Afadin

Overview
NameAfadin
Smed IDSMED30019772
Length (bp)4202
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Afadin (SMED30019772) t-SNE clustered cells

Violin plots show distribution of expression levels for Afadin (SMED30019772) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Afadin (SMED30019772) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Afadin (SMED30019772) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019772

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30019772h1SMcG0013759 dd_Smed_v4_9564_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Afadin vs. Ensembl Human
Match: AFDN (afadin, adherens junction formation factor [Source:HGNC Symbol;Acc:HGNC:7137])

HSP 1 Score: 153.68 bits (387), Expect = 9.825e-37
Identity = 127/412 (30.83%), Postives = 200/412 (48.54%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  560 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCD-VVRNIPNGLQEFL-------------------DPLCQ-RGF----CRLIP 928          

HSP 2 Score: 103.219 bits (256), Expect = 3.060e-21
Identity = 104/342 (30.41%), Postives = 157/342 (45.91%), Query Frame = 1
Query:  202 MRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWC----------------------------KDDKEGVFV-FKSNLKNKNSRR--------IRSQTRKD--KIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVY---KDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQGTFP 1086
            MRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S  ++ LD ++ PL++QL W                             K +KEGV   FK  L  K  +         +R  + KD          NS   R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  D A+F V E L+KYG+E EN  D+ +   +       + +K   E IL + + PL+   +   + G + F++ + P + I K  K   +G  P
Sbjct:    1 MRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENS---RLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDHIPKKTKKHLEGKTP 323          
BLAST of Afadin vs. Ensembl Human
Match: AFDN (afadin, adherens junction formation factor [Source:HGNC Symbol;Acc:HGNC:7137])

HSP 1 Score: 153.68 bits (387), Expect = 1.049e-36
Identity = 127/412 (30.83%), Postives = 200/412 (48.54%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  601 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCD-VVRNIPNGLQEFL-------------------DPLCQ-RGF----CRLIP 969          

HSP 2 Score: 142.124 bits (357), Expect = 3.461e-33
Identity = 119/368 (32.34%), Postives = 181/368 (49.18%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWC----------------------------KDDKEGVFV-FKSNLKNKNSRR--------IRSQTRKD--KIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVY---KDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQGTFP 1086
            +I+ WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W                             K +KEGV   FK  L  K  +         +R  + KD          NS   R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  D A+F V E L+KYG+E EN  D+ +   +       + +K   E IL + + PL+   +   + G + F++ + P + I K  K   +G  P
Sbjct:   16 IIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENS---RLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDHIPKKTKKHLEGKTP 364          
BLAST of Afadin vs. Ensembl Human
Match: AFDN (afadin, adherens junction formation factor [Source:HGNC Symbol;Acc:HGNC:7137])

HSP 1 Score: 153.68 bits (387), Expect = 1.089e-36
Identity = 127/412 (30.83%), Postives = 200/412 (48.54%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  600 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCD-VVRNIPNGLQEFL-------------------DPLCQ-RGF----CRLIP 968          

HSP 2 Score: 145.206 bits (365), Expect = 4.247e-34
Identity = 120/367 (32.70%), Postives = 182/367 (49.59%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKD---------------------------DKEGVFV-FKSNLKNKNSRR--------IRSQTRKD--KIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVY---KDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQGTFP 1086
            +I+ WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W KD                           +KEGV   FK  L  K  +         +R  + KD          NS   R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  D A+F V E L+KYG+E EN  D+ +   +       + +K   E IL + + PL+   +   + G + F++ + P + I K  K   +G  P
Sbjct:   16 IIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENS---RLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDHIPKKTKKHLEGKTP 363          
BLAST of Afadin vs. Ensembl Human
Match: AFDN (afadin, adherens junction formation factor [Source:HGNC Symbol;Acc:HGNC:7137])

HSP 1 Score: 153.295 bits (386), Expect = 1.326e-36
Identity = 127/412 (30.83%), Postives = 200/412 (48.54%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  585 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCD-VVRNIPNGLQEFL-------------------DPLCQ-RGF----CRLIP 953          

HSP 2 Score: 142.51 bits (358), Expect = 2.731e-33
Identity = 119/367 (32.43%), Postives = 181/367 (49.32%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWC---------------------------KDDKEGVFV-FKSNLKNKNSRR--------IRSQTRKD--KIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVY---KDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQGTFP 1086
            +I+ WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W                            K +KEGV   FK  L  K  +         +R  + KD          NS   R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  D A+F V E L+KYG+E EN  D+ +   +       + +K   E IL + + PL+   +   + G + F++ + P + I K  K   +G  P
Sbjct:   16 IIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENS---RLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDHIPKKTKKHLEGKTP 363          
BLAST of Afadin vs. Ensembl Human
Match: AFDN (afadin, adherens junction formation factor [Source:HGNC Symbol;Acc:HGNC:7137])

HSP 1 Score: 152.91 bits (385), Expect = 1.905e-36
Identity = 127/412 (30.83%), Postives = 200/412 (48.54%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  601 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCD-VVRNIPNGLQEFL-------------------DPLCQ-RGF----CRLIP 969          

HSP 2 Score: 142.51 bits (358), Expect = 2.689e-33
Identity = 119/368 (32.34%), Postives = 181/368 (49.18%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWC----------------------------KDDKEGVFV-FKSNLKNKNSRR--------IRSQTRKD--KIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVY---KDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQGTFP 1086
            +I+ WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W                             K +KEGV   FK  L  K  +         +R  + KD          NS   R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  D A+F V E L+KYG+E EN  D+ +   +       + +K   E IL + + PL+   +   + G + F++ + P + I K  K   +G  P
Sbjct:   16 IIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENS---RLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDHIPKKTKKHLEGKTP 364          
BLAST of Afadin vs. Ensembl Celegans
Match: afd-1 (AFaDin (Actin filament binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:X5M8U5])

HSP 1 Score: 108.612 bits (270), Expect = 2.049e-23
Identity = 100/332 (30.12%), Postives = 162/332 (48.80%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE--RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKS---------NLKNKNSRRIR----------SQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEI----LQNSDSPLRFLLQ--SNKNDGFIKFRVVK 1032
            L+ QWN +RL+LF +S P ++L+  GVMRF+F+   +K  +KC+RVSS    + ++  L EKF       S   + L+E   +    KLLD E+ PL++QL W KDD+EG F+ K          NL+  + +  R           + +K+ +           +  D +    P  +                 +RTISNPE++MR +R+ KLE      +K   +  GG+LK+YG  + P  PY S+L  I++ A+ ++   L+KYG+E+ +++DF LV     D      +  EI    +  ++ PL  +     N  +GF  F  +K
Sbjct:   11 LVQQWNENRLDLFHLSYPTEDLEVEGVMRFYFQDGGEKVLTKCVRVSSTATTRAVVDALSEKFLPDLKMLSNDTYSLWEVHENGEERKLLD-EEKPLVVQLQWHKDDREGRFLLKKDAAPPVSLLNLQEADQKNTRFAKKKDKEPKKKNQKNFVSVQVNGGREEAQSQDDIYKQVPFNT----------------FTRTISNPEAVMRKRREKKLE------TKLKEMMFGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEH-SKDDFILVEVSNDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIK 318          

HSP 2 Score: 78.5666 bits (192), Expect = 3.063e-14
Identity = 78/296 (26.35%), Postives = 146/296 (49.32%), Query Frame = 1
Query: 1834 YWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDT---PCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVP--QIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL-HKEWC 2703
            +WLAN +EF HL++ +   ++  +S + K     +   +  F+ +       +      LL+ + +D +   D               +I  L + M   + C +N AL IQ+   + H++N ++FNS +       ++     + +  RIE I R+ ER  + +AA+C+  +S QA  LL  +K D+    +    +   NS+Q+ ++L    + P++ ++P     +D +   A + ADK+  E+G  + L+  + LNLP L+P+DGY V+  +  VP G  +YL++L H+  C
Sbjct:  633 FWLANASEFNHLVERD---TELKASRYGK----ISVEIERIFRRLVAVLQSVIRPAARALLDIHLNDHDATGD---------------VIHLLDTTMRQARICGLNAALTIQLCGHLLHMVNAFVFNSLVSVNLPAAQLNTRLGKCLQYRIESIHRFCERMGVEMAAECHLDRSRQAANLLATQKNDVAALGSTCYKL---NSLQVVHILSG--FEPDDGEIPCDDDVVDRICRLAEKQADKLTLEDGQRVTLEESDELNLPFLIPQDGYFVEQ-FRTVPDGLWQYLQQLQHRRLC 900          
BLAST of Afadin vs. Ensembl Celegans
Match: afd-1 (AFaDin (Actin filament binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:X5M8U5])

HSP 1 Score: 108.612 bits (270), Expect = 2.247e-23
Identity = 98/314 (31.21%), Postives = 159/314 (50.64%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE--RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSR-RIRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEI----LQNSDSPLRFLLQ--SNKNDGFIKFRVVK 1032
            L+ QWN +RL+LF +S P ++L+  GVMRF+F+   +K  +KC+RVSS    + ++  L EKF       S   + L+E   +    KLLD E+ PL++QL W KDD+EG F+ K +     S   ++   +K+   +      P  +           +   Q           +  +RTISNPE++MR +R+ KLE      +K   +  GG+LK+YG  + P  PY S+L  I++ A+ ++   L+KYG+E+ +++DF LV     D      +  EI    +  ++ PL  +     N  +GF  F  +K
Sbjct:   11 LVQQWNENRLDLFHLSYPTEDLEVEGVMRFYFQDGGEKVLTKCVRVSSTATTRAVVDALSEKFLPDLKMLSNDTYSLWEVHENGEERKLLD-EEKPLVVQLQWHKDDREGRFLLKKDAAPPVSLLNLQEADQKNTRFAKKKDKEPKKKNQKNFVQVNGGREEAQSQDDIYKQVPFNTFTRTISNPEAVMRKRREKKLE------TKLKEMMFGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEH-SKDDFILVEVSNDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIK 316          

HSP 2 Score: 78.5666 bits (192), Expect = 3.062e-14
Identity = 78/296 (26.35%), Postives = 146/296 (49.32%), Query Frame = 1
Query: 1834 YWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDT---PCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVP--QIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL-HKEWC 2703
            +WLAN +EF HL++ +   ++  +S + K     +   +  F+ +       +      LL+ + +D +   D               +I  L + M   + C +N AL IQ+   + H++N ++FNS +       ++     + +  RIE I R+ ER  + +AA+C+  +S QA  LL  +K D+    +    +   NS+Q+ ++L    + P++ ++P     +D +   A + ADK+  E+G  + L+  + LNLP L+P+DGY V+  +  VP G  +YL++L H+  C
Sbjct:  631 FWLANASEFNHLVERD---TELKASRYGK----ISVEIERIFRRLVAVLQSVIRPAARALLDIHLNDHDATGD---------------VIHLLDTTMRQARICGLNAALTIQLCGHLLHMVNAFVFNSLVSVNLPAAQLNTRLGKCLQYRIESIHRFCERMGVEMAAECHLDRSRQAANLLATQKNDVAALGSTCYKL---NSLQVVHILSG--FEPDDGEIPCDDDVVDRICRLAEKQADKLTLEDGQRVTLEESDELNLPFLIPQDGYFVEQ-FRTVPDGLWQYLQQLQHRRLC 898          
BLAST of Afadin vs. Ensembl Celegans
Match: afd-1 (AFaDin (Actin filament binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:X5M8U5])

HSP 1 Score: 108.612 bits (270), Expect = 2.550e-23
Identity = 98/314 (31.21%), Postives = 159/314 (50.64%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE--RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSR-RIRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEI----LQNSDSPLRFLLQ--SNKNDGFIKFRVVK 1032
            L+ QWN +RL+LF +S P ++L+  GVMRF+F+   +K  +KC+RVSS    + ++  L EKF       S   + L+E   +    KLLD E+ PL++QL W KDD+EG F+ K +     S   ++   +K+   +      P  +           +   Q           +  +RTISNPE++MR +R+ KLE      +K   +  GG+LK+YG  + P  PY S+L  I++ A+ ++   L+KYG+E+ +++DF LV     D      +  EI    +  ++ PL  +     N  +GF  F  +K
Sbjct:   11 LVQQWNENRLDLFHLSYPTEDLEVEGVMRFYFQDGGEKVLTKCVRVSSTATTRAVVDALSEKFLPDLKMLSNDTYSLWEVHENGEERKLLD-EEKPLVVQLQWHKDDREGRFLLKKDAAPPVSLLNLQEADQKNTRFAKKKDKEPKKKNQKNFVQVNGGREEAQSQDDIYKQVPFNTFTRTISNPEAVMRKRREKKLE------TKLKEMMFGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEH-SKDDFILVEVSNDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIK 316          

HSP 2 Score: 78.9518 bits (193), Expect = 2.882e-14
Identity = 78/296 (26.35%), Postives = 146/296 (49.32%), Query Frame = 1
Query: 1834 YWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDT---PCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVP--QIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL-HKEWC 2703
            +WLAN +EF HL++ +   ++  +S + K     +   +  F+ +       +      LL+ + +D +   D               +I  L + M   + C +N AL IQ+   + H++N ++FNS +       ++     + +  RIE I R+ ER  + +AA+C+  +S QA  LL  +K D+    +    +   NS+Q+ ++L    + P++ ++P     +D +   A + ADK+  E+G  + L+  + LNLP L+P+DGY V+  +  VP G  +YL++L H+  C
Sbjct:  631 FWLANASEFNHLVERD---TELKASRYGK----ISVEIERIFRRLVAVLQSVIRPAARALLDIHLNDHDATGD---------------VIHLLDTTMRQARICGLNAALTIQLCGHLLHMVNAFVFNSLVSVNLPAAQLNTRLGKCLQYRIESIHRFCERMGVEMAAECHLDRSRQAANLLATQKNDVAALGSTCYKL---NSLQVVHILSG--FEPDDGEIPCDDDVVDRICRLAEKQADKLTLEDGQRVTLEESDELNLPFLIPQDGYFVEQ-FRTVPDGLWQYLQQLQHRRLC 898          
BLAST of Afadin vs. Ensembl Celegans
Match: afd-1 (AFaDin (Actin filament binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:X5M8U5])

HSP 1 Score: 108.612 bits (270), Expect = 2.639e-23
Identity = 100/332 (30.12%), Postives = 162/332 (48.80%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE--RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKS---------NLKNKNSRRIR----------SQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEI----LQNSDSPLRFLLQ--SNKNDGFIKFRVVK 1032
            L+ QWN +RL+LF +S P ++L+  GVMRF+F+   +K  +KC+RVSS    + ++  L EKF       S   + L+E   +    KLLD E+ PL++QL W KDD+EG F+ K          NL+  + +  R           + +K+ +           +  D +    P  +                 +RTISNPE++MR +R+ KLE      +K   +  GG+LK+YG  + P  PY S+L  I++ A+ ++   L+KYG+E+ +++DF LV     D      +  EI    +  ++ PL  +     N  +GF  F  +K
Sbjct:   11 LVQQWNENRLDLFHLSYPTEDLEVEGVMRFYFQDGGEKVLTKCVRVSSTATTRAVVDALSEKFLPDLKMLSNDTYSLWEVHENGEERKLLD-EEKPLVVQLQWHKDDREGRFLLKKDAAPPVSLLNLQEADQKNTRFAKKKDKEPKKKNQKNFVSVQVNGGREEAQSQDDIYKQVPFNT----------------FTRTISNPEAVMRKRREKKLE------TKLKEMMFGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEH-SKDDFILVEVSNDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIK 318          

