Ammonium transporter Rh type B

Overview
NameAmmonium transporter Rh type B
Smed IDSMED30019771
Length (bp)1630
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ammonium transporter Rh type B (SMED30019771) t-SNE clustered cells

Violin plots show distribution of expression levels for Ammonium transporter Rh type B (SMED30019771) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ammonium transporter Rh type B (SMED30019771) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ammonium transporter Rh type B (SMED30019771) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019771

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30019771SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30019771SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019771SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019771SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019771SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30019771SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30019771SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30019771SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019771SMESG000048384.1 Contig27221newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019771SMESG000048384.1 Contig27221uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019771SMESG000048384.1 Contig52110newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30019771SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30019771SMESG000048384.1 dd_Smed_v6_1882_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30019771SMESG000048384.1 dd_Smed_v6_1882_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30019771SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30019771SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30019771SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ammonium transporter Rh type B vs. Ensembl Human
Match: RHBG (Rh family B glycoprotein (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:14572])

HSP 1 Score: 372.089 bits (954), Expect = 1.214e-123
Identity = 194/419 (46.30%), Postives = 279/419 (66.59%), Query Frame = 1
Query:  121 QAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALV-EKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFE--ARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVP 1356
            Q    +L  +F  Y+ + DA++   +NH+   +     YP FQDV  M+F+GFGFLM FLQ+YG+SSVG  F +A  ++QW+ ++ GF+ S H   I++   S++NA+F    +LISFG VLGKT P Q+L+M+ +E+ LF +NE++  HLL V D G S+ +HTFGAYFGL LSRV+++ ++  SK+ + S+YHSDLFAMIGT+ LW+FWPSFN+     G  +HR  +NT+ SL AST+ TF +SALV E G+++MVHI NA L+GGV VG S+ +ML P+GA   G +AG VSTLGYK+ TP L +K    DTCGV+NLHGMPG++  ++  +     T+E YG  +  +F   A   R+A+ QA +Q+  L VT   A++ G L GL+LK+  L+      + Q++ D+  W+VP
Sbjct:   23 QGATAVLFAVFVRYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQRYGFSSVGFTFLLAAFALQWSTLVQGFLHSFHGGHIHVGVESMINADFCAGAVLISFGAVLGKTGPTQLLLMALLEVVLFGINEFVLLHLLGVRDAGGSMTIHTFGAYFGLVLSRVLYRPQLEKSKHRQGSVYHSDLFAMIGTIFLWIFWPSFNAALTALGAGQHRTALNTYYSLAASTLGTFALSALVGEDGRLDMVHIQNAALAGGVVVGTSSEMMLTPFGALAAGFLAGTVSTLGYKFFTPILESKFKVQDTCGVHNLHGMPGVLGALLGVLVAGLATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLGGLLLKLPFLD---SPPDSQHYEDQVHWQVP 438          
BLAST of Ammonium transporter Rh type B vs. Ensembl Human
Match: RHCG (Rh family C glycoprotein [Source:HGNC Symbol;Acc:HGNC:18140])

HSP 1 Score: 365.155 bits (936), Expect = 1.193e-120
Identity = 206/455 (45.27%), Postives = 294/455 (64.62%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVY---PYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGA-SLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSK-NESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFII-SALVEKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKN-VVKIFEAR---STRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPDFIPGNYSVVDTEKK 1401
            T ++  LP  +T  LLQ  + IL  +F  YD   DA       H  + D  +  Y   P FQDV  M+F+GFGFLMTFLQ+YG+S+VG NF +A   IQWAL++ G+      R  + G  +L+NA+F  A++ ++FG VLGK +PIQ+LIM+F ++ LF +NE+I  +LL V D G S+ +HTFGAYFGL ++R+++++ +  SK  ++S+Y SDLFAMIGTL LWM+WPSFNS     G+ +HRA +NT+CSL A  + +  I SAL +KGK++MVHI NATL+GGVAVG +A +ML P+GA +IG + G +STLG+ Y+TP L +++   DTCG+NNLHG+PG+I GIV A+     + E YGK  +V  F+ +      TA  Q  +Q+  LLVT  +A + G + GLIL++       +  +E  F D  +WE+P+   GN +V   E  
Sbjct:    5 TNLRWRLP--LTCLLLQVIMVILFGVFVRYDFEADAHWWSERTHKNLSDMENEFYYRYPSFQDVHVMVFVGFGFLMTFLQRYGFSAVGFNFLLAAFGIQWALLMQGWFHFLQDRYIVVGVENLINADFCVASVCVAFGAVLGKVSPIQLLIMTFFQVTLFAVNEFILLNLLKVKDAGGSMTIHTFGAYFGLTVTRILYRRNLEQSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYCSLAACVLTSVAISSALHKKGKLDMVHIQNATLAGGVAVGTAAEMMLMPYGALIIGFVCGIISTLGFVYLTPFLESRLHIQDTCGINNLHGIPGIIGGIVGAVTAASASLEVYGKEGLVHSFDFQGFNGDWTARTQGKFQIYGLLVTLAMALMGGIIVGLILRLPFWG---QPSDENCFEDAVYWEMPE---GNSTVYIPEDP 451          
BLAST of Ammonium transporter Rh type B vs. Ensembl Human
Match: RHAG (Rh associated glycoprotein [Source:HGNC Symbol;Acc:HGNC:10006])

