVKEIKSTGK-----DVLIPGDRERMNIKK-REKEGIELDKKLVEKLKEIADELNIE 336          
BLAST of Malate dehydrogenase vs. UniProt/SwissProt
Match: sp|O59028|MDH_PYRHO (Malate dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=mdh PE=1 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 4.645e-67
Identity = 139/357 (38.94%), Postives = 210/357 (58.82%), Query Frame = 1
Query:   49 DNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXX--XXXXXXXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAF--ETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPL 1107
            +N + +P + +  F V  L   G   E A+ +A  +V AD RG  SHG+ RL +Y+  +  G +N   + +VI+E  S A +DG+  LG VVG  SMKLA+ KAK TGIG V+A  SNHYGIAG+Y++ A EEG+IG+S TN+ PLV PTG  +  LGTNPI++AAP   K+   ++DMATS V +GK+E+  R    +P GWA +  G +T   E+       L   G  E  GG+KGYGL LMV+I  G+LS  ++ + V+  ++ E  +N+   F+ ID + F     F E+IS++ +E++   +  E   + + G+   + +E    L GIP    +++ L+E+   + V+ L
Sbjct:    9 ENYIRVPKDRLFSFIVRVLTKLGVPEEDAKIVADNLVMADLRGVESHGVQRLKRYVDGIISGGVNLHPKIRVIREGPSYALIDGDEGLGQVVGYRSMKLAIKKAKDTGIGIVIARNSNHYGIAGYYALMAAEEGMIGISMTNSRPLVAPTGGIERILGTNPIALAAP--TKDKPFLLDMATSVVPIGKLEVYRRKGKDIPEGWAINREGNITTKVEEVFNGGALLPLGGFGELLGGHKGYGLSLMVDILSGILSGGTWSKYVK--NTSEKGSNVCHFFMVIDIEHFIPLEEFKEKISQMIEEIKSSRKHPEFERIWIHGEKGFLTMETRLKL-GIPIYRKVLEELNEIAKRVGVEGL 360          
BLAST of Malate dehydrogenase vs. UniProt/SwissProt
Match: sp|Q9V0D5|MDH_PYRAB (Malate dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=mdh PE=3 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 9.119e-67
Identity = 138/358 (38.55%), Postives = 211/358 (58.94%), Query Frame = 1
Query:   49 DNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXX--XXXXXXXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFE--TGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPLQ 1110
            +N V IP +E+  F V  L   G   E A+ +A  ++ AD RG  SHG+ RL +Y+  +  G IN     K+I+E  S A +DG+   G VVG  +MKLA++KA+KTGIG V    SNHYGIAG+Y++ A EEG+IG+S TN+ PLV PTG  +  LGTNPI++AAP   K    ++DMATS V +GK+E+  R    +P GWA ++ G++T   E+       L   G  E  GG+KGYGL LMV+I  G+LS  ++ ++V+  +++E  +N+   F+AI+ + F     F  R+S++  E++   +  +   + + G+   + +E    L GIP    ++  L+E+   + VK L+
Sbjct:    9 ENYVRIPKDELFSFVVRVLTKLGTPEEDAKIVADNLIMADLRGIESHGVQRLKRYVDGILSGGINLHPRIKIIREGPSYALLDGDEGFGQVVGYKAMKLAIEKARKTGIGIVAVRNSNHYGIAGYYALMAAEEGMIGISMTNSRPLVAPTGGVERILGTNPIALAAP--TKGKPFLLDMATSVVPIGKLEVYRRKGEEIPEGWAINSKGEITRSVEEVFNGGSLLPLGGFGELLGGHKGYGLSLMVDILSGILSGGTWSKHVK--NTNEKNSNVCHFFMAINIEHFTPLEEFKGRMSEMINEIKNSRKHPDFERIWIHGEKGFLTMETRLKL-GIPIYKKVLDELNEIARRVGVKGLE 361          
BLAST of Malate dehydrogenase vs. UniProt/SwissProt
Match: sp|Q58820|COMC_METJA (L-sulfolactate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=comC PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 3.167e-62
Identity = 139/347 (40.06%), Postives = 200/347 (57.64%), Query Frame = 1
Query:   58 VIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXXXXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAF--ETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNEL 1092