HSP 2 Score: 78.5666 bits (192), Expect = 3.085e-14
Identity = 78/296 (26.35%), Postives = 146/296 (49.32%), Query Frame = 1
Query: 1834 YWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDT---PCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVP--QIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL-HKEWC 2703
            +WLAN +EF HL++ +   ++  +S + K     +   +  F+ +       +      LL+ + +D +   D               +I  L + M   + C +N AL IQ+   + H++N ++FNS +       ++     + +  RIE I R+ ER  + +AA+C+  +S QA  LL  +K D+    +    +   NS+Q+ ++L    + P++ ++P     +D +   A + ADK+  E+G  + L+  + LNLP L+P+DGY V+  +  VP G  +YL++L H+  C
Sbjct:  633 FWLANASEFNHLVERD---TELKASRYGK----ISVEIERIFRRLVAVLQSVIRPAARALLDIHLNDHDATGD---------------VIHLLDTTMRQARICGLNAALTIQLCGHLLHMVNAFVFNSLVSVNLPAAQLNTRLGKCLQYRIESIHRFCERMGVEMAAECHLDRSRQAANLLATQKNDVAALGSTCYKL---NSLQVVHILSG--FEPDDGEIPCDDDVVDRICRLAEKQADKLTLEDGQRVTLEESDELNLPFLIPQDGYFVEQ-FRTVPDGLWQYLQQLQHRRLC 900          
BLAST of Afadin vs. Ensembl Celegans
Match: afd-1 (AFaDin (Actin filament binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:X5M8U5])

HSP 1 Score: 74.3294 bits (181), Expect = 5.997e-13
Identity = 78/296 (26.35%), Postives = 142/296 (47.97%), Query Frame = 1
Query: 1834 YWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFID---TPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVP--QIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL-HKEWC 2703
            +WLAN +EF HL++ +  L           Y   +   +  F+ +       +      LL+ + +D +   D               +I  L + M   + C +N AL IQ+   + H++N ++FNS +       ++     + +  RIE I R+ ER  + +AA+C+  +S QA  LL  +K D+    +    +   NS+Q+ ++L    + P++ ++P     +D +   A + ADK+  E+G  + L+  + LNLP L+P+DGY V+  +  VP G  +YL++L H+  C
Sbjct:  200 FWLANASEFNHLVERDTELKA-------SRYGKISVEIERIFRRLVAVLQSVIRPAARALLDIHLNDHDATGD---------------VIHLLDTTMRQARICGLNAALTIQLCGHLLHMVNAFVFNSLVSVNLPAAQLNTRLGKCLQYRIESIHRFCERMGVEMAAECHLDRSRQAANLLATQKNDVAALGSTCYKL---NSLQVVHILSG--FEPDDGEIPCDDDVVDRICRLAEKQADKLTLEDGQRVTLEESDELNLPFLIPQDGYFVEQ-FRTVPDGLWQYLQQLQHRRLC 467          
BLAST of Afadin vs. Ensembl Fly
Match: cno (gene:FBgn0259212 transcript:FBtr0334911)

HSP 1 Score: 268.47 bits (685), Expect = 2.329e-72
Identity = 249/911 (27.33%), Postives = 432/911 (47.42%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRRIRSQTR-KDKIGSTTCLNSPTTRCLDKVCTDPPTK------------------------------STKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNY----RNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQ-----EDSSYNTDSYESRNIPSV---ETPEQENDDVVIISDLDSHLSRH----LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELV--IGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKE 2697
            +I QWN++RL+LF +S+PD+NL F GVMRF+F+    K  +KC+RV+SD  V D++  L+EKF       S  ++ L+E  ++  ++ L+ ++ PLL+QL W  DD+EG F+ K N+  K +   ++    K K+             + K+ +DPPT                               S+   +         +  +R+ISNPE++MR +R+ KLE+KL+Q  S+ G  + GGTLKIYG+SL   +PYK+LLLSI D A+ VVRE+L KYG+E  +   + LV       N+   EY  IL + + PL  L+    + G I F V + PA+    ++ K             +  +N  N+    R   V     ++ DG  +  L  D     + + N +    PS      L+  +E      P + ++++ +    +       +   I + GS   F   + Y+      D  YN    +S+   +     +P+     ++      S  ++     LP  + + ++ +++ L  I+ ++  +   FKLA  Y L+L      R +   R  +   E    + MF+  VA+ +   + +  T   I ++W+AN +EFLH LK++  +S F+     +  ++ A+  Q  F+ +   F  ++  TL+  L+EN D                     +++  L S M++L++C VN AL IQ+ S++FH IN   FN+ +         W +++  R++ +  W+ER  L LAADC+  +  Q  + L   K+ +E           +NS+Q+  LL        + K+P+  +D  +  A  VAD++   +G ++ L+    L+L LLLP+DG+  D +  G+P G +++L  L ++
Sbjct:   16 VIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIRVASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHIDDREGRFLLK-NIDQKTTPIEQTDLNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSHLGLGNGVGASSGSAHMNGNAGGTGGDSSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKADPLHYCLVQV-----NSDGTEY--ILDDDECPLSILMNHPTSRGSIMFHVRRRPADSQPRRRKKK-----------PLGAANGANHISGDREGPVLVEVTHSGDGGRRIKLGSDPVEVGSANTNCLQLFGPSIQPRHCLISLLEGVCTVTPLHTDALTFVNGHHI-------SQPTILHNGSVVMFGRVASYRFLDSPTDGRYNLALSQSQLDSACLYERSPKMTGSGILAGGGSGSGDTQGQEPILPAVLEFPETHQELFLRHIISELDVNVPHFKLAPVYSLYLCAR--YRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPRILAFWMANSSEFLHFLKSDRHISAFSV----QAQEVLAEAVQTAFRNLVNCFRLELSQTLNQFLSENIDHDSAA---------------GLVLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTGDWGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALLQ-------QEKLPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVR-GIPTGLVDFLNPLQQQ 871          
BLAST of Afadin vs. Ensembl Fly
Match: cno (gene:FBgn0259212 transcript:FBtr0334912)

HSP 1 Score: 159.073 bits (401), Expect = 1.349e-38
Identity = 122/350 (34.86%), Postives = 188/350 (53.71%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRRIRSQTR-KDKIGSTTCLNSPTTRCLDKVCTDPPTK------------------------------STKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSK 1068
            +I QWN++RL+LF +S+PD+NL F GVMRF+F+    K  +KC+RV+SD  V D++  L+EKF       S  ++ L+E  ++  ++ L+ ++ PLL+QL W  DD+EG F+ K N+  K +   ++    K K+             + K+ +DPPT                               S+   +         +  +R+ISNPE++MR +R+ KLE+KL+Q  S+ G  + GGTLKIYG+SL   +PYK+LLLSI D A+ VVRE+L KYG+E  +   + LV       N+   EY  IL + + PL  L+    + G I F V + PA+    ++ K
Sbjct:   16 VIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIRVASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHIDDREGRFLLK-NIDQKTTPIEQTDLNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSHLGLGNGVGASSGSAHMNGNAGGTGGDSSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKADPLHYCLVQV-----NSDGTEY--ILDDDECPLSILMNHPTSRGSIMFHVRRRPADSQPRRRKK 357          

HSP 2 Score: 136.346 bits (342), Expect = 1.027e-31
Identity = 102/379 (26.91%), Postives = 188/379 (49.60%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELV--IGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKE 2697
            LP  + + ++ +++ L  I+ ++  +   FKLA  Y L+L      R +   R  +   E    + MF+  VA+ +   + +  T   I ++W+AN +EFLH LK++  +S F+     +  ++ A+  Q  F+ +   F  ++  TL+  L+EN D                     +++  L S M++L++C VN AL IQ+ S++FH IN   FN+ +         W +++  R++ +  W+ER  L LAADC+  +  Q  + L   K+ +E           +NS+Q+  LL        + K+P+  +D  +  A  VAD++   +G ++ L+    L+L LLLP+DG+  D +  G+P G +++L  L ++
Sbjct:  622 LPAVLEFPETHQELFLRHIISELDVNVPHFKLAPVYSLYLCAR--YRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPRILAFWMANSSEFLHFLKSDRHISAFSV----QAQEVLAEAVQTAFRNLVNCFRLELSQTLNQFLSENIDHDSAA---------------GLVLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTGDWGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALL-------QQEKLPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVR-GIPTGLVDFLNPLQQQ 971          
BLAST of Afadin vs. Ensembl Fly
Match: cno (gene:FBgn0259212 transcript:FBtr0299710)

HSP 1 Score: 158.688 bits (400), Expect = 1.536e-38
Identity = 122/354 (34.46%), Postives = 189/354 (53.39%), Query Frame = 1
Query:  109 TILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRRIRSQTR-KDKIGSTTCLNSPTTRCLDKVCTDPPTK------------------------------STKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSK 1068
             +  +I QWN++RL+LF +S+PD+NL F GVMRF+F+    K  +KC+RV+SD  V D++  L+EKF       S  ++ L+E  ++  ++ L+ ++ PLL+QL W  DD+EG F+ K N+  K +   ++    K K+             + K+ +DPPT                               S+   +         +  +R+ISNPE++MR +R+ KLE+KL+Q  S+ G  + GGTLKIYG+SL   +PYK+LLLSI D A+ VVRE+L KYG+E  +   + LV       N+   EY  IL + + PL  L+    + G I F V + PA+    ++ K
Sbjct:   12 AVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIRVASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHIDDREGRFLLK-NIDQKTTPIEQTDLNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSHLGLGNGVGASSGSAHMNGNAGGTGGDSSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKADPLHYCLVQV-----NSDGTEY--ILDDDECPLSILMNHPTSRGSIMFHVRRRPADSQPRRRKK 357          

HSP 2 Score: 137.502 bits (345), Expect = 4.349e-32
Identity = 102/379 (26.91%), Postives = 188/379 (49.60%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELV--IGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKE 2697
            LP  + + ++ +++ L  I+ ++  +   FKLA  Y L+L      R +   R  +   E    + MF+  VA+ +   + +  T   I ++W+AN +EFLH LK++  +S F+     +  ++ A+  Q  F+ +   F  ++  TL+  L+EN D                     +++  L S M++L++C VN AL IQ+ S++FH IN   FN+ +         W +++  R++ +  W+ER  L LAADC+  +  Q  + L   K+ +E           +NS+Q+  LL        + K+P+  +D  +  A  VAD++   +G ++ L+    L+L LLLP+DG+  D +  G+P G +++L  L ++
Sbjct:  622 LPAVLEFPETHQELFLRHIISELDVNVPHFKLAPVYSLYLCAR--YRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPRILAFWMANSSEFLHFLKSDRHISAFSV----QAQEVLAEAVQTAFRNLVNCFRLELSQTLNQFLSENIDHDSA---------------AGLVLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTGDWGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALL-------QQEKLPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVR-GIPTGLVDFLNPLQQQ 971          
BLAST of Afadin vs. Ensembl Fly
Match: cno (gene:FBgn0259212 transcript:FBtr0334913)

HSP 1 Score: 158.688 bits (400), Expect = 1.590e-38
Identity = 122/354 (34.46%), Postives = 189/354 (53.39%), Query Frame = 1
Query:  109 TILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRRIRSQTR-KDKIGSTTCLNSPTTRCLDKVCTDPPTK------------------------------STKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSK 1068
             +  +I QWN++RL+LF +S+PD+NL F GVMRF+F+    K  +KC+RV+SD  V D++  L+EKF       S  ++ L+E  ++  ++ L+ ++ PLL+QL W  DD+EG F+ K N+  K +   ++    K K+             + K+ +DPPT                               S+   +         +  +R+ISNPE++MR +R+ KLE+KL+Q  S+ G  + GGTLKIYG+SL   +PYK+LLLSI D A+ VVRE+L KYG+E  +   + LV       N+   EY  IL + + PL  L+    + G I F V + PA+    ++ K
Sbjct:   12 AVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIRVASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHIDDREGRFLLK-NIDQKTTPIEQTDLNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSHLGLGNGVGASSGSAHMNGNAGGTGGDSSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKADPLHYCLVQV-----NSDGTEY--ILDDDECPLSILMNHPTSRGSIMFHVRRRPADSQPRRRKK 357          

HSP 2 Score: 137.502 bits (345), Expect = 4.655e-32
Identity = 102/379 (26.91%), Postives = 188/379 (49.60%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELV--IGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKE 2697
            LP  + + ++ +++ L  I+ ++  +   FKLA  Y L+L      R +   R  +   E    + MF+  VA+ +   + +  T   I ++W+AN +EFLH LK++  +S F+     +  ++ A+  Q  F+ +   F  ++  TL+  L+EN D                     +++  L S M++L++C VN AL IQ+ S++FH IN   FN+ +         W +++  R++ +  W+ER  L LAADC+  +  Q  + L   K+ +E           +NS+Q+  LL        + K+P+  +D  +  A  VAD++   +G ++ L+    L+L LLLP+DG+  D +  G+P G +++L  L ++
Sbjct:  622 LPAVLEFPETHQELFLRHIISELDVNVPHFKLAPVYSLYLCAR--YRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPRILAFWMANSSEFLHFLKSDRHISAFSV----QAQEVLAEAVQTAFRNLVNCFRLELSQTLNQFLSENIDHDSA---------------AGLVLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTGDWGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALL-------QQEKLPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVR-GIPTGLVDFLNPLQQQ 971          
BLAST of Afadin vs. Ensembl Fly
Match: cno (gene:FBgn0259212 transcript:FBtr0300525)

HSP 1 Score: 158.688 bits (400), Expect = 1.621e-38
Identity = 122/350 (34.86%), Postives = 188/350 (53.71%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRRIRSQTR-KDKIGSTTCLNSPTTRCLDKVCTDPPTK------------------------------STKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSK 1068
            +I QWN++RL+LF +S+PD+NL F GVMRF+F+    K  +KC+RV+SD  V D++  L+EKF       S  ++ L+E  ++  ++ L+ ++ PLL+QL W  DD+EG F+ K N+  K +   ++    K K+             + K+ +DPPT                               S+   +         +  +R+ISNPE++MR +R+ KLE+KL+Q  S+ G  + GGTLKIYG+SL   +PYK+LLLSI D A+ VVRE+L KYG+E  +   + LV       N+   EY  IL + + PL  L+    + G I F V + PA+    ++ K
Sbjct:   16 VIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIRVASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHIDDREGRFLLK-NIDQKTTPIEQTDLNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSHLGLGNGVGASSGSAHMNGNAGGTGGDSSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKADPLHYCLVQV-----NSDGTEY--ILDDDECPLSILMNHPTSRGSIMFHVRRRPADSQPRRRKK 357          

HSP 2 Score: 136.732 bits (343), Expect = 9.604e-32
Identity = 102/379 (26.91%), Postives = 188/379 (49.60%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELV--IGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKE 2697
            LP  + + ++ +++ L  I+ ++  +   FKLA  Y L+L      R +   R  +   E    + MF+  VA+ +   + +  T   I ++W+AN +EFLH LK++  +S F+     +  ++ A+  Q  F+ +   F  ++  TL+  L+EN D                     +++  L S M++L++C VN AL IQ+ S++FH IN   FN+ +         W +++  R++ +  W+ER  L LAADC+  +  Q  + L   K+ +E           +NS+Q+  LL        + K+P+  +D  +  A  VAD++   +G ++ L+    L+L LLLP+DG+  D +  G+P G +++L  L ++
Sbjct:  622 LPAVLEFPETHQELFLRHIISELDVNVPHFKLAPVYSLYLCAR--YRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPRILAFWMANSSEFLHFLKSDRHISAFSV----QAQEVLAEAVQTAFRNLVNCFRLELSQTLNQFLSENIDHDSAA---------------GLVLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTGDWGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALLQ-------QEKLPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVR-GIPTGLVDFLNPLQQQ 971          
BLAST of Afadin vs. Ensembl Zebrafish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 159.844 bits (403), Expect = 8.829e-39
Identity = 119/354 (33.62%), Postives = 181/354 (51.13%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRRIRSQTRKDKI-------------------------------GSTTCLN---SPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSK 1068
            +IN WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S  ++ LD ++ PL++QL W KDD+EG FV K+       R + +   K+K                                G    LN      +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++  S+ G  + GGTL+IY DSL P IPYK++LLS  D A+F V E L+KYG+E EN  D+ +   ++ +    K   E IL ++D PL+ L     +   + F++ K P + +  K  K
Sbjct:   95 IINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKDDREGRFVLKNENDIMPKRTLTNGPEKEKEGVIQNFKRTLSKKEKKKEKKREKEAFSRIPDGDDHVLNREDGENSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSEDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDMADFAVAEALEKYGLEKENPRDYCIAQVIHANDKAVK---ETILDDTDCPLQILRDWTSDKEALVFQLKKRPPDYAPRKGRK 429          