HSP 1 Score: 349.362 bits (895), Expect = 1.902e-115
Identity = 186/427 (43.56%), Postives = 273/427 (63.93%), Query Frame = 1
Query:   97 FVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDT--LSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNS-KNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            F + A +L+  + +L  +F +Y++  D ++    N T   D      +YP FQDV  MIF+GFGFLMTFL+KYG+SSVGIN  +A + +QW  ++ G + S   +  +   +++NA+F+ AT+LISFG VLGKT+P QMLIM+ +E+  F  NEY+   +   SD+G S+ +H FGAYFGL ++ ++++  +    +NE S Y+SDLFAMIGTL LWMFWPSFNS   E G+++ RA+VNT+ SL A  +  F  S+LVE +GK+NMVHI NATL+GGVAVG  A++ + P+G+ +IG IAG VS LGYK++TP    K+  HDTCGV+NLHG+PG++ G+                 +V +    S  + + QA    AAL  + G A + G +TGLILK+ +     +  ++  ++D  +W+VP 
Sbjct:    5 FPLMAIVLEIAMIVLFGLFVEYET--DQTVLEQLNITKPTDMGIFFELYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGL---------------AGIVAVAMGASNTSMAMQA----AALGSSIGTAVVGGLMTGLILKLPLWG---QPSDQNCYDDSVYWKVPK 407          
BLAST of Ammonium transporter Rh type B vs. Ensembl Human
Match: RHAG (Rh associated glycoprotein [Source:HGNC Symbol;Acc:HGNC:10006])

HSP 1 Score: 349.362 bits (895), Expect = 2.286e-115
Identity = 186/427 (43.56%), Postives = 273/427 (63.93%), Query Frame = 1
Query:   97 FVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDT--LSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNS-KNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            F + A +L+  + +L  +F +Y++  D ++    N T   D      +YP FQDV  MIF+GFGFLMTFL+KYG+SSVGIN  +A + +QW  ++ G + S   +  +   +++NA+F+ AT+LISFG VLGKT+P QMLIM+ +E+  F  NEY+   +   SD+G S+ +H FGAYFGL ++ ++++  +    +NE S Y+SDLFAMIGTL LWMFWPSFNS   E G+++ RA+VNT+ SL A  +  F  S+LVE +GK+NMVHI NATL+GGVAVG  A++ + P+G+ +IG IAG VS LGYK++TP    K+  HDTCGV+NLHG+PG++ G+                 +V +    S  + + QA    AAL  + G A + G +TGLILK+ +     +  ++  ++D  +W+VP 
Sbjct:    5 FPLMAIVLEIAMIVLFGLFVEYET--DQTVLEQLNITKPTDMGIFFELYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLA---------------GIVAVAMGASNTSMAMQA----AALGSSIGTAVVGGLMTGLILKLPLWG---QPSDQNCYDDSVYWKVPK 407          
BLAST of Ammonium transporter Rh type B vs. Ensembl Human
Match: RHAG (Rh associated glycoprotein [Source:HGNC Symbol;Acc:HGNC:10006])