            +I+ PE  ++  +D LK  G   E A+  A V V AD +G  SHG+ R P+YI  LK G IN K + K++KES +TA +DG+  LG VVG  +M+LA+ KAK  G+G V    +NH+GIAG+YS  A+ + +IG++ TNT P + P G K+  LGTNPI++A  GN  + S  +DMAT+++A GKI    R K ++P G A D +GK T DP KAL+G +LP GG       KGYGL L +E+    +  +  G  V+   + E     G  F+AI+P+ F  +  F  ++ +L  E++    A E   +L+PG+ E  +  K K   G      L   L E+ NEL
Sbjct:    1 MILKPENEKKLIIDVLKKFGVPEEDAKITADVFVDADLKGFTSHGIGRFPQYITALKLGNINPKPDIKIVKESPATAVIDGDLGLGQVVGKKAMELAIKKAKNVGVGVVATRNANHFGIAGYYSELAMNQDMIGITITNTEPAMAPFGGKEKILGTNPIAIAFKGNKYKFS--LDMATASIARGKILEALRKKIKIPEGCAVDKDGKPTTDPAKALEGCILPFGGP------KGYGLALAIEMLSA-IGGAEVGTKVKGTANPEERCTKGDLFIAINPEFFMGKEEFKRKVDELLDEIKNSEPA-EGFEILIPGEIEERN--KMKRKDGFEIDKNLYNQLKEICNEL 335          
BLAST of Malate dehydrogenase vs. UniProt/SwissProt
Match: sp|O27273|COMC_METTH (L-sulfolactate dehydrogenase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=comC PE=3 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.214e-53
Identity = 121/347 (34.87%), Postives = 183/347 (52.74%), Query Frame = 1
Query:   64 IPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXXXXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAF--ETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKV 1098
            I PEE  +   + L +     E +  +A V + AD +G  SHG+ R P+Y+  L+ G I    +  + +E+ STA ++GN+  G VV   +M+LA++KA+ TG+G V  + SNH+G+AG+YS  AV   +IG+   NT P V P G ++  LGTNP+++  P N     + +DMATSA A GK+    R    +P   A DA GK T DPE A        G     GG+KGY L  M+EI  G L  ++FG  V    + E +   G   +AIDP        F  ++ +  +E++       +  VL+PGD E M+I K +  +GI     L++ +  +  EL +
Sbjct:    3 ISPEEEVKIIKEILTAMNVPEESSDIVADVTLDADLKGFSSHGIGRFPQYVDGLRHGTIRADGDITIERETESTALINGNHIFGHVVAYRAMELAIEKARNTGVGLVGVHDSNHFGVAGYYSDMAVMNDMIGVVIANTEPAVAPIGGRKPILGTNPVAIGIPSN--RYYVSVDMATSASARGKLLEAARKGESIPENVALDAEGKPTTDPEMA------LKGSILPFGGHKGYALSFMIEILAGPLVGAAFGTAVTGTANPEEMCTKGDLMMAIDPSKMVDPDEFRAQVDEFIEEVKS------SGDVLIPGDIESMNI-KRRRAEGIELDEKLLERILGIARELDI 334          
BLAST of Malate dehydrogenase vs. TrEMBL
Match: A0A3Q0KLL3 (Putative malate dehydrogenase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 6.047e-132
Identity = 195/351 (55.56%), Postives = 264/351 (75.21%), Query Frame = 1
Query:   61 IIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXX-XXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPLQ 1110
            +I  EEV++FC+ CL+  GA+ +HA AL+ V+V  D+RGH+SHGLNRL  Y++D++KG+ +T  EP ++KE+VSTA VDG N LGPVVGNFSM+ A+ KA +TGI +V A  SNH+GIAGWYS+ A+++GLIG++FTNTSPLV PT ++++A+GTNPI++AAPG V ED  ++DMATSAVALGKIEM  R    +P GW AD +GK + DP   +  G L  LGG EE  GYKGYGLG++VEI CG++++++FG N+R+W S +  ANLGQ F+AIDPKAF  GF +R+S+    MR LP  +   PV+VPGD ER H+ +C  L GIPY  VLI+SL+ L ++LKV  ++
Sbjct:   29 VISTEEVKKFCIQCLQKVGAQLKHATALSDVLVAGDYRGHYSHGLNRLEMYVQDIQKGVCSTDLEPTIVKETVSTALVDGKNVLGPVVGNFSMETAIKKANETGIAFVAAFGSNHFGIAGWYSLMALQQGLIGLAFTNTSPLVFPTRARRLAVGTNPITLAAPGKVPEDHFVLDMATSAVALGKIEMSRRRGIEIPKGWGADTDGKTSVDPNLVMTKGGLMPLGGEEENSGYKGYGLGMLVEILCGIIADAAFGPNIRRWLSTDKPANLGQSFLAIDPKAFAPGFEQRLSEYVNIMRNLPPVDNQKPVIVPGDFEREHMTECDELGGIPYPPVLIESLNRLADQLKVDKMK 379          
BLAST of Malate dehydrogenase vs. TrEMBL