HSP 2 Score: 157.532 bits (397), Expect = 4.573e-38
Identity = 115/378 (30.42%), Postives = 191/378 (50.53%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL 2688
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      D+ N +   L    +D +E++  P   K  D      ++ TL+  MS+L++C VN AL IQ+ S++FH +N W+FN  +       C  +  W  I+  ++  I  W+E+  L LAADC+  + +QA  LL M+K  ++   N       +NS+QL  LL NY  +P+EP +P   ID VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P GF E+LE L
Sbjct:  653 LPASIEFRENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL----EDPDEQN--PQRPKIED------VLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFVNMWLFNKLVTEADSGLCSHY--WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSMQDVQNINNTCFKLNSLQLNALLSNYHCAPDEPYIPPELIDHVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGFQEFLEPL 1011          
BLAST of Afadin vs. Ensembl Zebrafish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 159.458 bits (402), Expect = 1.195e-38
Identity = 119/354 (33.62%), Postives = 181/354 (51.13%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRRIRSQTRKDKI-------------------------------GSTTCLN---SPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSK 1068
            +IN WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S  ++ LD ++ PL++QL W KDD+EG FV K+       R + +   K+K                                G    LN      +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++  S+ G  + GGTL+IY DSL P IPYK++LLS  D A+F V E L+KYG+E EN  D+ +   ++ +    K   E IL ++D PL+ L     +   + F++ K P + +  K  K
Sbjct:   79 IINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKDDREGRFVLKNENDIMPKRTLTNGPEKEKEGVIQNFKRTLSKKEKKKEKKREKEAFSRIPDGDDHVLNREDGENSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSEDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDMADFAVAEALEKYGLEKENPRDYCIAQVIHANDKAVK---ETILDDTDCPLQILRDWTSDKEALVFQLKKRPPDYAPRKGRK 413          

HSP 2 Score: 157.918 bits (398), Expect = 3.628e-38
Identity = 115/378 (30.42%), Postives = 191/378 (50.53%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL 2688
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      D+ N +   L    +D +E++  P   K  D      ++ TL+  MS+L++C VN AL IQ+ S++FH +N W+FN  +       C  +  W  I+  ++  I  W+E+  L LAADC+  + +QA  LL M+K  ++   N       +NS+QL  LL NY  +P+EP +P   ID VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P GF E+LE L
Sbjct:  637 LPASIEFRENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL----EDPDEQN--PQRPKIED------VLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFVNMWLFNKLVTEADSGLCSHY--WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSMQDVQNINNTCFKLNSLQLNALLSNYHCAPDEPYIPPELIDHVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGFQEFLEPL 995          
BLAST of Afadin vs. Ensembl Xenopus
Match: AFDN (afadin, adherens junction formation factor [Source:NCBI gene;Acc:100493083])

HSP 1 Score: 162.155 bits (409), Expect = 2.105e-39
Identity = 124/353 (35.13%), Postives = 187/353 (52.97%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSN-----LKNKNSRRIRSQTRKDKIGS-TTCLNSPTTRCLDKVCTDPPTKSTK--------------QXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVY--KDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANI---------SKSKKSKTQG 1077
            +IN WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD E+ PL++QL W KDD+EG FV K+       K   S     Q ++  I +    L+    +   +   D   +ST               Q +         +  +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS +DTA+F V E L+KYGME EN  ++ +   V     Q++ K   E IL + + PL          G + F++ + P +          SKS KSK +G
Sbjct:   15 IINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPRYSLYEVHVSGERKLDFEEKPLVVQLNWNKDDREGRFVLKNENDIFPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKRRERDILKQSTDNEDRPQVRDDSENLQLAMEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTNDTADFAVIEALEKYGMEKENPKEYCIAKVVLPPGAQHSDKGMKEFILDDEECPLHIFRDWPSEKGELVFQLKRRPTDSLLKQNRKHESKSGKSKERG 367          

HSP 2 Score: 156.377 bits (394), Expect = 1.224e-37
Identity = 116/378 (30.69%), Postives = 188/378 (49.74%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL 2688
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+   +   I + + I    ++W+AN +E L+ +K +      N    D   D+ A   Q  F+ +      ++ +++   +    DD EE D       +  PK   +L  TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   ID VVS A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  E+LE L
Sbjct:  518 LPANIEFRENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSNKYRPDTSPAERTHKVIAVVNKMVGMMESVIQKQKNIAGALAFWMANASELLNFIKQD---RDLNRITLDAQ-DVLAHLVQMAFKYLVHCLQSELTSSMPAFI----DDPEEND-------SQRPKIEDVL-HTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLAHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHQDIPNINNTCFKLNSLQLQALLQNYHCAPDEPYIPTELIDSVVSVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGLQEFLEPL 876          
BLAST of Afadin vs. Ensembl Xenopus
Match: AFDN (afadin, adherens junction formation factor [Source:NCBI gene;Acc:100493083])

HSP 1 Score: 162.155 bits (409), Expect = 2.579e-39
Identity = 124/353 (35.13%), Postives = 187/353 (52.97%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSN-----LKNKNSRRIRSQTRKDKIGS-TTCLNSPTTRCLDKVCTDPPTKSTK--------------QXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVY--KDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANI---------SKSKKSKTQG 1077
            +IN WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD E+ PL++QL W KDD+EG FV K+       K   S     Q ++  I +    L+    +   +   D   +ST               Q +         +  +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS +DTA+F V E L+KYGME EN  ++ +   V     Q++ K   E IL + + PL          G + F++ + P +          SKS KSK +G
Sbjct:   15 IINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPRYSLYEVHVSGERKLDFEEKPLVVQLNWNKDDREGRFVLKNENDIFPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKRRERDILKQSTDNEDRPQVRDDSENLQLAMEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTNDTADFAVIEALEKYGMEKENPKEYCIAKVVLPPGAQHSDKGMKEFILDDEECPLHIFRDWPSEKGELVFQLKRRPTDSLLKQNRKHESKSGKSKERG 367          

HSP 2 Score: 146.747 bits (369), Expect = 1.249e-34
Identity = 116/383 (30.29%), Postives = 186/383 (48.56%), Query Frame = 1
Query: 1600 EDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIR----------------LTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL 2688
            ED  L +I+     S   FKL+  Y+L++    ++                 +  +N+        ++GM +E V  +I +   + + I    ++W+AN +E L+ +K +      N    D   D+ A   Q  F+ +      ++ +++   +    DD EE D     R   D      ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   ID VVS A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  E+LE L
Sbjct:  563 EDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSNKYRPDTSPAERTHKVIAVVNK--------MVGM-MESVIQEIDKGNQKQKNIAGALAFWMANASELLNFIKQD---RDLNRITLDAQ-DVLAHLVQMAFKYLVHCLQSELTSSMPAFI----DDPEENDS---QRPKID------VLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLAHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHQDIPNINNTCFKLNSLQLQALLQNYHCAPDEPYIPTELIDSVVSVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGLQEFLEPL 916          
BLAST of Afadin vs. Ensembl Xenopus
Match: AFDN (afadin, adherens junction formation factor [Source:NCBI gene;Acc:100493083])

HSP 1 Score: 161.384 bits (407), Expect = 3.660e-39
Identity = 125/352 (35.51%), Postives = 184/352 (52.27%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFK-----------SNLKNKNSRRIRSQTRKDKIGSTTCLNSPTTRC-LDKVCTD----PPTKSTK---QXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVY--KDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANI---------SKSKKSKTQG 1077
            +IN WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD E+ PL++QL W KDD+EG FV K           SN   K  +    Q  K  +              + K  TD    P  +      Q +         +  +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS +DTA+F V E L+KYGME EN  ++ +   V     Q++ K   E IL + + PL          G + F++ + P +          SKS KSK +G
Sbjct:   15 IINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPRYSLYEVHVSGERKLDFEEKPLVVQLNWNKDDREGRFVLKNENDIFPAKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKRRERDILKQSTDNEDRPQVRDDSENLQLAMEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTNDTADFAVIEALEKYGMEKENPKEYCIAKVVLPPGAQHSDKGMKEFILDDEECPLHIFRDWPSEKGELVFQLKRRPTDSLLKQNRKHESKSGKSKERG 366          

HSP 2 Score: 154.066 bits (388), Expect = 6.308e-37
Identity = 120/394 (30.46%), Postives = 193/394 (48.98%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIR----------------LTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL 2688
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    ++                 +  +N+        ++GM +E V  +I +   + + I    ++W+AN +E L+ +K +      N    D   D+ A   Q  F+ +      ++ +++   +    DD EE D       +  PK   +L  TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   ID VVS A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  E+LE L
Sbjct:  517 LPANIEFRENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSNKYRPDTSPAERTHKVIAVVNK--------MVGM-MESVIQEIDKGNQKQKNIAGALAFWMANASELLNFIKQD---RDLNRITLDAQ-DVLAHLVQMAFKYLVHCLQSELTSSMPAFI----DDPEEND-------SQRPKIEDVL-HTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLAHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHQDIPNINNTCFKLNSLQLQALLQNYHCAPDEPYIPTELIDSVVSVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGLQEFLEPL 882          
BLAST of Afadin vs. Ensembl Xenopus
Match: AFDN (afadin, adherens junction formation factor [Source:NCBI gene;Acc:100493083])

HSP 1 Score: 159.458 bits (402), Expect = 1.650e-38
Identity = 123/355 (34.65%), Postives = 183/355 (51.55%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFK------------SNLKNKNSRRIRSQTRKDKIGSTTC---------LNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVY--KDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANI---------SKSKKSKTQG 1077
            +IN WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S  ++ LD E+ PL++QL W KDD+EG FV K            SN   K  +    Q  K  +              +   +T   D+           Q +         +  +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS +DTA+F V E L+KYGME EN  ++ +   V     Q++ K   E IL + + PL          G + F++ + P +          SKS KSK +G
Sbjct:   15 IINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPRYSLYEVHVSGEERKLDFEEKPLVVQLNWNKDDREGRFVLKNENDIFPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKRRERDILKQSTDNEDRALAHGGDYENLQLAMEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTNDTADFAVIEALEKYGMEKENPKEYCIAKVVLPPGAQHSDKGMKEFILDDEECPLHIFRDWPSEKGELVFQLKRRPTDSLLKQNRKHESKSGKSKERG 369          

HSP 2 Score: 148.673 bits (374), Expect = 2.776e-35
Identity = 117/387 (30.23%), Postives = 191/387 (49.35%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQ---------HRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL 2688
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+   + +S++Q          + I    ++W+AN +E L+ +K +      N    D   D+ A   Q  F+ +      ++ +++   +    DD EE D       +  PK   +L  TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   ID VVS A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  E+LE L
Sbjct:  520 LPANIEFRENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSNKYRPDTSPAERTHKVIAVVNKMVGMM-ESVIQVSNQVGHEKQKNIAGALAFWMANASELLNFIKQD---RDLNRITLDAQ-DVLAHLVQMAFKYLVHCLQSELTSSMPAFI----DDPEEND-------SQRPKIEDVL-HTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLAHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHQDIPNINNTCFKLNSLQLQALLQNYHCAPDEPYIPTELIDSVVSVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGLQEFLEPL 886          
BLAST of Afadin vs. Ensembl Xenopus
Match: AFDN (afadin, adherens junction formation factor [Source:NCBI gene;Acc:100493083])

HSP 1 Score: 159.073 bits (401), Expect = 2.180e-38
Identity = 124/354 (35.03%), Postives = 187/354 (52.82%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSN-----LKNKNSRRIRSQTRKDKIGS-TTCLNSPTTRCLDKVCTDPPTKSTK--------------QXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVY--KDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANI---------SKSKKSKTQG 1077
            +IN WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S  ++ LD E+ PL++QL W KDD+EG FV K+       K   S     Q ++  I +    L+    +   +   D   +ST               Q +         +  +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS +DTA+F V E L+KYGME EN  ++ +   V     Q++ K   E IL + + PL          G + F++ + P +          SKS KSK +G
Sbjct:   15 IINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPRYSLYEVHVSGEERKLDFEEKPLVVQLNWNKDDREGRFVLKNENDIFPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKRRERDILKQSTDNEDRPQVRDDSENLQLAMEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTNDTADFAVIEALEKYGMEKENPKEYCIAKVVLPPGAQHSDKGMKEFILDDEECPLHIFRDWPSEKGELVFQLKRRPTDSLLKQNRKHESKSGKSKERG 368          

HSP 2 Score: 157.147 bits (396), Expect = 7.587e-38
Identity = 124/412 (30.10%), Postives = 197/412 (47.82%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+   +   I + + I    ++W+AN +E L+ +K +      N    D   D+ A   Q  F+ +      ++ +++   +    DD EE D       +  PK   +L  TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   ID VVS A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  E+LE                    LCQ RGF    C L+P
Sbjct:  541 LPANIEFRENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSNKYRPDTSPAERTHKVIAVVNKMVGMMESVIQKQKNIAGALAFWMANASELLNFIKQD---RDLNRITLDAQ-DVLAHLVQMAFKYLVHCLQSELTSSMPAFI----DDPEEND-------SQRPKIEDVL-HTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLAHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHQDIPNINNTCFKLNSLQLQALLQNYHCAPDEPYIPTELIDSVVSVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGLQEFLEP-------------------LCQ-RGF----CRLVP 909          
BLAST of Afadin vs. Ensembl Mouse
Match: Afdn (afadin, adherens junction formation factor [Source:MGI Symbol;Acc:MGI:1314653])

HSP 1 Score: 156.377 bits (394), Expect = 1.023e-37
Identity = 120/366 (32.79%), Postives = 187/366 (51.09%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVF------------KSNLKNKNSRR-------------------------IRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLV------SSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQG 1077
            +I+ WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W KDD+EG FV             +SN   K  +                          +R  + K++  S    +S  +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  DTA+F V E L+KYG+E EN  D+ +        + + D+   K   E IL + + PL+   +   + G + F++ + P + I K  K   +G
Sbjct:   16 IIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKKEKEALRQASDKEERPSQGD-DSENSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAK---EIILDDDECPLQIFREWPSDKGILVFQLKRRPPDYIPKKMKKHVEG 361          

HSP 2 Score: 154.451 bits (389), Expect = 4.551e-37
Identity = 131/414 (31.64%), Postives = 201/414 (48.55%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMF--IEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++    +  L+  +R  +   E        + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G D+ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  601 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYV--LSSQHRPDISPTERTHKAIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADELARSDGRDVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGLQEFL-------------------DPLCQ-RGF----CRLVP 969          
BLAST of Afadin vs. Ensembl Mouse
Match: Afdn (afadin, adherens junction formation factor [Source:MGI Symbol;Acc:MGI:1314653])

HSP 1 Score: 156.377 bits (394), Expect = 1.088e-37
Identity = 120/366 (32.79%), Postives = 187/366 (51.09%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVF------------KSNLKNKNSRR-------------------------IRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLV------SSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQG 1077
            +I+ WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W KDD+EG FV             +SN   K  +                          +R  + K++  S    +S  +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  DTA+F V E L+KYG+E EN  D+ +        + + D+   K   E IL + + PL+   +   + G + F++ + P + I K  K   +G
Sbjct:   16 IIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKKEKEALRQASDKEERPSQGD-DSENSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAK---EIILDDDECPLQIFREWPSDKGILVFQLKRRPPDYIPKKMKKHVEG 361          