HSP 1 Score: 345.125 bits (884), Expect = 2.160e-113
Identity = 185/425 (43.53%), Postives = 272/425 (64.00%), Query Frame = 1
Query:   97 FVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDT--LSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNS-KNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEV 1353
            F + A +L+  + +L  +F +Y++  D ++    N T   D      +YP FQDV  MIF+GFGFLMTFL+KYG+SSVGIN  +A + +QW  ++ G + S   +  +   +++NA+F+ AT+LISFG VLGKT+P QMLIM+ +E+  F  NEY+   +   SD+G S+ +H FGAYFGL ++ ++++  +    +NE S Y+SDLFAMIGTL LWMFWPSFNS   E G+++ RA+VNT+ SL A  +  F  S+LVE +GK+NMVHI NATL+GGVAVG  A++ + P+G+ +IG IAG VS LGYK++TP    K+  HDTCGV+NLHG+PG++ G+                 +V +    S  + + QA    AAL  + G A + G +TGLILK+ +     +  ++  ++D  +W+V
Sbjct:    5 FPLMAIVLEIAMIVLFGLFVEYET--DQTVLEQLNITKPTDMGIFFELYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLA---------------GIVAVAMGASNTSMAMQA----AALGSSIGTAVVGGLMTGLILKLPLWG---QPSDQNCYDDSVYWKV 405          
BLAST of Ammonium transporter Rh type B vs. Ensembl Celegans
Match: rhr-1 (RH (Rhesus) antigen Related [Source:UniProtKB/TrEMBL;Acc:Q22947])

HSP 1 Score: 367.851 bits (943), Expect = 2.751e-122
Identity = 202/444 (45.50%), Postives = 292/444 (65.77%), Query Frame = 1
Query:  115 LLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSH-ATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVEKGK-INMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNET-YGKNVVKIFE--AR---STRTASQ--QAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPDFIPGNYSVVDTEKKISI 1410
            +L  F  + LVIF+ Y S   +++     +      ++++YP FQD   MIF+GFGFLMTFL++YG+S+V IN  +AV +IQW +++ G  S+H   +  +    LL A+FA A ILIS G +LGK +P Q +IM+F E P+ ++ E+I  H L ++DVG SI VH FGAYFGL  ++   KK+     NE S YH+D+FAMIG + LW++WPSFN+      + R RAV NTF SL A T+ TF++S  V+K K  +MVHIAN+TL+GGVA+G +AN++L+P+ A +IG+IAGAVS +GYKYITP L+ K+G HDTCGVNNLHGMPGLIAG   +IA +F+ +ET Y     KI+   AR    TR   +  QA  Q+ A+ + F  + +SG LTGL+LK+K+ +   + ++++Y+ D  ++E P        +V + K+I +
Sbjct:   13 ILGLFQVVFLVIFALYGSYDASALPSETKNVEEAARMTNLYPLFQDTHVMIFIGFGFLMTFLKRYGFSAVSINMLLAVFTIQWGIIVRGMASAHHGFKFTISLEQLLTADFAAAVILISMGAMLGKLSPSQYVIMAFFETPVALIVEHICVHNLQINDVGGSIIVHAFGAYFGLACAKGFGKKEQRGHTNEGSTYHTDIFAMIGAIFLWIYWPSFNAAVAATDDARQRAVANTFLSLCACTMTTFLVSQAVDKHKRFDMVHIANSTLAGGVAIGTTANVVLEPYHAMIIGVIAGAVSVIGYKYITPFLSEKLGIHDTCGVNNLHGMPGLIAGFA-SIAFLFIYDETRYPAQYDKIYPGMARGEDRTRMFDEKTQALNQLMAIGLVFLASTVSGYLTGLLLKLKIWD---QVRDDEYYADGDYFETPGDYDFTSRIVTSVKQIEV 452          
BLAST of Ammonium transporter Rh type B vs. Ensembl Celegans
Match: rhr-1 (RH (Rhesus) antigen Related [Source:UniProtKB/TrEMBL;Acc:Q22947])