Match: G4V698 (Putative malate dehydrogenase OS=Schistosoma mansoni OX=6183 GN=Smp_129610 PE=4 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 2.867e-131
Identity = 194/351 (55.27%), Postives = 263/351 (74.93%), Query Frame = 1
Query:   61 IIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXX-XXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPLQ 1110
            +I  EEV++FC+ CL+  GA+ +HA AL+ V+V  D+RGH+SHGLNRL  Y++D++KG+ +T  EP ++KE+VSTA VDG N LGPVVGNFSM+ A+ KA +TGI +  A  SNH+GIAGWYS+ A+++GLIG++FTNTSPLV PT ++++A+GTNPI++AAPG V ED  ++DMATSAVALGKIEM  R    +P GW AD +GK + DP   +  G L  LGG EE  GYKGYGLG++VEI CG++++++FG N+R+W S +  ANLGQ F+AIDPKAF  GF +R+S+    MR LP  +   PV+VPGD ER H+ +C  L GIPY  VLI+SL+ L ++LKV  ++
Sbjct:   29 VISTEEVKKFCIQCLQKVGAQLKHATALSDVLVAGDYRGHYSHGLNRLEMYVQDIQKGVCSTDLEPTIVKETVSTALVDGKNVLGPVVGNFSMETAIKKANETGIAFAAAFGSNHFGIAGWYSLMALQQGLIGLAFTNTSPLVFPTRARRLAVGTNPITLAAPGKVPEDHFVLDMATSAVALGKIEMSRRRGIEIPKGWGADTDGKTSVDPNLVMTKGGLMPLGGEEENSGYKGYGLGMLVEILCGIIADAAFGPNIRRWLSTDKPANLGQSFLAIDPKAFAPGFEQRLSEYVNIMRNLPPVDNQKPVIVPGDFEREHMTECDELGGIPYPPVLIESLNRLADQLKVDKMK 379          
BLAST of Malate dehydrogenase vs. TrEMBL
Match: A0A4Z2DGV9 (Malate dehydrogenase isoform 1 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_001104 PE=4 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 7.958e-131
Identity = 194/350 (55.43%), Postives = 260/350 (74.29%), Query Frame = 1
Query:   61 IIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXX-XXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPL 1107
            ++   E+++FCV CL   GA+  HA AL+ V++  D+RGH+SHGLNRL  Y++D+KKG+  T  EP ++KE+VSTA VDG N +GPVVGNF+M  A+ KA+KTGI +V A  SNH+GIAGWYS+ A++EGLIG++FTNTSPLV PT ++++A+GTNP+++AAPG V +D  ++DMATSAVALGKIEM  R    +P+GW AD +GK   DP   +  G L  LGG EE  GYKGYGLG++VEI CG+++N+ FG NVR+W + E  ANLGQ F+AIDPKAF  GF +R+S+    MR LP  N+  PV+VPGD ER H+ +C  L GIPY  VL++SL+ L +ELKV+ +
Sbjct:   48 VVSAAEIKKFCVQCLTKVGAQSRHAIALSDVLISGDYRGHYSHGLNRLEMYVQDIKKGVCATDTEPAIVKETVSTALVDGKNAMGPVVGNFAMGKAIAKAQKTGIAFVAAFGSNHFGIAGWYSLMALQEGLIGLAFTNTSPLVFPTRARKLAVGTNPLTLAAPGKVPDDHFVLDMATSAVALGKIEMNRRRGLEIPIGWGADQDGKTCVDPNLVVTKGGLMPLGGEEEHSGYKGYGLGMLVEILCGIIANADFGPNVRRWMTTEKQANLGQSFLAIDPKAFAPGFEQRLSEYVNIMRNLPPVNDKEPVVVPGDFEREHMIECDQLGGIPYPPVLLESLNRLADELKVEKI 397          
BLAST of Malate dehydrogenase vs. TrEMBL
Match: A0A4S2MGB0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001608 PE=4 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 2.425e-130
Identity = 198/355 (55.77%), Postives = 258/355 (72.68%), Query Frame = 1
Query:   46 ADNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDP-EKAXXXXXXXXXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPL 1107
            A+   +I  E+V +FC+ CL+  G   +H  ALA V+V  DHRGH+SHG+NRL  Y+ D++KG+ + + EP + KE+VSTA V+G N LGPVVGNF MKLA++KAKKTG+ W+ A  SNH+GIAGWYS+ A   GL+GM+FTNTSPLV PT SKQ A+GTNP++VAAP +   D  ++DMATSAVALGKIEM  R    +P GW AD NGK T DP E A +G L PLGG E+  GYKG+GLG+MVEIFCG+++  ++G NVR+W + +  ANLGQ FVAIDP AF +GF +R+S     MR L R +E  PV++PGDPER HIE+C+ + GI Y  VLI S+D+L + L V+ +