HSP 2 Score: 153.68 bits (387), Expect = 7.914e-37
Identity = 132/421 (31.35%), Postives = 203/421 (48.22%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMV---------VDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++            DI      ++A  +  ++V    +E V  ++ Q   + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G D+ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  601 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSSQHRPDISPTERTHKAIAVVNKMV--SMMEGVIQEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADELARSDGRDVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGLQEFL-------------------DPLCQ-RGF----CRLVP 976          
BLAST of Afadin vs. Ensembl Mouse
Match: Afdn (afadin, adherens junction formation factor [Source:MGI Symbol;Acc:MGI:1314653])

HSP 1 Score: 156.377 bits (394), Expect = 1.131e-37
Identity = 120/366 (32.79%), Postives = 187/366 (51.09%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVF------------KSNLKNKNSRR-------------------------IRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLV------SSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQG 1077
            +I+ WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W KDD+EG FV             +SN   K  +                          +R  + K++  S    +S  +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  DTA+F V E L+KYG+E EN  D+ +        + + D+   K   E IL + + PL+   +   + G + F++ + P + I K  K   +G
Sbjct:   16 IIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKKEKEALRQASDKEERPSQGD-DSENSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAK---EIILDDDECPLQIFREWPSDKGILVFQLKRRPPDYIPKKMKKHVEG 361          

HSP 2 Score: 152.91 bits (385), Expect = 1.091e-36
Identity = 131/414 (31.64%), Postives = 201/414 (48.55%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMF--IEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++    +  L+  +R  +   E        + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G D+ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  601 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYV--LSSQHRPDISPTERTHKAIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADELARSDGRDVQLEEDPDLQLPFLLPEDGYSCD-VVRNIPNGLQEFL-------------------DPLCQ-RGF----CRLVP 969          
BLAST of Afadin vs. Ensembl Mouse
Match: Afdn (afadin, adherens junction formation factor [Source:MGI Symbol;Acc:MGI:1314653])

HSP 1 Score: 156.377 bits (394), Expect = 1.216e-37
Identity = 120/366 (32.79%), Postives = 187/366 (51.09%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVF------------KSNLKNKNSRR-------------------------IRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLV------SSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQG 1077
            +I+ WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W KDD+EG FV             +SN   K  +                          +R  + K++  S    +S  +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  DTA+F V E L+KYG+E EN  D+ +        + + D+   K   E IL + + PL+   +   + G + F++ + P + I K  K   +G
Sbjct:   16 IIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKKEKEALRQASDKEERPSQGD-DSENSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAK---EIILDDDECPLQIFREWPSDKGILVFQLKRRPPDYIPKKMKKHVEG 361          

HSP 2 Score: 154.451 bits (389), Expect = 4.303e-37
Identity = 131/414 (31.64%), Postives = 201/414 (48.55%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMF--IEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++    +  L+  +R  +   E        + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G D+ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  586 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYV--LSSQHRPDISPTERTHKAIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADELARSDGRDVQLEEDPDLQLPFLLPEDGYSCD-VVRNIPNGLQEFL-------------------DPLCQ-RGF----CRLVP 954          
BLAST of Afadin vs. Ensembl Mouse
Match: Afdn (afadin, adherens junction formation factor [Source:MGI Symbol;Acc:MGI:1314653])

HSP 1 Score: 156.377 bits (394), Expect = 1.248e-37
Identity = 120/366 (32.79%), Postives = 187/366 (51.09%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVF------------KSNLKNKNSRR-------------------------IRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLV------SSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQG 1077
            +I+ WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W KDD+EG FV             +SN   K  +                          +R  + K++  S    +S  +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  DTA+F V E L+KYG+E EN  D+ +        + + D+   K   E IL + + PL+   +   + G + F++ + P + I K  K   +G
Sbjct:   16 IIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKKEKEALRQASDKEERPSQGD-DSENSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAK---EIILDDDECPLQIFREWPSDKGILVFQLKRRPPDYIPKKMKKHVEG 361          

HSP 2 Score: 154.451 bits (389), Expect = 4.845e-37
Identity = 131/414 (31.64%), Postives = 201/414 (48.55%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMF--IEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++    +  L+  +R  +   E        + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G D+ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  586 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYV--LSSQHRPDISPTERTHKAIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADELARSDGRDVQLEEDPDLQLPFLLPEDGYSCD-VVRNIPNGLQEFL-------------------DPLCQ-RGF----CRLVP 954          
BLAST of Afadin vs. UniProt/SwissProt
Match: sp|Q9QZQ1|AFAD_MOUSE (Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3)

HSP 1 Score: 156.377 bits (394), Expect = 7.156e-37
Identity = 120/366 (32.79%), Postives = 187/366 (51.09%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVF------------KSNLKNKNSRR-------------------------IRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLV------SSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQG 1077
            +I+ WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W KDD+EG FV             +SN   K  +                          +R  + K++  S    +S  +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  DTA+F V E L+KYG+E EN  D+ +        + + D+   K   E IL + + PL+   +   + G + F++ + P + I K  K   +G
Sbjct:   16 IIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKKEKEALRQASDKEERPSQGD-DSENSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAK---EIILDDDECPLQIFREWPSDKGILVFQLKRRPPDYIPKKMKKHVEG 361          

HSP 2 Score: 154.451 bits (389), Expect = 3.183e-36
Identity = 131/414 (31.64%), Postives = 201/414 (48.55%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMF--IEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++    +  L+  +R  +   E        + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G D+ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  601 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYV--LSSQHRPDISPTERTHKAIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADELARSDGRDVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGLQEFL-------------------DPLCQ-RGF----CRLVP 969          
BLAST of Afadin vs. UniProt/SwissProt
Match: sp|O35889|AFAD_RAT (Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 4.223e-36
Identity = 119/366 (32.51%), Postives = 186/366 (50.82%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVF------------KSNLKNKNSRR-------------------------IRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLV------SSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQG 1077
            +I+ WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W KDD+EG FV             +SN   K  +                          +R  + K++  S    +S  +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  D A+F V E L+KYG+E EN  D+ +        + + D+   K   E IL + + PL+   +   + G + F++ + P + I K  K   +G
Sbjct:   16 IIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQASDKEERPSQGD-DSENSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAK---EIILDDDECPLQIFREWPSDKGILVFQLKRRPPDYIPKKMKKHVEG 361          

HSP 2 Score: 153.68 bits (387), Expect = 5.046e-36
Identity = 132/421 (31.35%), Postives = 203/421 (48.22%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMV---------VDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++            DI      ++A  +  ++V    +E V  ++ Q   + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G D+ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  601 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSSQHRPDISPTERTHKAIAVVNKMV--SMMEGVIQEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADELARSDGRDVQLEEDPDLQLPFLLPEDGYSCD-VVRNIPNGLQEFL-------------------DPLCQ-RGF----CRLVP 976          
BLAST of Afadin vs. UniProt/SwissProt
Match: sp|P55196|AFAD_HUMAN (Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3)

HSP 1 Score: 153.68 bits (387), Expect = 5.038e-36
Identity = 127/412 (30.83%), Postives = 200/412 (48.54%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLP 2790
            LP  I + +S ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      ++ N +   L    DD EE     L R    PK +  ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +  P    C  +  W  II  ++  I  W+E+  L LAADC+  + +QA  LL M+K   +   N       +NS+QL+ LL NY  +P+EP +P   I+ VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  E+L                   D LCQ RGF    C L+P
Sbjct:  601 LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFL----DDPEENS---LQR----PK-IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHY--WGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCD-VVRNIPNGLQEFL-------------------DPLCQ-RGF----CRLIP 969          