Sbjct:    7 AEYTRVIKVEDVIQFCMRCLEKVGVNKDHCGALAEVLVAGDHRGHYSHGINRLEMYVMDVEKGVCSKEGEPVIEKETVSTALVNGRNLLGPVVGNFCMKLAIEKAKKTGVAWITAYGSNHFGIAGWYSLMASNAGLLGMAFTNTSPLVYPTRSKQRAMGTNPLTVAAPSSKAGDEFVLDMATSAVALGKIEMCRRRGIPIPHGWGADKNGKSTTDPAEAAGEGALFPLGGEEQNSGYKGFGLGMMVEIFCGIMAGGAYGTNVRRWMATDRPANLGQAFVAIDPNAFASGFGDRMSDYVNSMRNLSRVDEKQPVVIPGDPEREHIEECRKMGGIRYPPVLIDSMDKLADRLHVQRM 361          
BLAST of Malate dehydrogenase vs. TrEMBL
Match: A0A4S2MA26 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001608 PE=4 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.625e-130
Identity = 200/367 (54.50%), Postives = 263/367 (71.66%), Query Frame = 1
Query:   10 QYFKLKIINYGMADNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDP-EKAXXXXXXXXXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPL 1107
            +Y  L++     A+   +I  E+V +FC+ CL+  G   +H  ALA V+V  DHRGH+SHG+NRL  Y+ D++KG+ + + EP + KE+VSTA V+G N LGPVVGNF MKLA++KAKKTG+ W+ A  SNH+GIAGWYS+ A   GL+GM+FTNTSPLV PT SKQ A+GTNP++VAAP +   D  ++DMATSAVALGKIEM  R    +P GW AD NGK T DP E A +G L PLGG E+  GYKG+GLG+MVEIFCG+++  ++G NVR+W + +  ANLGQ FVAIDP AF +GF +R+S     MR L R +E  PV++PGDPER HIE+C+ + GI Y  VLI S+D+L + L V+ +
Sbjct:   15 KYCFLRMSCVTPAEYTRVIKVEDVIQFCMRCLEKVGVNKDHCGALAEVLVAGDHRGHYSHGINRLEMYVMDVEKGVCSKEGEPVIEKETVSTALVNGRNLLGPVVGNFCMKLAIEKAKKTGVAWITAYGSNHFGIAGWYSLMASNAGLLGMAFTNTSPLVYPTRSKQRAMGTNPLTVAAPSSKAGDEFVLDMATSAVALGKIEMCRRRGIPIPHGWGADKNGKSTTDPAEAAGEGALFPLGGEEQNSGYKGFGLGMMVEIFCGIMAGGAYGTNVRRWMATDRPANLGQAFVAIDPNAFASGFGDRMSDYVNSMRNLSRVDEKQPVVIPGDPEREHIEECRKMGGIRYPPVLIDSMDKLADRLHVQRM 381          
BLAST of Malate dehydrogenase vs. Ensembl Cavefish
Match: ENSAMXT00000013803.2 (uncharacterized oxidoreductase YjmC-like [Source:NCBI gene;Acc:103033560])

HSP 1 Score: 350.517 bits (898), Expect = 6.256e-118
Identity = 183/356 (51.40%), Postives = 246/356 (69.10%), Query Frame = 1
Query:   43 MADNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXX-XXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPL 1107
            M+ +  ++   EV+ F   C+ + G +  HA++LA V++  D RGH+SHGLNRL  Y+++++ G+   + EP + KESV+TA VDG N LGPVVGN+ M LA+ KA+ TGIGWVVA+ SNHYGIA +YSM+A++E +IGMS+TNTSPLV+PT +++  +GTNPISVAAP     DS ++DMATSAVALGK+E+ +R+   +P GW  DA G+ T DP+  L GG L  LG  E TGG+KGYGLGLMVE+FCG+L+ S +   +R W   +  A+LGQCFVAI+P+ F  GF +R+S L    R L      +PVL  GDPER HI+ CK L GIPY   L+  ++E    L V PL
Sbjct:    1 MSVSRCLLIQAEVQAFIERCMVAVGTRASHARSLADVLIEGDLRGHYSHGLNRLDVYLREIRAGICVREGEPLLEKESVATALVDGRNLLGPVVGNYCMNLALKKARDTGIGWVVAHGSNHYGIAAYYSMQALKENMIGMSYTNTSPLVVPTRARECTVGTNPISVAAPAK-NGDSFVLDMATSAVALGKVEIHDRNGLSIPEGWGCDAEGRATTDPKAVLCGGGLVPLGDKETTGGHKGYGLGLMVEVFCGILAGSKYSNKIRNWKKTDRRADLGQCFVAINPENFAPGFNDRMSDLLARHRNLTPMEPGMPVLAAGDPEREHIQTCKELGGIPYDLKLVTHVNEYARTLDVSPL 355          
BLAST of Malate dehydrogenase vs. Ensembl Cavefish
Match: ENSAMXT00000047133.1 (uncharacterized oxidoreductase YjmC-like [Source:NCBI gene;Acc:103033560])

HSP 1 Score: 312.383 bits (799), Expect = 3.989e-103
Identity = 173/348 (49.71%), Postives = 235/348 (67.53%), Query Frame = 1