HSP 2 Score: 142.124 bits (357), Expect = 1.662e-32
Identity = 119/368 (32.34%), Postives = 181/368 (49.18%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWC----------------------------KDDKEGVFV-FKSNLKNKNSRR--------IRSQTRKD--KIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKS-GNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVY---KDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQGTFP 1086
            +I+ WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W                             K +KEGV   FK  L  K  +         +R  + KD          NS   R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++   S G  + GGTL+IY DSL P IPYK++LLS  D A+F V E L+KYG+E EN  D+ +   +       + +K   E IL + + PL+   +   + G + F++ + P + I K  K   +G  P
Sbjct:   16 IIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENS---RLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDHIPKKTKKHLEGKTP 364          
BLAST of Afadin vs. TrEMBL
Match: A0A0M8ZQR9 (Afadin OS=Melipona quadrifasciata OX=166423 GN=WN51_08083 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 7.776e-74
Identity = 259/901 (28.75%), Postives = 425/901 (47.17%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVF-----KSNLKNKNSRRIRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXX-------XXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPAN-ISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDSSYNTDSYESRNIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELV--IGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKE--------------WCFYKISHQD 2727
            +I QWN++RL+LF++S+P+++L+F GVMRF+F+ +  K  +KC+RV+SD   + ++  L+EKF       S  ++ L+E   +  ++ L  E+ PLL+QL W  DD+EG F+      K+N +          + + K+             L ++      KS +Q   +        +     +  +R+ISNPE++MR +R+ KLE KL+Q  SK G  + GGTLKIYG++L   +PYK+LLLS+ D+A  VVRE+L KYG+E  +   + LV    ++      + E IL + + PL  L+      G I F V + P++ + + +K K  G            K N V+YR  D +          F   L+PD +   NG+  +    P +++      +R  S     P+   SV A     V  +  P  H P S      +F L  +  E +S  +    +R + +   P +  D +             LP  + + +  E+    +++ D++PS  +FKLA  Y L+L      R +   R  +   E    + + +  VAS I++ I +     S  + WLAN +E LH+LKN+  +  F++   D   +          +CIS      M   ++                     A +P   + +++  SS M++L++C VN AL IQ+ S +FH IN   FN+ +       R + R +  R+  +  W+ER  L LA+ C+    +QA  LL   K + E     +     +NS+Q+R LL  Y  + +EP++P   I+ VV  A  VAD +   +G +I L+ + +L L LLLPEDGY  + +  GVP G  E+L  L ++              W  Y I H +
Sbjct:   18 VIQQWNANRLDLFELSEPNEDLEFHGVMRFYFQDSGQKVATKCIRVASDATSQAVIETLIEKFRPDMRMLSVPEYALYEIHENGEERKLGLEEKPLLVQLNWHIDDREGRFLLRRIDDKTNAQGVGFSSSDGSSFRRKLSKREKKQMKKQEKLSRL------KSLEQDENAIPVDQNGVAEKLYTASFTRSISNPEAVMRRRRQQKLERKLQQFRSKDGGPDTGGTLKIYGEALCKDVPYKTLLLSVRDSAVQVVREMLTKYGLEKVDPQQYCLVQVNSENNMNGGTQQEYILDDDECPLAILMNHPSARGSIMFHVRRRPSDYVPRKRKKKPSG------------KWNEVDYRYEDERL--------PFSLELNPDGNEIANGAGVRHRLQPNAAEMGS---ERSISIHPSSPSKSTSVPAAAVATVCHTRSP-THPPESTHNYETTFDLDGNV-ETASLTSSRDGNRTLQNDRQP-RGMDPI-------------LPAVLEFLEETEETFFHAVITDVEPSAPQFKLAPTYTLYLAAR--YRASTHYRPELQPTERAHRLTVMLANVASMIQRVIQERYMDTSSLALWLANGSELLHMLKNDRHVGAFSTRAQDILTEAVHTAFASLVRCISLELAPAMSQFMA--------------------DADEPAKEAGILQIFSSTMALLRRCRVNAALTIQLFSHLFHTINATAFNALVSNANLCVRWFGRRLKGRLNALETWAERQGLELASQCHLATIMQATHLLQAPKYNAEELATLSSTCFKLNSLQVRALLQKYQPAADEPRLPAELIENVVKVAESVADTLARADGREIRLEEEPTLALALLLPEDGYSCEVIR-GVPPGLAEFLTPLQRDGLCRMAPQPTSSGYWTIYMIDHNN 850          
BLAST of Afadin vs. TrEMBL
Match: A0A1I8MFH0 (Uncharacterized protein OS=Musca domestica OX=7370 GN=101892464 PE=4 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 8.231e-71
Identity = 256/891 (28.73%), Postives = 437/891 (49.05%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKS-------------NLKNKNSRRIRSQTRKDKI-------GSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANIS-KSKKSKTQGTFPDVCKSIAIRKSNSVNY-RNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDSSYNTDSYESRNIPSVETPEQENDDVVIISDLDSHLSRH-----LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELV--IGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKE 2697
            +I QWN++RL+LF +S+PD+NL F GVMRF+F+    K  +KC+RV+SD  V D++  L+EKF       S  ++ L+E  ++  ++ L+P++ PLL+QL W  DD+EG F+ K+             N K K S+R + + +K +        GS T  NS T        TD       Q +         +  +R+ISNPE++MR +R+ KLE+KL+Q  S+ G  + GGTLKIYG+SL   +PYK+LLLSI D A+ VVRE+L KYG++  +   + LV       N+   EY  IL + + PL  L+    + G I F V + PA+   + +K K  G         A   +N+++  R   +     ++ DG  +  L  D     + + N +    PS  +   L+  VE      P + ++++ +    +       N   + + G   S+    D   D  YN    +S+ + S    E+     +  +   +H+        LP  + + ++ +++ L  I+ ++  +   FKLA  Y L+L      R +   R  +   E    + +F+  VA+ I   + +  T   I ++W+AN +EFLH LK++  +S F+     +  ++ A++ Q  F+ +   F  ++  TL+  L+E  D                     +++  L S M++L++C VN AL IQ+ S++FH IN   FN+ +         W +++  R++ +  W+ER  L LAADC+  +  Q  + L   KT +E           +NS+Q+  LL        + K+P+  +D  +  A  VAD++   +G ++ L+    L+L LLLP+DG+  D +  G+P G +++L  L ++
Sbjct:   18 VIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIRVASDATVIDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNPDEKPLLVQLNWHIDDREGRFLLKNIDQKTTPIEQNDINFKRKLSKREKKEQKKKEKLAKLNTDGSNTTTNSQTNGLNGSHGTD---AGETQVAGKLYTELPETSFTRSISNPEAVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLDKADPLHYCLVQV-----NSDGSEY--ILDDDECPLSILMNHPTSRGSIMFHVRRRPADSQPRRRKKKPLG---------AANGANNISQDREGPMLVEVTHSGDGGRRIKLGSDPIEVGSANTNCLQLFGPSIQARHCLISLVEGVCTVTPLHADALTFVNGHHISQPTILHNGSVVMF-GRVASYRFV-DSPTDGRYNLALSQSQ-LDSACLYERSPKMPLSSTSAAAHIEPQGQEPILPAVLEFPETHQELFLRHIITELDVNAPHFKLAPVYSLYLCAR--YRASTHYRPELQPTERAHKLTIFLHHVANLIYNVVQEQYTDPRILAFWMANSSEFLHFLKSDRHISAFSV----QAQEVLAESVQTAFRNLVNCFRVELSQTLNQFLSETIDHDSAA---------------GLVLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSHMCTGEWGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKTSVEEIQQLACSCFRLNSLQMAALLQ-------QEKIPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVR-GIPSGLVDFLNPLQQQ 857          
BLAST of Afadin vs. TrEMBL
Match: A0A4S2KFE7 (Afadin (Fragment) OS=Temnothorax longispinosus OX=300112 GN=DBV15_10157 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 2.943e-70
Identity = 263/936 (28.10%), Postives = 432/936 (46.15%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRRIRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPT--------KSTKQXXXXXXXXXXXXXX-----------XRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPP----SSDSPV-PLLKRVESEKKPLPT---------YEESVSAL----RSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDSSYNTDSYESRNIPSVETPEQENDDVVIISDLDSHLSRH-------LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELV--IGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCF----QCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKE--------------WCFYKISHQD 2727
            +I QWN++RL+LF++S+P+++L+F GVMRF+F+ +  K  +KC+RV+SD   + ++  L+EKF       S  ++ L+E   +  ++ LD E+ PLL+QL W  DD+EG F+ K         RI  +T    +G  +   S   R L K               KS +Q   +                     +R+ISNPE++MR +R+ KLE +L+Q  SK G  + GGTLKIYG++L   +PYK+LLLS+ D+A  VVRE+L KYG++  +   + LV  V  +        E IL + + PL  L+      G I F V + PA+             P   K     K N +++R  D +          F   L+PD S+  NG+  +    P      S+ P+ P   + ++   P PT         + E++  L    R     ++N   +   I   G+   F     ++    +   + E R    +   +  N  +    D  S   R        LP  + + +  E+  L +++ D++PS  +FKLA  Y L+L      R +   +  +   E    + + +  VA+ I++ I +     S  ++WLAN +E LH+LK++  +  F++    +  D+ AD     F    +C++   T  M   ++                     A +P   + +++  S+ M++L++C VN AL IQ+ S +FH IN   FN+ +       R + R +  R+  +  W+ER  L LA+ C+    +QA  LL   K + E     +     +NS+Q+R LL  Y  + +EP++P   I+ VV  A  VAD +   +G +I L+ +  L L LLLPEDGY  + +  GVP G  E+L  L ++              W  Y I H +
Sbjct:  153 VIQQWNANRLDLFELSEPNEDLEFHGVMRFYFQDSGQKVATKCIRVASDATSQAVIETLIEKFRPDMRMLSVPEYALYEIHENGEERKLDLEEKPLLVQLNWHIDDREGRFLLK---------RIDDKTNAQGVGFISAEGSSFRRKLSKREKKQIKKQEKLSRLKSLEQDENAAPGDPNGVAEKLYTELPETSFTRSISNPEAVMRRRRQQKLERRLQQFRSKDGGPDTGGTLKIYGEALCKDVPYKTLLLSVRDSAAQVVREMLSKYGLDKVDPQLYCLVQ-VNSENVGGNAHQEYILDDDECPLAILMNHPSTRGSIMFHVRRRPADY-----------MPRKRKKKPAGKWNELDHRYEDERL--------PFLLELNPDGSDIPNGAGVRHRLQPNVTEVGSERPIGPQAVQAQTLTLPGPTVMPRHCVIAFTENIVTLTPCSRDAHTYVNNQRIHQTTILQNGAIIKFGRMHTFR----FIDPAPEER----IRQRQDSNKQIDYAYDRHSQYDRQPRGTDPILPAVLEFLEETEETFLHAVITDVEPSAPQFKLAPTYTLYLSAR--YRASTHYKPELQPTERAHRLTVMLANVATMIQRVIQERYMDASSLAFWLANGSELLHMLKSDRHVGAFST----RAQDILADAVHTAFGSLVRCVTLELTPAMTQFMA--------------------DADEPAKEAGVLQIFSNTMALLRRCRVNAALTIQLFSHLFHAINATAFNTLVSNGNLCVRWFGRRLKARLNALETWAERQGLELASQCHLATIMQATHLLQAPKYNAEELATLSSTCFKLNSLQVRALLQKYQPAADEPRLPAELIENVVRVAESVADTLARADGREIRLEEEPVLGLALLLPEDGYSCEVIR-GVPPGLAEFLAPLQRDGLCRMAAQPTSSGYWTIYMIDHHN 1024          
BLAST of Afadin vs. TrEMBL
Match: A0A1J1HL25 (CLUMA_CG000755, isoform E OS=Clunio marinus OX=568069 GN=putative Afadin PE=4 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 3.443e-70
Identity = 254/898 (28.29%), Postives = 424/898 (47.22%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFK--------------SNLKNKNSRRIRSQTRKDKIGSTTCLNSPTT--RCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQ-----EDSSYN-------TDS---YESR---------NIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELV--IGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYL 2679
            +I QWN++RL+LF++S+P++NL+F GVMRF+F+    K  +KC+RV+SD  V D++  L+EKF       S  ++ L+E  ++  ++ L+P++ PLL+QL W  DD+EG F+ K              +N K K S+R + + +K +       N   +     +K+ T+ P  S                 +R+ISNPE++MR +R+ KLE+KL+Q  ++ G  + GGTLKIYG+SL   +PYK+LLLSI D A+ VVRE+L KYGM+  +   + LV       N+   EY  IL + + PL  L+    + G I F V + PA  +   + + +         I+    N    R   V     ++ DG  +  L  +     + + N +    PS      L+   E      P + + ++ +    +           I + GS   F  ++ Y+      D  YN        DS   YE+R          + +  T E +  + +            LP  + + +  ++  L  ++ ++  +   FKLA  Y L+L      R +   R  +   E    + +F+  VA+ I   I +      I S+W+AN +EFLH LK++  +S F+     +  ++ A+  Q  FQ +   F  ++  TL+  L+EN D                     +++  L S M++L++C VN AL IQ+ S++FH IN   FN F+ T       W + + +R+  +  W+E+  L LAADC+  +  Q  + L   KT++            +NS+Q+  LL       ++  +P+  ID  V  A  VAD++   +G +I L+    L L LLLP DG+  D +  G+P G +++L
Sbjct:   19 VIQQWNANRLDLFELSEPNENLEFHGVMRFYFQDVGQKVATKCIRVASDATVADVIETLIEKFRPDMRMLSVPNYALYEVHANGEERKLNPDEKPLLVQLNWHVDDREGRFLLKDLDQKPTTLDNNTDTNFKRKLSKREKKEQKKKEKLQKLNPNGEDSENHVAEKLYTELPETS----------------FTRSISNPEAVMRRRRQQKLEKKLQQFRARDGGPDTGGTLKIYGESLCRDVPYKTLLLSIRDCAQAVVREMLAKYGMDKADPLHYCLVQV-----NSDGSEY--ILDDDECPLSILMNHPTSRGSIMFHVRRRPAADTSQPRRRKKKPL-----GISNGSGNMSAEREGPVLIEITHSGDGGRRLKLTTEPVEVGSANTNALQLFGPSIQPRHCLISLHEGVCTVTPLHADGLTFVNGHHI-------TQPTILHNGSVVMFGRAASYRFVDVPSDGRYNLALSQSQLDSAYLYENRPQSFAKPPAGMSATPTMEPQGQEAI------------LPAVLEFPEHHQEQFLKQVISELDVNSPNFKLAPVYTLYLCAR--YRASTHYRPDLQPTERAHKLTVFLHHVANLIHNVIQEKYNDPKILSFWMANSSEFLHFLKSDRHISAFSV----QAQEVLAECVQTAFQNLVSIFHSELSQTLNQFLSENIDHDSAA---------------GLVLSVLGSAMALLRRCRVNAALTIQLFSQLFHYINVVCFNKFVTTSHMCTSTWGKALSDRLSLLELWAEKQGLELAADCHLAKINQCAEFLQAPKTNVTEVQQLACSCFRLNSLQMAALL-------SQETIPRTLIDATVRMAESVADELTRADGREIRLEESPDLPLALLLPVDGFSCD-VVRGIPAGLVDFL 840          
BLAST of Afadin vs. TrEMBL
Match: A0A1J1HG24 (CLUMA_CG000755, isoform C OS=Clunio marinus OX=568069 GN=putative Afadin PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 3.658e-70
Identity = 254/898 (28.29%), Postives = 424/898 (47.22%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFK--------------SNLKNKNSRRIRSQTRKDKIGSTTCLNSPTT--RCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQ-----EDSSYN-------TDS---YESR---------NIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELV--IGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYL 2679
            +I QWN++RL+LF++S+P++NL+F GVMRF+F+    K  +KC+RV+SD  V D++  L+EKF       S  ++ L+E  ++  ++ L+P++ PLL+QL W  DD+EG F+ K              +N K K S+R + + +K +       N   +     +K+ T+ P  S                 +R+ISNPE++MR +R+ KLE+KL+Q  ++ G  + GGTLKIYG+SL   +PYK+LLLSI D A+ VVRE+L KYGM+  +   + LV       N+   EY  IL + + PL  L+    + G I F V + PA  +   + + +         I+    N    R   V     ++ DG  +  L  +     + + N +    PS      L+   E      P + + ++ +    +           I + GS   F  ++ Y+      D  YN        DS   YE+R          + +  T E +  + +            LP  + + +  ++  L  ++ ++  +   FKLA  Y L+L      R +   R  +   E    + +F+  VA+ I   I +      I S+W+AN +EFLH LK++  +S F+     +  ++ A+  Q  FQ +   F  ++  TL+  L+EN D                     +++  L S M++L++C VN AL IQ+ S++FH IN   FN F+ T       W + + +R+  +  W+E+  L LAADC+  +  Q  + L   KT++            +NS+Q+  LL       ++  +P+  ID  V  A  VAD++   +G +I L+    L L LLLP DG+  D +  G+P G +++L
Sbjct:   19 VIQQWNANRLDLFELSEPNENLEFHGVMRFYFQDVGQKVATKCIRVASDATVADVIETLIEKFRPDMRMLSVPNYALYEVHANGEERKLNPDEKPLLVQLNWHVDDREGRFLLKDLDQKPTTLDNNTDTNFKRKLSKREKKEQKKKEKLQKLNPNGEDSENHVAEKLYTELPETS----------------FTRSISNPEAVMRRRRQQKLEKKLQQFRARDGGPDTGGTLKIYGESLCRDVPYKTLLLSIRDCAQAVVREMLAKYGMDKADPLHYCLVQV-----NSDGSEY--ILDDDECPLSILMNHPTSRGSIMFHVRRRPAADTSQPRRRKKKPL-----GISNGSGNMSAEREGPVLIEITHSGDGGRRLKLTTEPVEVGSANTNALQLFGPSIQPRHCLISLHEGVCTVTPLHADGLTFVNGHHI-------TQPTILHNGSVVMFGRAASYRFVDVPSDGRYNLALSQSQLDSAYLYENRPQSFAKPPAGMSATPTMEPQGQEAI------------LPAVLEFPEHHQEQFLKQVISELDVNSPNFKLAPVYTLYLCAR--YRASTHYRPDLQPTERAHKLTVFLHHVANLIHNVIQEKYNDPKILSFWMANSSEFLHFLKSDRHISAFSV----QAQEVLAECVQTAFQNLVSIFHSELSQTLNQFLSENIDHDSAA---------------GLVLSVLGSAMALLRRCRVNAALTIQLFSQLFHYINVVCFNKFVTTSHMCTSTWGKALSDRLSLLELWAEKQGLELAADCHLAKINQCAEFLQAPKTNVTEVQQLACSCFRLNSLQMAALL-------SQETIPRTLIDATVRMAESVADELTRADGREIRLEESPDLPLALLLPVDGFSCD-VVRGIPAGLVDFL 840          
BLAST of Afadin vs. Ensembl Cavefish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 160.999 bits (406), Expect = 3.684e-39
Identity = 117/378 (30.95%), Postives = 191/378 (50.53%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL 2688
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      D+ N +   L    DD EE++  P   K  D      ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +       C  +  W  I+  ++  I  W+E+  L LAADC+  + +QA  LL M+K  ++   N       +NS+QL  L+ NY  +P+EP +P   ID VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P GF E+LE L
Sbjct:  573 LPASIEFRENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL----DDPEEQN--PQRPKIED------VLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTESDSGLCSHY--WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSVQDVQNINNTCFKLNSLQLNALMSNYHCAPDEPYIPHELIDHVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGFQEFLEPL 931          

HSP 2 Score: 150.599 bits (379), Expect = 5.920e-36
Identity = 116/354 (32.77%), Postives = 181/354 (51.13%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEG--VFVFKSNLKNKNSRRIRSQTRKDKI-----------------------------GSTTCLNSPT--TRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKT 1071
            +IN WN++RL+LF+ISQP + L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S  ++ LD ++ PL++QL W KDD+EG  V   ++++  K ++    +  K+ +                             G    LN     +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++  S  G  + GGTL+IY DSL P IPYK++LLS  DTA+F V E L+KYG+E EN  ++ +   V+ D    K   E IL +++ PL+       +   + F++ K P +    K  K+
Sbjct:   15 IINHWNANRLDLFEISQPTEELEFHGVMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKDDREGRFVLKNENDIIPKKAQSNGPEKEKEGVIQNFKRTLSKKEKKKEKKKDKEAFARIPDGDDHALNREDGDSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSGDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPREYCIARVVHSDDKPVK---ETILDDTECPLQIFRDWTSDKEALVFQLKKRPPDYIAKKGRKS 349          
BLAST of Afadin vs. Ensembl Cavefish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 160.999 bits (406), Expect = 3.684e-39
Identity = 117/378 (30.95%), Postives = 191/378 (50.53%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL 2688
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      D+ N +   L    DD EE++  P   K  D      ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +       C  +  W  I+  ++  I  W+E+  L LAADC+  + +QA  LL M+K  ++   N       +NS+QL  L+ NY  +P+EP +P   ID VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P GF E+LE L
Sbjct:  573 LPASIEFRENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL----DDPEEQN--PQRPKIED------VLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTESDSGLCSHY--WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSVQDVQNINNTCFKLNSLQLNALMSNYHCAPDEPYIPHELIDHVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGFQEFLEPL 931          

HSP 2 Score: 150.599 bits (379), Expect = 5.920e-36
Identity = 116/354 (32.77%), Postives = 181/354 (51.13%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEG--VFVFKSNLKNKNSRRIRSQTRKDKI-----------------------------GSTTCLNSPT--TRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKT 1071
            +IN WN++RL+LF+ISQP + L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S  ++ LD ++ PL++QL W KDD+EG  V   ++++  K ++    +  K+ +                             G    LN     +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++  S  G  + GGTL+IY DSL P IPYK++LLS  DTA+F V E L+KYG+E EN  ++ +   V+ D    K   E IL +++ PL+       +   + F++ K P +    K  K+
Sbjct:   15 IINHWNANRLDLFEISQPTEELEFHGVMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKDDREGRFVLKNENDIIPKKAQSNGPEKEKEGVIQNFKRTLSKKEKKKEKKKDKEAFARIPDGDDHALNREDGDSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSGDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPREYCIARVVHSDDKPVK---ETILDDTECPLQIFRDWTSDKEALVFQLKKRPPDYIAKKGRKS 349          
BLAST of Afadin vs. Ensembl Cavefish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 160.614 bits (405), Expect = 4.094e-39
Identity = 117/378 (30.95%), Postives = 191/378 (50.53%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL 2688
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      D+ N +   L    DD EE++  P   K  D      ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +       C  +  W  I+  ++  I  W+E+  L LAADC+  + +QA  LL M+K  ++   N       +NS+QL  L+ NY  +P+EP +P   ID VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P GF E+LE L
Sbjct:  558 LPASIEFRENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL----DDPEEQN--PQRPKIED------VLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTESDSGLCSHY--WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSVQDVQNINNTCFKLNSLQLNALMSNYHCAPDEPYIPHELIDHVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGFQEFLEPL 916          