Query:   76 EVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVAN-RSNH--YGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXX-XXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPL 1107
            EV+ F   C+ + G +  HA++LA V++  D RGH+SHGLNRL  Y+++++ G+   + EP + KESV+TA VDG N LGPVVGN+ M LA+ KA+ TGIGWVVA+ +SN   Y  + ++++K      +GMS+TNTSPLV+PT +++  +GTNPISVAAP     DS ++DMATSAVALGK+E+ +R+   +P GW  DA G+ T DP+  L GG L  LG  E TGG+KGYGLGLMVE+FCG+L+ S +   +R W   +  A+LGQCFVAI+P+ F  GF +R+S L    R L   +  +PVL  GDPER HI+ CK L GIPY   L+  ++E    L V PL
Sbjct:   11 EVQAFIERCMVAVGTRASHARSLADVLIEGDLRGHYSHGLNRLDVYLREIRAGICVREGEPLLEKESVATALVDGRNLLGPVVGNYCMNLALKKARDTGIGWVVAHGKSNTPPY-FSCFHALK------LGMSYTNTSPLVVPTRARECTVGTNPISVAAPAK-NGDSFVLDMATSAVALGKVEIHDRNGLSIPEGWGCDAEGRATTDPKAVLCGGGLVPLGDKETTGGHKGYGLGLMVEVFCGILAGSKYSNKIRNWKKTDRRADLGQCFVAINPENFAPGFNDRMSDLLARHRNLTPVSPGMPVLAAGDPEREHIQTCKELGGIPYDLKLVTHVNEYARTLDVSPL 350          
BLAST of Malate dehydrogenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003235.1 (pep scaffold:Pmarinus_7.0:GL476623:177877:191001:1 gene:ENSPMAG00000002953.1 transcript:ENSPMAT00000003235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 352.829 bits (904), Expect = 4.832e-120
Identity = 175/332 (52.71%), Postives = 231/332 (69.58%), Query Frame = 1
Query:   61 IIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXXXXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANL---GQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPY 1047
            +IP  +V+ F   C+ +   KP HA+ALA V+V  D+RGH+SHGLNR+  Y+KD+K G+     EP + KE+ +TA V+GNN LGPVVGNF M LAM KA ++G+GWVVA  SNHYGIAG+YSM+A+E+G++GMSFTNTSPLV+PT   +  LGTNPISVAAP   K+DS ++DMATSAVALGK+E+  R++  +P GW  DA G VT DP+K    G   L      GGYKGYGLG+MVE+FCG+++ +++  N+R W     +A+L    +CFVA++   F  GF  R++ L    R LP A     VLVPGDPER HI +C++  GIPY
Sbjct:    1 LIPKADVKSFIQQCMVAVKTKPAHAKALADVLVEGDYRGHYSHGLNRMDMYVKDIKSGICEKDGEPTIEKETAATALVNGNNLLGPVVGNFCMDLAMKKATESGVGWVVARGSNHYGIAGFYSMQALEQGMMGMSFTNTSPLVVPTRGMECTLGTNPISVAAPAG-KDDSFVLDMATSAVALGKVELHARNQQTIPEGWGCDAKGAVTQDPQKV-LDGGGLLALGGAEGGYKGYGLGMMVEVFCGIMAGATYSNNIRTWRETSRVADLVGVSKCFVAVNLSCFAPGFESRMADLLSIHRHLPPAPGATSVLVPGDPERQHIAECESKGGIPY 330          
BLAST of Malate dehydrogenase vs. Ensembl Nematostella
Match: EDO45090 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTU3])

HSP 1 Score: 335.88 bits (860), Expect = 2.389e-112
Identity = 177/342 (51.75%), Postives = 225/342 (65.79%), Query Frame = 1
Query:   76 EVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXX--XXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELK 1095
            +VE F   C+   G    HA+ L  V+   D RGHFSHGLNRL  Y+ D+++G      +P V+K++ +TA VDGNN LGPVVGNF M LA++KAK  G+ WVV   SNHYGIAGWY+++A+EEGLIG+S TNTSPLV+PT  + V LGTNPISVAAP     DS ++DMATSAVALGKIEM  R    +P GW  DA G  T DP   L  G     LGG+E T GYKGYGL +MVE+  G+L+ S+ G ++R W  D   ANLGQCF AI+P  F  G+ +R+ +L    R +P A     VLV GDPER+H+ K +   GI Y   L+ +LD+L ++LK
Sbjct:   38 DVESFIERCMTKVGTTEAHARQLGQVLTAGDVRGHFSHGLNRLEMYVHDIQEGTTVYTGKPTVVKQTAATAFVDGNNLLGPVVGNFCMDLAINKAKDVGVSWVVCKGSNHYGIAGWYTLRALEEGLIGISVTNTSPLVVPTRGRGVTLGTNPISVAAPAQ-NGDSFVLDMATSAVALGKIEMNRRKDIPIPHGWGVDAKGLETLDPVDVLDRGGGQLPLGGTELTSGYKGYGLAMMVEVLSGILAGSAVGPDIRLWKGDPRTANLGQCFAAINPAMFAPGYEDRMQRLMDHCRNMPPAEGEDGVLVAGDPERLHMRKVEQEGGIQYHVNLLDALDKLADQLK 378          
BLAST of Malate dehydrogenase vs. Ensembl Medaka
Match: ENSORLT00000002623.2 (uncharacterized oxidoreductase YjmC [Source:NCBI gene;Acc:101173859])

HSP 1 Score: 352.058 bits (902), Expect = 1.259e-118
Identity = 184/350 (52.57%), Postives = 245/350 (70.00%), Query Frame = 1
Query:   61 IIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXX-XXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPL 1107
            +I   EV+ F   C+ + G KP HA++LA V+V AD RGH+SHGLNR+  Y+KD+K G+     EP   K+S +TA VDG N LGPVVGNF M LA+ KAK+ GIGWVVA+ SNH+GIAG+Y+M+A+++ +IGMSFTNTSPLV+PT  K+  LGTNP+SVAAP     DS ++D ATSAVALGK+E+  R    +P GW  D  GK+T DP++ L GG L  +GGSE TGGYKGYGLG+MVE+FCG+L+ + +  NVR W   + +A+LGQCFVAI+P  F  GF ER+S L    R    A+ + PVL PGDPER  ++KC+ + GI Y   ++K +++   ++ V  L
Sbjct:    5 LISRVEVQGFIERCMMAVGTKPHHARSLAEVLVAADSRGHYSHGLNRMDMYVKDIKSGVCAVDGEPLAEKQSAATALVDGKNLLGPVVGNFCMNLAIRKAKEVGIGWVVAHGSNHFGIAGFYAMQALKDNMIGMSFTNTSPLVVPTRGKERTLGTNPLSVAAPAK-DGDSFVLDTATSAVALGKVELSERHGDSIPDGWGCDPQGKITADPKRVLTGGGLVPIGGSEATGGYKGYGLGMMVEVFCGILAGAHYSNNVRTWKVTDRVADLGQCFVAINPDNFAAGFNERMSDLLSIQRNQDLADPDAPVLTPGDPERASLKKCEEMGGILYHINVVKYMNDYAKKIGVSEL 353          
BLAST of Malate dehydrogenase vs. Planmine SMEST
Match: SMESG000034865.1 (SMESG000034865.1)

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 358/358 (100.00%), Postives = 358/358 (100.00%), Query Frame = 1
Query:   43 MADNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXXXXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPLQRK 1116
            MADNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKALKGGLLPLGGSEETGGYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPLQRK
Sbjct:    1 MADNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKALKGGLLPLGGSEETGGYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPLQRK 358          
BLAST of Malate dehydrogenase vs. Planmine SMEST
Match: SMESG000073623.1 (SMESG000073623.1)

HSP 1 Score: 369.777 bits (948), Expect = 6.647e-126
Identity = 189/336 (56.25%), Postives = 241/336 (71.73%), Query Frame = 1
Query:  103 LKSGGAKPEHAQALAVVIVCADHRGHFSHGLNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMKLAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVLPTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSRLPLGWAADANGKVTDDPEKAXXXXXXXXXXXXXXXXYKGYGLGLMVEIFCGMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQEMRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNELKVKPLQ 1110
            + S   K EH++ALA V+V AD+ GHFSHGLNRL  Y+ D+K  + +  +EP +I E   TA VDG NCLGPVVGNF M +A+ KA+  GIGWV A  SNHYGIAGWYS  A ++GL+GMSFTNTSPL  PT  KQVALGTNP+++AAPG    D+ ++DMAT+AVALGKIEM  R    +P GWAAD +G VT    +  +GGLLPLGG E TGGYKGYGL ++VEIFCG+LS S +G N+RKW S    ANLGQ F  IDP AFE+GF  R+S  ++ +R LP ++  +PVL+PGD ER+H + C  + GIPY +VLI S++ L  +L + P++