HSP 2 Score: 150.599 bits (379), Expect = 5.946e-36
Identity = 116/354 (32.77%), Postives = 181/354 (51.13%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEG--VFVFKSNLKNKNSRRIRSQTRKDKI-----------------------------GSTTCLNSPT--TRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKT 1071
            +IN WN++RL+LF+ISQP + L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S  ++ LD ++ PL++QL W KDD+EG  V   ++++  K ++    +  K+ +                             G    LN     +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++  S  G  + GGTL+IY DSL P IPYK++LLS  DTA+F V E L+KYG+E EN  ++ +   V+ D    K   E IL +++ PL+       +   + F++ K P +    K  K+
Sbjct:   15 IINHWNANRLDLFEISQPTEELEFHGVMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKDDREGRFVLKNENDIIPKKAQSNGPEKEKEGVIQNFKRTLSKKEKKKEKKKDKEAFARIPDGDDHALNREDGDSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSGDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPREYCIARVVHSDDKPVK---ETILDDTECPLQIFRDWTSDKEALVFQLKKRPPDYIAKKGRKS 349          
BLAST of Afadin vs. Ensembl Cavefish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 160.229 bits (404), Expect = 5.495e-39
Identity = 118/353 (33.43%), Postives = 182/353 (51.56%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKS--NLKNKNSRRIRSQTRKDKI-----------------------------GSTTCLNSPT--TRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKT 1071
            +IN WN++RL+LF+ISQP + L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W KDD+EG FV K+  ++  K ++    +  K+ +                             G    LN     +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++  S  G  + GGTL+IY DSL P IPYK++LLS  DTA+F V E L+KYG+E EN  ++ +   V+ D    K   E IL +++ PL+       +   + F++ K P +    K  K+
Sbjct:   15 IINHWNANRLDLFEISQPTEELEFHGVMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERKLDLDEKPLVVQLNWNKDDREGRFVLKNENDIIPKKAQSNGPEKEKEGVIQNFKRTLSKKEKKKEKKKDKEAFARIPDGDDHALNREDGDSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSGDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPREYCIARVVHSDDKPVK---ETILDDTECPLQIFRDWTSDKEALVFQLKKRPPDYIAKKGRKS 348          

HSP 2 Score: 160.229 bits (404), Expect = 6.137e-39
Identity = 117/378 (30.95%), Postives = 191/378 (50.53%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL 2688
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      D+ N +   L    DD EE++  P   K  D      ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +       C  +  W  I+  ++  I  W+E+  L LAADC+  + +QA  LL M+K  ++   N       +NS+QL  L+ NY  +P+EP +P   ID VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P GF E+LE L
Sbjct:  568 LPASIEFRENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL----DDPEEQN--PQRPKIED------VLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTESDSGLCSHY--WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSVQDVQNINNTCFKLNSLQLNALMSNYHCAPDEPYIPHELIDHVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGFQEFLEPL 926          
BLAST of Afadin vs. Ensembl Cavefish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 157.918 bits (398), Expect = 3.403e-38
Identity = 117/353 (33.14%), Postives = 182/353 (51.56%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVF--KSNLKNKNSRRIRSQTRKDKI-----------------------------GSTTCLNSPT--TRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQI-SKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKT 1071
            +IN WN++RL+LF+ISQP + L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S ++ LD ++ PL++QL W KDD+EG FV   ++++  K ++    +  K+ +                             G    LN     +R   +V  D P  S                 +RTISNPE +M+ +R+ KLE+++++  S  G  + GGTL+IY DSL P IPYK++LLS  DTA+F V E L+KYG+E EN  ++ +   V+ D    K   E IL +++ PL+       +   + F++ K P +    K  K+
Sbjct:   15 IINHWNANRLDLFEISQPTEELEFHGVMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERKLDLDEKPLVVQLNWNKDDREGRFVLKNENDIIPKKAQSNGPEKEKEGVIQNFKRTLSKKEKKKEKKKDKEAFARIPDGDDHALNREDGDSRLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKLEKRMQEFRSGDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPREYCIARVVHSDDKPVK---ETILDDTECPLQIFRDWTSDKEALVFQLKKRPPDYIAKKGRKS 348          

HSP 2 Score: 156.762 bits (395), Expect = 7.744e-38
Identity = 120/387 (31.01%), Postives = 192/387 (49.61%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMV---------VDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL 2688
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++            DI      ++   +  ++V    +E V  +I     + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      D+ N +   L    DD EE++  P   K  D      ++ TL+  MS+L++C VN AL IQ+ S++FH IN W+FN  +       C  +  W  I+  ++  I  W+E+  L LAADC+  + +QA  LL M+K  ++   N       +NS+QL  L+ NY  +P+EP +P   ID VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P GF E+LE L
Sbjct:  572 LPASIEFRENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMV--SMMEGVIQEIADGDQKQKNIAGALAFWMANASELLNFIKQDKDLSR----ITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL----DDPEEQN--PQRPKIED------VLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTESDSGLCSHY--WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSVQDVQNINNTCFKLNSLQLNALMSNYHCAPDEPYIPHELIDHVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NIPNGFQEFLEPL 937          
BLAST of Afadin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009066.1 (pep scaffold:Pmarinus_7.0:GL479913:2065:18580:1 gene:ENSPMAG00000008193.1 transcript:ENSPMAT00000009066.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 5.759e-29
Identity = 104/382 (27.23%), Postives = 174/382 (45.55%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILL---DIKPSQTKFKLASAYLLH----LMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSF---IDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLE 2682
            LPV +      E+  LD++     DI PS   F L  AY ++     ++      +  ++     +   I    E  AS+I  ++      + +  +W+AN +E LH L+ +  L            ++ +      F  +      ++   L V L +           P +  A  P+ +  ++  L+  MS+L+    NPAL++QI +R+F LI  W+FNS    +D   R  R WA  +  R+  + RW+E   L  AA C+    +QA +LL M K ++       V    +NS+Q+R LL+ Y Y+P+EPK+PQ  I+ VVS      D V+  +  ++       L LP L+P DGY  + L   +P G  ++L+
Sbjct:  219 LPVYVEVSSIAEEEFLDAVTSTPSDIPPS---FSLGPAYTIYSACRFLLSSQGSCSLPSQQQQRRRHQHIAYLTEGAASRIEGTVQASGRDMMVSGFWMANTSELLHFLEQDGDLRPLTL----PAQEMLSSAVHTAFSNLVECLKTELSVRLPVFLQD-----------PQTLTAGAPQ-IGPVLSLLTEVMSMLRTFKTNPALLVQIFARVFTLIAGWLFNSLLSDVDLGLR-SRYWATTLQRRLLPLARWAEGQGLERAAACHLAHIVQATELLTMRKYEVSDVREILVTCYRLNSLQMRALLETYQYAPDEPKIPQEVIEQVVSVTRDTTDAVWLSQQQEVSRLESLELRLPFLVPGDGYACEGL-AAIPAGLHQFLQ 579          
BLAST of Afadin vs. Ensembl Nematostella
Match: EDO32442 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV26])

HSP 1 Score: 158.303 bits (399), Expect = 4.785e-39
Identity = 120/378 (31.75%), Postives = 195/378 (51.59%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELV--IGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIF--RGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKL 2688
            LP  + + +S ED    +++ ++      FKLA  Y L++      R++   R  ++ Q+    +G+ I K+A+  R +I ++  +    ++W+ANC+E LH +K +I +S +          + A + Q  F+ +      ++ N+L   L+++ D   E  D   +R       +S +I  LSS MS+L++C VN AL IQ+ S++FH IN W+FN  +  P      R W R I  R+ R+  W+ R  L LAADC+  +  QA  LL   K+        +     +NS+Q+R LL +Y  + +E  + Q +ID VV+ A   AD+   + G +I L+    L LP LLPEDGY  + +  GVP G  E+LE L
Sbjct:  576 LPATLEFRESGEDAFFAAVISEVNGLAVHFKLAPTYTLYM--CSRYRMSSAYRPELMPQQKAERLGVTIMKIANMARSTIRENSHMPGSLAFWMANCSELLHFIKEDIDISPYTKD----SQSVLAKSVQLAFRHLVLCIQHELRNSLPAFLDQSDDADVEDSDMEANRP-----TVSEVIYHLSSTMSLLRRCRVNAALTIQVFSQLFHFINMWLFNKLVLEPKLGLCSREWGRRISKRLRRVEDWALRQGLELAADCHLGRIEQAAYLLQAPKSSPADINAISSSCFKLNSVQMRTLLQSYRPTQDE-YLSQEFIDRVVAIAEDTADQTAYKSGQEITLEEDPELQLPFLLPEDGYSCEVIR-GVPQGLREFLEPL 940          

HSP 2 Score: 137.502 bits (345), Expect = 1.243e-32
Identity = 115/355 (32.39%), Postives = 186/355 (52.39%), Query Frame = 1
Query:  112 ILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFE-TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSN----LKNKNSRRIRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQN---TQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSK------KSKTQGTFPDVC--KSIAIRKSNSV 1128
            +L LI +WN+SRL++F IS+P ++L++ GVMRFFF+ +  K  +KC+R+SS     D+  IL++KF+      +   + L+E   +    L   D PL IQL W  DD+EG F+ KS+    +  KN           +  S         +  ++       K     ++        +  +R+ISNPE++MR +R+ KLE+KLK+  +S     GGTLKI+ ++L P IPYK+LL+S+D+    +V+E L KY ME E+  ++ LV      +    +  +  E ++ + D PLR  +   +N G + F + +  AN+ K +      KS T+    DV   KS+A R + S 
Sbjct:   14 LLKLIEEWNASRLDIFAISEPTEDLEYRGVMRFFFQDSGSKVATKCVRISSKDNTDDVTKILVDKFHPDMKMLTNPSYSLYEVHPNGAHKLKATDHPLRIQLEWQLDDREGRFLLKSDQDKIVHAKNLFEGEQNQNLKRRLSKREKKQMKKKREEEAKKVKAGKDDTAIAQHLYDELPETSFTRSISNPEAVMRRRRQQKLEKKLKEF-ESRESAPGGTLKIFAETLKPEIPYKTLLVSVDEITTNIVKEALVKYNMEKEDPEEYCLVMVNIPPEGSNTSATLGKERVVHDEDCPLRIAVTWPENRGSVAFHLRRR-ANLPKYRRDKRRSKSPTRSPMQDVSPDKSVAERLAKST 366          
BLAST of Afadin vs. Ensembl Medaka
Match: afdna (afadin, adherens junction formation factor [Source:NCBI gene;Acc:101169758])

HSP 1 Score: 159.073 bits (401), Expect = 1.328e-38
Identity = 121/358 (33.80%), Postives = 183/358 (51.12%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFK--SNLKNKNSRRIRSQTRKDKI----------------------------------GSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQ-ISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQ 1074
            +IN WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S  ++ LD ++ PL++QL W KDD+EG FV K  +++  K S+    +  KD +                                  G     NS   R   +V  D P  S                 +RTISNPE +M+ +R+ K+E++++  I+  G  + GGTL+IY DSL P IPYK+LL S+ DTA+ VV E L+KYG+E EN  +F +       +  +K   E IL +S+ PL+ L     + G + F++ K P +    K  K +
Sbjct:   15 IINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERQLDLDEKPLVVQLNWNKDDREGRFVLKNENDVPPKKSQSNGPEREKDGVIQNFKRTLSKKEKKKEKKREKEFIRMPDEDERTLGREDGENS---RLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKVEKRMQDFINNDGRPDSGGTLRIYADSLKPNIPYKTLLCSVRDTADLVVVEALEKYGLEKENPREFCIA------RQEEKTGKEVILDDSECPLQILRDWPADRGVLVFQLKKKPPDYQGRKGRKME 347          

HSP 2 Score: 147.132 bits (370), Expect = 5.705e-35
Identity = 123/394 (31.22%), Postives = 192/394 (48.73%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQEL---VIGM------FIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP-----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEK-LHKEWC 2703
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    +  L+   R  +   E    VI +       +E V   +R+   + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      D+ N +   L    DD EE +  P S K  D      ++ TLS  MS+L++C VN AL IQ+ S++FH IN W+FN  +        C     W  I+  ++  I  W+E+  L LAADC+  + +QA  LL M K   E   N       +NS+QL  LL NY  +  EP +P   I+ VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  ++LE  L +++C
Sbjct:  560 LPASIEFRENSEDTFLSAIINYTNSSTVHFKLSPTYVLYMACRFV--LSPAYRPDISPSERTHKVIAIVNKMVSMMEGVIQDMREGDQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDILAHLVQMAFKYLVHCLQADLNNYMPAFL----DDPEEHN--PQSPKIED------VLHTLSGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTDADSGLCCHY---WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMNKYSKEDVQNIHSTCFKLNSLQLHALLTNYHCAQGEPYIPPELINEVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NLPNGLQDFLEPLLQRDFC 931          
BLAST of Afadin vs. Ensembl Medaka
Match: afdna (afadin, adherens junction formation factor [Source:NCBI gene;Acc:101169758])

HSP 1 Score: 158.688 bits (400), Expect = 1.449e-38
Identity = 121/358 (33.80%), Postives = 183/358 (51.12%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFK--SNLKNKNSRRIRSQTRKDKI----------------------------------GSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQ-ISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQ 1074
            +IN WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S  ++ LD ++ PL++QL W KDD+EG FV K  +++  K S+    +  KD +                                  G     NS   R   +V  D P  S                 +RTISNPE +M+ +R+ K+E++++  I+  G  + GGTL+IY DSL P IPYK+LL S+ DTA+ VV E L+KYG+E EN  +F +       +  +K   E IL +S+ PL+ L     + G + F++ K P +    K  K +
Sbjct:   15 IINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERQLDLDEKPLVVQLNWNKDDREGRFVLKNENDVPPKKSQSNGPEREKDGVIQNFKRTLSKKEKKKEKKREKEFIRMPDEDERTLGREDGENS---RLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKVEKRMQDFINNDGRPDSGGTLRIYADSLKPNIPYKTLLCSVRDTADLVVVEALEKYGLEKENPREFCIA------RQEEKTGKEVILDDSECPLQILRDWPADRGVLVFQLKKKPPDYQGRKGRKME 347          

HSP 2 Score: 147.132 bits (370), Expect = 5.770e-35
Identity = 123/394 (31.22%), Postives = 192/394 (48.73%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQEL---VIGM------FIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP-----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEK-LHKEWC 2703
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    +  L+   R  +   E    VI +       +E V   +R+   + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      D+ N +   L    DD EE +  P S K  D      ++ TLS  MS+L++C VN AL IQ+ S++FH IN W+FN  +        C     W  I+  ++  I  W+E+  L LAADC+  + +QA  LL M K   E   N       +NS+QL  LL NY  +  EP +P   I+ VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  ++LE  L +++C
Sbjct:  545 LPASIEFRENSEDTFLSAIINYTNSSTVHFKLSPTYVLYMACRFV--LSPAYRPDISPSERTHKVIAIVNKMVSMMEGVIQDMREGDQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDILAHLVQMAFKYLVHCLQADLNNYMPAFL----DDPEEHN--PQSPKIED------VLHTLSGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTDADSGLCCHY---WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMNKYSKEDVQNIHSTCFKLNSLQLHALLTNYHCAQGEPYIPPELINEVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NLPNGLQDFLEPLLQRDFC 916          
BLAST of Afadin vs. Ensembl Medaka
Match: afdna (afadin, adherens junction formation factor [Source:NCBI gene;Acc:101169758])

HSP 1 Score: 158.688 bits (400), Expect = 1.517e-38
Identity = 121/358 (33.80%), Postives = 183/358 (51.12%), Query Frame = 1
Query:  121 LINQWNSSRLELFKISQPDKNLKFFGVMRFFFE--TEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFE-RSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFK--SNLKNKNSRRIRSQTRKDKI----------------------------------GSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQ-ISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQ 1074
            +IN WN++RL+LF+ISQP ++L+F GVMRF+F+      F +KC+RVSS    +D++  L EKF       S   + L+E   S  ++ LD ++ PL++QL W KDD+EG FV K  +++  K S+    +  KD +                                  G     NS   R   +V  D P  S                 +RTISNPE +M+ +R+ K+E++++  I+  G  + GGTL+IY DSL P IPYK+LL S+ DTA+ VV E L+KYG+E EN  +F +       +  +K   E IL +S+ PL+ L     + G + F++ K P +    K  K +
Sbjct:   15 IINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERQLDLDEKPLVVQLNWNKDDREGRFVLKNENDVPPKKSQSNGPEREKDGVIQNFKRTLSKKEKKKEKKREKEFIRMPDEDERTLGREDGENS---RLAAEVYKDMPETS----------------FTRTISNPEVVMKRRRQQKVEKRMQDFINNDGRPDSGGTLRIYADSLKPNIPYKTLLCSVRDTADLVVVEALEKYGLEKENPREFCIA------RQEEKTGKEVILDDSECPLQILRDWPADRGVLVFQLKKKPPDYQGRKGRKME 347          