Sbjct:    1 MNSVNTKIEHSKALADVLVAADYSGHFSHGLNRLEMYVDDIKANVTSKVNEPCIISEKGGTAFVDGKNCLGPVVGNFCMDIAIKKAQDVGIGWVAAKGSNHYGIAGWYSQMACDKGLLGMSFTNTSPLAFPTRGKQVALGTNPLTLAAPGEKNSDNFLLDMATTAVALGKIEMAKRKGEAIPEGWAADIDGNVTKIASEGAEGGLLPLGGVELTGGYKGYGLSMLVEIFCGILSGSLYGPNIRKWGSVGTEANLGQGFAVIDPDAFESGFKSRMSDFAKILRSLPHSDSKLPVLIPGDKERLHKKSCNEIGGIPYPNVLIDSMNSLAQKLNINPIK 336          
The following BLAST results are available for this feature:
BLAST of Malate dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Malate dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
VF13D12L.38.055e-11550.29pep chromosome:WBcel235:II:11705989:11713608:1 gen... [more]
VF13D12L.38.055e-11550.29pep chromosome:WBcel235:II:11706009:11713610:1 gen... [more]
F36A2.31.629e-11149.86pep chromosome:WBcel235:I:8798785:8801694:1 gene:W... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG105122.334e-10146.78gene:FBgn0037057 transcript:FBtr0078299[more]
CG105122.334e-10146.78gene:FBgn0037057 transcript:FBtr0078300[more]
CG105123.793e-10146.65gene:FBgn0037057 transcript:FBtr0078298[more]
CG105122.879e-10046.78gene:FBgn0037057 transcript:FBtr0078297[more]
CG188085.911e-7035.14gene:FBgn0042131 transcript:FBtr0073361[more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Malate dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Malate dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Malate dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16142|MDH_METFV1.930e-6738.86Malate/(S)-sulfolactate dehydrogenase OS=Methanoth... [more]
sp|O59028|MDH_PYRHO4.645e-6738.94Malate dehydrogenase OS=Pyrococcus horikoshii (str... [more]
sp|Q9V0D5|MDH_PYRAB9.119e-6738.55Malate dehydrogenase OS=Pyrococcus abyssi (strain ... [more]
sp|Q58820|COMC_METJA3.167e-6240.06L-sulfolactate dehydrogenase OS=Methanocaldococcus... [more]
sp|O27273|COMC_METTH1.214e-5334.87L-sulfolactate dehydrogenase OS=Methanothermobacte... [more]
back to top
BLAST of Malate dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KLL36.047e-13255.56Putative malate dehydrogenase OS=Schistosoma manso... [more]
G4V6982.867e-13155.27Putative malate dehydrogenase OS=Schistosoma manso... [more]
A0A4Z2DGV97.958e-13155.43Malate dehydrogenase isoform 1 (Fragment) OS=Schis... [more]
A0A4S2MGB02.425e-13055.77Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2MA262.625e-13054.50Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000013803.26.256e-11851.40uncharacterized oxidoreductase YjmC-like [Source:N... [more]
ENSAMXT00000047133.13.989e-10349.71uncharacterized oxidoreductase YjmC-like [Source:N... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003235.14.832e-12052.71pep scaffold:Pmarinus_7.0:GL476623:177877:191001:1... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Malate dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO450902.389e-11251.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000002623.21.259e-11852.57uncharacterized oxidoreductase YjmC [Source:NCBI g... [more]
back to top
BLAST of Malate dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000034865.10.000e+0100.00SMESG000034865.1[more]
SMESG000073623.16.647e-12656.25SMESG000073623.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019773 ID=SMED30019773|Name=Malate dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1390bp