HSP 2 Score: 149.058 bits (375), Expect = 1.595e-35
Identity = 118/385 (30.65%), Postives = 189/385 (49.09%), Query Frame = 1
Query: 1567 LPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTP-----CRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEK-LHKEWC 2703
            LP  I + ++ ED  L +I+     S   FKL+  Y+L++    ++        +  ++   +   + K+ S +   I + + I    ++W+AN +E L+ +K +  LS+    I     D+ A   Q  F+ +      D+ N +   L    DD EE +  P S K  D      ++ TLS  MS+L++C VN AL IQ+ S++FH IN W+FN  +        C     W  I+  ++  I  W+E+  L LAADC+  + +QA  LL M K   E   N       +NS+QL  LL NY  +  EP +P   I+ VV+ A   AD++   +G ++ L+    L LP LLPEDGY  D +   +P G  ++LE  L +++C
Sbjct:  560 LPASIEFRENSEDTFLSAIINYTNSSTVHFKLSPTYVLYMACRFVLSPAYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR----ITLDAQDILAHLVQMAFKYLVHCLQADLNNYMPAFL----DDPEEHN--PQSPKIED------VLHTLSGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTDADSGLCCHY---WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMNKYSKEDVQNIHSTCFKLNSLQLHALLTNYHCAQGEPYIPPELINEVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR-NLPNGLQDFLEPLLQRDFC 924          
BLAST of Afadin vs. Planmine SMEST
Match: SMESG000058689.1 (SMESG000058689.1)

HSP 1 Score: 2363.19 bits (6123), Expect = 0.000e+0
Identity = 1235/1243 (99.36%), Postives = 1239/1243 (99.68%), Query Frame = 1
Query:  103 MTTILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFETEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRRIRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDSSYNTDSYESRNIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLPFENCVKVEDNLNKSNSSNRHQLKLSDFKANVYYENLDTINNNESTGESGIDTYRNQSYQHSASRLDVNDNQCARKKIQCTDLPLNFTYDLYQNNCPKPFSDAGSTTAASLLSEIIDDDNPCNSHSKRHRVIKDLRKSLENSIEKTIVAQEQFQSVIRGTDEIYTKELIKRLDKLEKDKSEEIYKMNYQQFHRVQSTNLSLENLENKRQTDYIKQSERMKNICELESQMESIDKYSFLKSSTLPIRNSNSGSQPPASFVPASLALRNSLNYPPRLRPKPKIHSLSTTNRSHSAANXXXXXXXXXXXXXXPPRSLSNDRFYSRMSDGMENLTFQEKVQLFEFAISRSSH 3831
            MTTILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFETEDKFHSKCLRVSSDLKVKDLLP+LLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSR IRSQTRK KIGSTTCLNSPTTRCLDKVCTDPPTKSTKQFSKSPSLLSTPSFLSRTISNPESLMRLKRKSKLEEKLKQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDSSYNTDS+ESRNIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAY+LHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWARIILNRIERIRRWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICLKLKESLNLPLLLPEDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLPFENCVKVEDNLNKSNSSNRHQLKLSDFKANVYYENLDTINNNESTGESGIDTYRNQSYQHSASRLDVNDNQCARKKIQCTDLPLNFTYDLYQNNCPKPFSDAGSTTAASLLSEIIDDDNPCNSHSKRHRVIKDLRKSLE+SIEKTIVAQEQFQSVI GTDEIYTKELIKRLDKLEKDKSEEIYKMNYQQFHRVQSTNLSLENLENKRQTDYI QSERMKNICELESQMESIDKYSFLKSSTLPIRNSNSGSQPPASFVPASLALRNSLNYPPRLRPKPKIHSLSTTNRSHSAANISKSDSSFEISSRIPPRSLSNDRFYSRMSDGMENLTFQEKVQLFEFAISRSSH
Sbjct:    1 MTTILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFETEDKFHSKCLRVSSDLKVKDLLPVLLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRWIRSQTRKYKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQFSKSPSLLSTPSFLSRTISNPESLMRLKRKSKLEEKLKQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDSSYNTDSFESRNIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYVLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWARIILNRIERIRRWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVFEEEGIDICLKLKESLNLPLLLPEDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLPFENCVKVEDNLNKSNSSNRHQLKLSDFKANVYYENLDTINNNESTGESGIDTYRNQSYQHSASRLDVNDNQCARKKIQCTDLPLNFTYDLYQNNCPKPFSDAGSTTAASLLSEIIDDDNPCNSHSKRHRVIKDLRKSLEDSIEKTIVAQEQFQSVIHGTDEIYTKELIKRLDKLEKDKSEEIYKMNYQQFHRVQSTNLSLENLENKRQTDYIIQSERMKNICELESQMESIDKYSFLKSSTLPIRNSNSGSQPPASFVPASLALRNSLNYPPRLRPKPKIHSLSTTNRSHSAANISKSDSSFEISSRIPPRSLSNDRFYSRMSDGMENLTFQEKVQLFEFAISRSSH 1243          
BLAST of Afadin vs. Planmine SMEST
Match: SMESG000058689.1 (SMESG000058689.1)

HSP 1 Score: 1543.1 bits (3994), Expect = 0.000e+0
Identity = 805/812 (99.14%), Postives = 809/812 (99.63%), Query Frame = 1
Query:  103 MTTILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFETEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRRIRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDSSYNTDSYESRNIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVA 2538
            MTTILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFETEDKFHSKCLRVSSDLKVKDLLP+LLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSR IRSQTRK KIGSTTCLNSPTTRCLDKVCTDPPTKSTKQFSKSPSLLSTPSFLSRTISNPESLMRLKRKSKLEEKLKQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDSSYNTDS+ESRNIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAY+LHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWARIILNRIERIRRWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQ +
Sbjct:    1 MTTILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFETEDKFHSKCLRVSSDLKVKDLLPVLLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRWIRSQTRKYKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQFSKSPSLLSTPSFLSRTISNPESLMRLKRKSKLEEKLKQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDSSYNTDSFESRNIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYVLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWARIILNRIERIRRWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQAS 812          
BLAST of Afadin vs. Planmine SMEST
Match: SMESG000058689.1 (SMESG000058689.1)

HSP 1 Score: 1542.71 bits (3993), Expect = 0.000e+0
Identity = 806/811 (99.38%), Postives = 809/811 (99.75%), Query Frame = 1
Query:  103 MTTILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFETEDKFHSKCLRVSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRRIRSQTRKDKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQXXXXXXXXXXXXXXXRTISNPXXXXXXXXXXXXXXXXXQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDSSYNTDSYESRNIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWAXXXXXXXXXXXXWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQV 2535
            MTTILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFETEDKFHSKCLRVSSDLKVKDLLP+LLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSR IRSQTRK KIGSTTCLNSPTTRCLDKVCTDPPTKSTKQFSKSPSLLSTPSFLSRTISNPESLMRLKRKSKLEEKLKQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDSSYNTDS+ESRNIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAY+LHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWARIILNRIERIRRWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQV
Sbjct:    1 MTTILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFETEDKFHSKCLRVSSDLKVKDLLPVLLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRWIRSQTRKYKIGSTTCLNSPTTRCLDKVCTDPPTKSTKQFSKSPSLLSTPSFLSRTISNPESLMRLKRKSKLEEKLKQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQSHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESEKKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDSSYNTDSFESRNIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKEDMLLDSILLDIKPSQTKFKLASAYVLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDDFPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFIDTPCRIFRGWARIILNRIERIRRWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQV 811          
BLAST of Afadin vs. Planmine SMEST
Match: SMESG000058689.1 (SMESG000058689.1)

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 433/440 (98.41%), Postives = 435/440 (98.86%), Query Frame = 1
Query: 2512 VVSGANQVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLPFENCVKVEDNLNKSNSSNRHQLKLSDFKANVYYENLDTINNNESTGESGIDTYRNQSYQHSASRLDVNDNQCARKKIQCTDLPLNFTYDLYQNNCPKPFSDAGSTTAASLLSEIIDDDNPCNSHSKRHRVIKDLRKSLENSIEKTIVAQEQFQSVIRGTDEIYTKELIKRLDKLEKDKSEEIYKMNYQQFHRVQSTNLSLENLENKRQTDYIKQSERMKNICELESQMESIDKYSFLKSSTLPIRNSNSGSQPPASFVPASLALRNSLNYPPRLRPKPKIHSLSTTNRSHSAANXXXXXXXXXXXXXXPPRSLSNDRFYSRMSDGMENLTFQEKVQLFEFAISRSSH 3831
            V+S A  VADKVFEEEGIDICLKLKESLNLPLLLPEDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLPFENCVKVEDNLNKSNSSNRHQLKLSDFKANVYYENLDTINNNESTGESGIDTYRNQSYQHSASRLDVNDNQCARKKIQCTDLPLNFTYDLYQNNCPKPFSDAGSTTAASLLSEIIDDDNPCNSHSKRHRVIKDLRKSLE+SIEKTIVAQEQFQSVI GTDEIYTKELIKRLDKLEKDKSEEIYKMNYQQFHRVQSTNLSLENLENKRQTDYI QSERMKNICELESQMESIDKYSFLKSSTLPIRNSNSGSQPPASFVPASLALRNSLNYPPRLRPKPKIHSLSTTNRSHSAANISKSDSSFEISSRIPPRSLSNDRFYSRMSDGMENLTFQEKVQLFEFAISRSSH
Sbjct:  120 VLSVALHVADKVFEEEGIDICLKLKESLNLPLLLPEDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLPFENCVKVEDNLNKSNSSNRHQLKLSDFKANVYYENLDTINNNESTGESGIDTYRNQSYQHSASRLDVNDNQCARKKIQCTDLPLNFTYDLYQNNCPKPFSDAGSTTAASLLSEIIDDDNPCNSHSKRHRVIKDLRKSLEDSIEKTIVAQEQFQSVIHGTDEIYTKELIKRLDKLEKDKSEEIYKMNYQQFHRVQSTNLSLENLENKRQTDYIIQSERMKNICELESQMESIDKYSFLKSSTLPIRNSNSGSQPPASFVPASLALRNSLNYPPRLRPKPKIHSLSTTNRSHSAANISKSDSSFEISSRIPPRSLSNDRFYSRMSDGMENLTFQEKVQLFEFAISRSSH 559          
BLAST of Afadin vs. Planmine SMEST
Match: SMESG000058689.1 (SMESG000058689.1)