AAATAATTTCAATATTTTAAATTAAAGATTATAAACTACGGCATGGCTGA
TAATCCGGTCATAATACCACCTGAAGAAGTTGAAAGATTTTGTGTTGATT
GCTTAAAATCAGGAGGAGCCAAGCCGGAACACGCACAAGCACTAGCTGTC
GTTATTGTTTGCGCAGACCACCGAGGTCATTTTAGCCATGGTCTTAATAG
ATTGCCAAAGTATATCAAAGATTTGAAAAAGGGTATGATTAATACAAAAG
ATGAACCTAAAGTAATTAAAGAATCTGTTTCGACTGCGTCAGTTGACGGC
AACAATTGCTTGGGACCAGTTGTTGGGAACTTTTCAATGAAATTGGCTAT
GGATAAAGCGAAAAAAACTGGAATAGGATGGGTAGTTGCAAACCGTTCAA
ATCATTATGGAATTGCAGGTTGGTATTCAATGAAAGCTGTCGAAGAAGGA
TTAATTGGAATGTCTTTTACAAATACGTCGCCATTAGTTTTACCAACTGG
ATCGAAACAGGTTGCATTAGGCACCAACCCAATATCTGTAGCGGCCCCAG
GTAATGTAAAAGAAGATTCAATAATAATAGATATGGCCACTTCTGCCGTT
GCATTGGGTAAAATTGAAATGAAGAATCGCTCTAAATCACGACTTCCGTT
AGGTTGGGCTGCAGATGCAAATGGCAAAGTAACTGATGATCCAGAAAAAG
CATTAAAGGGTGGATTGCTTCCATTAGGAGGTTCTGAAGAAACAGGTGGA
TACAAAGGATATGGTTTAGGACTAATGGTGGAAATATTTTGCGGAATGCT
GTCTAATTCTTCTTTTGGACAAAATGTCAGAAAATGGGATAGTGATGAAG
CAATTGCAAATCTTGGTCAATGTTTTGTTGCAATAGATCCAAAGGCCTTT
GAAACCGGTTTTACTGAAAGAATATCAAAACTGTCACAAGAGATGCGTCA
ATTACCAAGAGCTAATGAAAACATTCCGGTCCTAGTTCCAGGTGACCCAG
AACGAATGCACATAGAAAAATGTAAAAATCTAAAGGGTATTCCATATGTC
TCGGTTTTGATTAAAAGCCTGGATGAACTAGGGAATGAACTGAAAGTAAA
ACCACTGCAAAGAAAGTAAATTTCAAAGCATCTATTAACTTGATTTTGAC
AAACTTAGTATTATTTTTCAGATAATTATGTAATTTCCAATTTATTTGAA
TTAAAAGGGGCACCAAATAGTTTGTCACCCAGCCTGACTGTAAACGGAAC
AAATTTTTGAATTTTTTTGCTCTCATTGTAAAATTTAGTTTTAGTAATGA
AATTCTATATTAAAACTTTTGTTGAAGCCAAAGATTACCATTTTGTTGAT
TACCATATCCCTCGTTTTTATCCTGTTACTTCCAGTCAGC
back to top

protein sequence of SMED30019773-orf-1

>SMED30019773-orf-1 ID=SMED30019773-orf-1|Name=SMED30019773-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=359bp
MADNPVIIPPEEVERFCVDCLKSGGAKPEHAQALAVVIVCADHRGHFSHG
LNRLPKYIKDLKKGMINTKDEPKVIKESVSTASVDGNNCLGPVVGNFSMK
LAMDKAKKTGIGWVVANRSNHYGIAGWYSMKAVEEGLIGMSFTNTSPLVL
PTGSKQVALGTNPISVAAPGNVKEDSIIIDMATSAVALGKIEMKNRSKSR
LPLGWAADANGKVTDDPEKALKGGLLPLGGSEETGGYKGYGLGLMVEIFC
GMLSNSSFGQNVRKWDSDEAIANLGQCFVAIDPKAFETGFTERISKLSQE
MRQLPRANENIPVLVPGDPERMHIEKCKNLKGIPYVSVLIKSLDELGNEL
KVKPLQRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR043144Mal/L-sulf/L-lact_DH-like_ah
IPR043143Mal/L-sulf/L-lact_DH-like_NADP
IPR036111Mal/L-sulfo/L-lacto_DH-like_sf
IPR003767Malate/L-lactate_DH-like
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0030060L-malate dehydrogenase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR043144Malate/L-sulfolactate/L-lactate dehydrogenase-like, alpha-helical domainGENE3DG3DSA:1.10.1530.10coord: 14..347
e-value: 5.1E-116
score: 389.2
IPR003767Malate/L-lactate dehydrogenase-likePFAMPF02615Ldh_2coord: 9..343
e-value: 1.5E-114
score: 382.6
IPR003767Malate/L-lactate dehydrogenase-likePANTHERPTHR11091OXIDOREDUCTASE-RELATEDcoord: 4..357
IPR043143Malate/L-sulfolactate/L-lactate dehydrogenase-like, NADPH binding domainGENE3DG3DSA:3.30.1370.60coord: 72..325
e-value: 5.1E-116
score: 389.2
NoneNo IPR availablePANTHERPTHR11091:SF0coord: 4..357
IPR036111Malate/L-sulfolactate/L-lactate dehydrogenase-like superfamilySUPERFAMILYSSF89733L-sulfolactate dehydrogenase-likecoord: 7..356