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 430/434 (99.08%), Postives = 432/434 (99.54%), Query Frame = 1
Query: 2530 QVADKVFEEEGIDICXXXXXXXXXXXXXXXDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLPFENCVKVEDNLNKSNSSNRHQLKLSDFKANVYYENLDTINNNESTGESGIDTYRNQSYQHSASRLDVNDNQCARKKIQCTDLPLNFTYDLYQNNCPKPFSDAGSTTAASLLSEIIDDDNPCNSHSKRHRVIKDLRKSLENSIEKTIVAQEQFQSVIRGTDEIYTKELIKRLDKLEKDKSEEIYKMNYQQFHRVQSTNLSLENLENKRQTDYIKQSERMKNICELESQMESIDKYSFLKSSTLPIRNSNSGSQPPASFVPASLALRNSLNYPPRLRPKPKIHSLSTTNRSHSAANXXXXXXXXXXXXXXPPRSLSNDRFYSRMSDGMENLTFQEKVQLFEFAISRSSH 3831
            +VADKVFEEEGIDICLKLKESLNLPLLLPEDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLPFENCVKVEDNLNKSNSSNRHQLKLSDFKANVYYENLDTINNNESTGESGIDTYRNQSYQHSASRLDVNDNQCARKKIQCTDLPLNFTYDLYQNNCPKPFSDAGSTTAASLLSEIIDDDNPCNSHSKRHRVIKDLRKSLE+SIEKTIVAQEQFQSVI GTDEIYTKELIKRLDKLEKDKSEEIYKMNYQQFHRVQSTNLSLENLENKRQTDYI QSERMKNICELESQMESIDKYSFLKSSTLPIRNSNSGSQPPASFVPASLALRNSLNYPPRLRPKPKIHSLSTTNRSHSAANISKSDSSFEISSRIPPRSLSNDRFYSRMSDGMENLTFQEKVQLFEFAISRSSH
Sbjct:    5 KVADKVFEEEGIDICLKLKESLNLPLLLPEDGYHVDSLYGGVPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLPFENCVKVEDNLNKSNSSNRHQLKLSDFKANVYYENLDTINNNESTGESGIDTYRNQSYQHSASRLDVNDNQCARKKIQCTDLPLNFTYDLYQNNCPKPFSDAGSTTAASLLSEIIDDDNPCNSHSKRHRVIKDLRKSLEDSIEKTIVAQEQFQSVIHGTDEIYTKELIKRLDKLEKDKSEEIYKMNYQQFHRVQSTNLSLENLENKRQTDYIIQSERMKNICELESQMESIDKYSFLKSSTLPIRNSNSGSQPPASFVPASLALRNSLNYPPRLRPKPKIHSLSTTNRSHSAANISKSDSSFEISSRIPPRSLSNDRFYSRMSDGMENLTFQEKVQLFEFAISRSSH 438          
The following BLAST results are available for this feature:
BLAST of Afadin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AFDN9.825e-3730.83afadin, adherens junction formation factor [Source... [more]
AFDN1.049e-3630.83afadin, adherens junction formation factor [Source... [more]
AFDN1.089e-3630.83afadin, adherens junction formation factor [Source... [more]
AFDN1.326e-3630.83afadin, adherens junction formation factor [Source... [more]
AFDN1.905e-3630.83afadin, adherens junction formation factor [Source... [more]
back to top
BLAST of Afadin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
afd-12.049e-2330.12AFaDin (Actin filament binding protein) homolog [... [more]
afd-12.247e-2331.21AFaDin (Actin filament binding protein) homolog [... [more]
afd-12.550e-2331.21AFaDin (Actin filament binding protein) homolog [... [more]
afd-12.639e-2330.12AFaDin (Actin filament binding protein) homolog [... [more]
afd-15.997e-1326.35AFaDin (Actin filament binding protein) homolog [... [more]
back to top
BLAST of Afadin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cno2.329e-7227.33gene:FBgn0259212 transcript:FBtr0334911[more]
cno1.349e-3834.86gene:FBgn0259212 transcript:FBtr0334912[more]
cno1.536e-3834.46gene:FBgn0259212 transcript:FBtr0299710[more]
cno1.590e-3834.46gene:FBgn0259212 transcript:FBtr0334913[more]
cno1.621e-3834.86gene:FBgn0259212 transcript:FBtr0300525[more]
back to top
BLAST of Afadin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
afdna8.829e-3933.62afadin, adherens junction formation factor a [Sour... [more]
afdna1.195e-3833.62afadin, adherens junction formation factor a [Sour... [more]
back to top
BLAST of Afadin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AFDN2.105e-3935.13afadin, adherens junction formation factor [Source... [more]
AFDN2.579e-3935.13afadin, adherens junction formation factor [Source... [more]
AFDN3.660e-3935.51afadin, adherens junction formation factor [Source... [more]
AFDN1.650e-3834.65afadin, adherens junction formation factor [Source... [more]
AFDN2.180e-3835.03afadin, adherens junction formation factor [Source... [more]
back to top
BLAST of Afadin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Afdn1.023e-3732.79afadin, adherens junction formation factor [Source... [more]
Afdn1.088e-3732.79afadin, adherens junction formation factor [Source... [more]
Afdn1.131e-3732.79afadin, adherens junction formation factor [Source... [more]
Afdn1.216e-3732.79afadin, adherens junction formation factor [Source... [more]
Afdn1.248e-3732.79afadin, adherens junction formation factor [Source... [more]
back to top
BLAST of Afadin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9QZQ1|AFAD_MOUSE7.156e-3732.79Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3[more]
sp|O35889|AFAD_RAT4.223e-3632.51Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 ... [more]
sp|P55196|AFAD_HUMAN5.038e-3630.83Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3[more]
back to top
BLAST of Afadin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0M8ZQR97.776e-7428.75Afadin OS=Melipona quadrifasciata OX=166423 GN=WN5... [more]
A0A1I8MFH08.231e-7128.73Uncharacterized protein OS=Musca domestica OX=7370... [more]
A0A4S2KFE72.943e-7028.10Afadin (Fragment) OS=Temnothorax longispinosus OX=... [more]
A0A1J1HL253.443e-7028.29CLUMA_CG000755, isoform E OS=Clunio marinus OX=568... [more]
A0A1J1HG243.658e-7028.29CLUMA_CG000755, isoform C OS=Clunio marinus OX=568... [more]
back to top
BLAST of Afadin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
afdna3.684e-3930.95afadin, adherens junction formation factor a [Sour... [more]
afdna3.684e-3930.95afadin, adherens junction formation factor a [Sour... [more]
afdna4.094e-3930.95afadin, adherens junction formation factor a [Sour... [more]
afdna5.495e-3933.43afadin, adherens junction formation factor a [Sour... [more]
afdna3.403e-3833.14afadin, adherens junction formation factor a [Sour... [more]
back to top
BLAST of Afadin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009066.15.759e-2927.23pep scaffold:Pmarinus_7.0:GL479913:2065:18580:1 ge... [more]
back to top
BLAST of Afadin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Afadin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO324424.785e-3931.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Afadin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
afdna1.328e-3833.80afadin, adherens junction formation factor [Source... [more]
afdna1.449e-3833.80afadin, adherens junction formation factor [Source... [more]
afdna1.517e-3833.80afadin, adherens junction formation factor [Source... [more]
back to top
BLAST of Afadin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058689.10.000e+099.36SMESG000058689.1[more]
SMESG000058689.10.000e+099.14SMESG000058689.1[more]
SMESG000058689.10.000e+099.38SMESG000058689.1[more]
SMESG000058689.10.000e+098.41SMESG000058689.1[more]
SMESG000058689.10.000e+099.08SMESG000058689.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019772 ID=SMED30019772|Name=Afadin|organism=Schmidtea mediterranea sexual|type=transcript|length=4202bp
AAATATTTTTTAATTTTTATAAATGGTTTTTTCTTAGTTTACATTTACAA
AATTATTTTTCACAAATTATCATAAAATGGTTTTTTATATTAATTTTACC
ATATGACTACCATCTTGCATTTAATCAATCAATGGAATTCTTCCAGATTG
GAATTATTCAAAATCAGTCAGCCTGATAAAAACTTGAAATTTTTTGGTGT
TATGCGATTTTTCTTCGAGACAGAAGATAAATTCCATTCCAAATGTTTGC
GTGTTTCAAGTGATTTGAAAGTAAAAGATTTATTGCCAATTTTATTGGAA
AAGTTTTACGTTTCTGATATTTGCTCTTCTAAGCAAGATTTTCGACTTTT
TGAGCGATCATCATCAATCGACAAATTATTGGATCCGGAAGATTTTCCTT
TGCTAATCCAGCTTTTTTGGTGTAAAGATGATAAAGAAGGAGTATTTGTG
TTTAAAAGCAATTTGAAGAATAAGAATTCTCGACGGATTCGTTCGCAAAC
TCGAAAAGATAAGATCGGTTCGACTACTTGTCTTAATTCTCCTACAACGC
GATGTCTCGATAAAGTGTGCACTGATCCTCCGACCAAATCAACGAAACAA
TTCTCGAAATCTCCAAGTCTATTGTCAACACCGAGCTTTTTGTCTCGAAC
TATCTCGAATCCTGAATCTCTCATGCGATTGAAGCGGAAGTCAAAGTTGG
AGGAGAAGTTGAAGCAAATATCAAAGAGTGGCAATTTGAATGGCGGTGGA
ACTCTGAAGATTTACGGTGACAGTCTCAATCCTTTAATTCCATATAAATC
TTTGTTATTATCTATTGATGACACCGCCGAATTTGTAGTGCGCGAGATTC
TGGATAAGTATGGCATGGAAAATGAAAATGAGAATGATTTTTCTCTAGTC
AGCTCTGTATATAAAGATCAAAATACTCAAAAAATTGAATACGAAGAAAT
TTTGCAAAATTCAGATTCCCCACTCAGATTTTTACTTCAATCAAATAAAA
ATGATGGATTTATTAAATTTAGGGTTGTAAAGATGCCTGCCAATATCTCA
AAATCAAAAAAAAGTAAAACTCAAGGCACATTTCCAGATGTCTGTAAAAG
CATTGCAATCAGGAAATCCAATTCTGTAAATTATCGAAATTCAGATGTCC
AATCTCATTCAAGAAATACTTGTGACGGAAAGTTTAAACATTCTCTTCAT
CCTGACTTCAGTAATAATTATAACGGGAGCAATAATAAAATATATTCCAC
TCCTCCTTCGTCTGATAGTCCAGTGCCATTGCTAAAAAGAGTTGAGTCAG
AGAAAAAACCTCTCCCTACTTATGAGGAATCGGTATCAGCGTTGCGCAGC
TGGCGAGTGAAAATTTCAAACTTTCCAGAAAATCATAAGCCTATTTCTTA
TAGGGGCAGTACGGAATCATTTTCTCTCTCGTCAGATTATCAAGAAGACT
CCTCTTATAACACTGATTCATATGAAAGTCGGAATATTCCAAGTGTCGAA
ACGCCCGAACAGGAAAATGATGATGTTGTGATAATATCTGATCTCGATTC
CCATCTGTCTCGACATCTGCCGGTGCAAATTACTTATTTTAAAAGTAAAG
AAGACATGTTGCTGGATTCTATTCTCCTGGACATCAAACCTTCACAAACA
AAATTCAAATTAGCATCTGCTTACCTATTGCACCTCATGGTGGTCGACAT
CATTCGACTGACTTGCATAAATAGAGCAACTGTGCTAGATCAAGAATTAG
TGATCGGTATGTTCATTGAAAAAGTCGCTTCAAAGATCCGACAATCTATA
ATGCAGCATCGCACCATCATATCTATACAGTCATATTGGTTGGCTAACTG
CACGGAATTCCTCCATCTTCTGAAAAACAATATCCTTCTCAGTCAATTCA
ACAGTTCGATTTTTGATAAATACTACGATCTGTTTGCTGATAATGCTCAG
TGGTGTTTCCAATGTATATCTTTCGGGTTTACCGATGACATGGTAAACAC
GCTCTCTGTGCTGTTGAATGAAAATACTGATGATTCTGAAGAAAAGGATG
ATTTTCCATTGTCAAGAAAAGCGTCTGATCCTAAAAATATGTCCATTTTA
ATCAGAACTTTGTCAAGTTGCATGTCAGTTTTACAGCAGTGTCACGTAAA
TCCTGCGTTAATTATACAAATCATTTCTCGGATTTTTCATCTCATTAACT
GTTGGATTTTTAATAGTTTTATTGATACCCCTTGTCGAATATTTCGAGGA
TGGGCCAGAATTATTTTGAATCGGATTGAAAGAATAAGGCGCTGGTCAGA
GCGTCATGACTTGTTACTGGCTGCTGATTGTTATTTCCAACAATCTCTTC
AGGCCTGCAAATTACTTATTATGGAAAAGACAGATATTGAGGTTTTTTAC
AATGAAACTGTTGATATGGTTGATATCAACTCGATTCAATTGCGATATTT
ATTGGATAATTATATTTATTCTCCAAATGAACCAAAAGTCCCACAAATTT
GGATTGACTTTGTTGTATCGGGTGCAAATCAGGTCGCAGATAAGGTTTTT
GAGGAAGAAGGAATTGATATTTGTCTAAAATTAAAAGAGAGTTTAAATTT
ACCATTGCTTCTGCCTGAGGACGGTTATCATGTTGATTCTTTGTACGGTG
GAGTTCCAGTTGGATTCATAGAATATTTGGAAAAGTTGCACAAAGAATGG
TGTTTTTATAAAATATCGCACCAAGACATCCATTTTGATTGGTTATGCCA
AAAAAGGGGTTTTCAAGACACTTCCTGTGAGTTGTTGCCGTTTGAGAACT
GTGTGAAAGTAGAAGACAACCTTAATAAGTCAAATTCCTCTAACAGGCAT
CAGCTGAAACTCTCAGATTTCAAAGCTAATGTTTATTACGAAAATCTCGA
CACCATCAACAACAACGAATCAACCGGGGAATCCGGAATAGATACTTACA
GAAACCAAAGTTATCAGCACTCGGCATCAAGATTAGATGTAAATGATAAT
CAATGTGCTAGAAAAAAAATTCAGTGCACTGATTTGCCATTAAATTTTAC
TTACGATTTATATCAGAATAATTGTCCAAAGCCATTCAGCGATGCTGGCT
CTACCACAGCAGCTTCACTTCTCTCTGAGATCATTGATGATGACAATCCA
TGCAATTCTCATTCAAAACGACATCGAGTAATTAAAGATTTGAGGAAGTC
ATTGGAAAACTCTATCGAAAAAACAATCGTAGCCCAGGAACAATTCCAAT
CTGTTATTCGTGGAACTGACGAGATTTACACAAAAGAATTAATTAAGCGT
CTGGACAAGCTTGAAAAGGACAAATCTGAAGAAATATACAAAATGAATTA
TCAGCAGTTTCATCGGGTTCAATCCACCAATCTGTCTTTGGAAAATTTGG
AAAATAAAAGGCAAACGGATTATATAAAACAGTCGGAACGAATGAAAAAT
ATATGTGAACTAGAATCTCAAATGGAATCAATTGATAAATATTCTTTCTT
GAAGTCAAGCACTCTACCAATTAGAAATTCAAATTCTGGCAGTCAACCAC
CTGCGTCTTTTGTTCCAGCTTCTTTGGCTTTGAGAAATTCGTTGAATTAT
CCGCCAAGATTGAGGCCAAAGCCAAAGATTCACAGTCTTTCCACAACGAA
CCGATCTCATTCAGCTGCCAATATTTCTAAATCTGATTCCAGTTTTGAAA
TATCTTCACGGATTCCGCCGCGCTCTTTGAGCAATGATCGGTTTTACTCT
CGAATGTCCGATGGAATGGAAAATTTGACATTCCAGGAAAAAGTCCAACT
TTTTGAATTTGCCATTAGTCGGAGCTCTCATTGAATCTATGGAATCTAAT
CAGATCTCTCTGGCAATATGTTCTGGGAGATTATTTTTTCACTGTTTTTG
GAGTAAATTTGCTGTTAGAGATTGTGTTGTCAGCACATTGTCCAAAGCCA
CCCGCAGTGCCATCATATCAAAATTTATCAACCTCCGTTACGGCAATCTT
CAACTATTCTGTAAATATTGATTTTGTCGGTGGCCTTTCACAGCATTCCA
TTAATTTTAGAGTTGTTTTATTGTAAATTTGTCCAGTTTTTTATATGTCG
CGTTTTAGTGTTTATAATTTGGTTTTTTAAACGATTTTTGGGTCATATTT
TCAGCACTAATTGAATTTTTCGTGAATTTGAGATCTGTTTTGAAAATGCA
TT
back to top

protein sequence of SMED30019772-orf-1

>SMED30019772-orf-1 ID=SMED30019772-orf-1|Name=SMED30019772-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1244bp
MTTILHLINQWNSSRLELFKISQPDKNLKFFGVMRFFFETEDKFHSKCLR
VSSDLKVKDLLPILLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPL
LIQLFWCKDDKEGVFVFKSNLKNKNSRRIRSQTRKDKIGSTTCLNSPTTR
CLDKVCTDPPTKSTKQFSKSPSLLSTPSFLSRTISNPESLMRLKRKSKLE
EKLKQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREIL
DKYGMENENENDFSLVSSVYKDQNTQKIEYEEILQNSDSPLRFLLQSNKN
DGFIKFRVVKMPANISKSKKSKTQGTFPDVCKSIAIRKSNSVNYRNSDVQ
SHSRNTCDGKFKHSLHPDFSNNYNGSNNKIYSTPPSSDSPVPLLKRVESE
KKPLPTYEESVSALRSWRVKISNFPENHKPISYRGSTESFSLSSDYQEDS
SYNTDSYESRNIPSVETPEQENDDVVIISDLDSHLSRHLPVQITYFKSKE
DMLLDSILLDIKPSQTKFKLASAYLLHLMVVDIIRLTCINRATVLDQELV
IGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFN
SSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENTDDSEEKDD
FPLSRKASDPKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINC
WIFNSFIDTPCRIFRGWARIILNRIERIRRWSERHDLLLAADCYFQQSLQ
ACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIW
IDFVVSGANQVADKVFEEEGIDICLKLKESLNLPLLLPEDGYHVDSLYGG
VPVGFIEYLEKLHKEWCFYKISHQDIHFDWLCQKRGFQDTSCELLPFENC
VKVEDNLNKSNSSNRHQLKLSDFKANVYYENLDTINNNESTGESGIDTYR
NQSYQHSASRLDVNDNQCARKKIQCTDLPLNFTYDLYQNNCPKPFSDAGS
TTAASLLSEIIDDDNPCNSHSKRHRVIKDLRKSLENSIEKTIVAQEQFQS
VIRGTDEIYTKELIKRLDKLEKDKSEEIYKMNYQQFHRVQSTNLSLENLE
NKRQTDYIKQSERMKNICELESQMESIDKYSFLKSSTLPIRNSNSGSQPP
ASFVPASLALRNSLNYPPRLRPKPKIHSLSTTNRSHSAANISKSDSSFEI
SSRIPPRSLSNDRFYSRMSDGMENLTFQEKVQLFEFAISRSSH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002710Dilute_dom
IPR000159RA_dom
IPR029071Ubiquitin-like_domsf
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005911cell-cell junction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000159Ras-associating (RA) domainSMARTSM00314RA_5coord: 214..300
e-value: 4.0E-6
score: 36.3
coord: 30..122
e-value: 1.8E-7
score: 40.8
IPR000159Ras-associating (RA) domainPFAMPF00788RAcoord: 216..301
e-value: 1.4E-12
score: 48.1
coord: 32..120
e-value: 2.8E-8
score: 34.3
IPR000159Ras-associating (RA) domainPROSITEPS50200RAcoord: 214..313
score: 13.597
IPR000159Ras-associating (RA) domainPROSITEPS50200RAcoord: 30..122
score: 15.022
IPR002710Dilute domainSMARTSM01132DIL_2coord: 689..793
e-value: 5.9E-8
score: 42.4
IPR002710Dilute domainPFAMPF01843DILcoord: 689..789
e-value: 2.0E-16
score: 60.1
IPR002710Dilute domainPROSITEPS51126DILUTEcoord: 556..810
score: 23.355
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 207..317
e-value: 3.6E-24
score: 87.2
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 34..120
e-value: 1.1E-5
score: 27.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1175..1202
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1176..1202
NoneNo IPR availablePANTHERPTHR10398AFADINcoord: 4..341
coord: 478..872
NoneNo IPR availablePANTHERPTHR10398:SF1MYELOID/LYMPHOID OR MIXED-LINEAGE LEUKEMIAcoord: 4..341
coord: 478..872
NoneNo IPR availableCDDcd01782RA1_Afadincoord: 11..120
e-value: 1.86988E-30
score: 114.359
NoneNo IPR availableCDDcd01781RA2_Afadincoord: 215..312
e-value: 1.65157E-30
score: 114.296
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 215..307
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 32..119