HSP 1 Score: 367.851 bits (943), Expect = 2.751e-122
Identity = 202/444 (45.50%), Postives = 292/444 (65.77%), Query Frame = 1
Query:  115 LLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSH-ATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVEKGK-INMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNET-YGKNVVKIFE--AR---STRTASQ--QAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPDFIPGNYSVVDTEKKISI 1410
            +L  F  + LVIF+ Y S   +++     +      ++++YP FQD   MIF+GFGFLMTFL++YG+S+V IN  +AV +IQW +++ G  S+H   +  +    LL A+FA A ILIS G +LGK +P Q +IM+F E P+ ++ E+I  H L ++DVG SI VH FGAYFGL  ++   KK+     NE S YH+D+FAMIG + LW++WPSFN+      + R RAV NTF SL A T+ TF++S  V+K K  +MVHIAN+TL+GGVA+G +AN++L+P+ A +IG+IAGAVS +GYKYITP L+ K+G HDTCGVNNLHGMPGLIAG   +IA +F+ +ET Y     KI+   AR    TR   +  QA  Q+ A+ + F  + +SG LTGL+LK+K+ +   + ++++Y+ D  ++E P        +V + K+I +
Sbjct:   13 ILGLFQVVFLVIFALYGSYDASALPSETKNVEEAARMTNLYPLFQDTHVMIFIGFGFLMTFLKRYGFSAVSINMLLAVFTIQWGIIVRGMASAHHGFKFTISLEQLLTADFAAAVILISMGAMLGKLSPSQYVIMAFFETPVALIVEHICVHNLQINDVGGSIIVHAFGAYFGLACAKGFGKKEQRGHTNEGSTYHTDIFAMIGAIFLWIYWPSFNAAVAATDDARQRAVANTFLSLCACTMTTFLVSQAVDKHKRFDMVHIANSTLAGGVAIGTTANVVLEPYHAMIIGVIAGAVSVIGYKYITPFLSEKLGIHDTCGVNNLHGMPGLIAGFA-SIAFLFIYDETRYPAQYDKIYPGMARGEDRTRMFDEKTQALNQLMAIGLVFLASTVSGYLTGLLLKLKIWD---QVRDDEYYADGDYFETPGDYDFTSRIVTSVKQIEV 452          
BLAST of Ammonium transporter Rh type B vs. Ensembl Celegans
Match: rhr-2 (RH (Rhesus) antigen Related [Source:UniProtKB/TrEMBL;Acc:Q17463])

HSP 1 Score: 319.701 bits (818), Expect = 1.266e-103
Identity = 180/413 (43.58%), Postives = 263/413 (63.68%), Query Frame = 1
Query:   97 FVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGF--VSSHATRIYLDG-ASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQ-RHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNKIGFH--DTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIF------EARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLN 1296
            F I A L+Q    + +V+F+ Y   ID        ++G        YP FQDV  MIF+GFGFLM FL++YG+S+V +N  ++   IQ+A+++ GF  V+   T ++  G   +++AE + A +LI+ GV+LG+ TP+Q L+++F E  + VL E+   + L V+D G S+ VHTFGAYFGL  + V HKK +        I+HSDLF+MIGTL+LW+F+PSFN+   E E  RHRA++NT+ ++ + T+ TF+IS+ V+  G+ NM+HI ++TL+GGVA+G+SAN +L P+ A ++G+IA  +S +G+ +I+PRL +  FH  DTCGV+NLHGMPG++AG++      F   E+YGK +  I+      E    R    QA YQ   LL     A I G LTG ILKIKV N
Sbjct:   10 FAIIAGLMQT---VFIVLFAKYVKYIDPLDDSRRVYSGTD------YPLFQDVHLMIFVGFGFLMAFLKRYGFSAVSVNLLLSAFVIQFAMLLRGFMTVAFQETGLFSIGIPEMISAESSCAAVLITMGVLLGRLTPVQFLLLAFFETGINVLVEHYVFNYLHVNDSGRSLSVHTFGAYFGLAAACVGHKKNVMEMDEHGGIHHSDLFSMIGTLLLWVFFPSFNAAIQEPEDARHRAIMNTYLAMASGTVTTFMISSCVDTLGRFNMIHIQSSTLAGGVAIGSSANAVLHPYHAVIVGVIAALLSVIGHAWISPRLERT-FHLFDTCGVHNLHGMPGILAGLLSIGFAYFYEPESYGKTLYHIYPYWIGGELHGDRENVSQAQYQALGLLTILVTAVIGGLLTGCILKIKVWN 412          
BLAST of Ammonium transporter Rh type B vs. Ensembl Fly
Match: Rh50 (gene:FBgn0028699 transcript:FBtr0331423)

HSP 1 Score: 353.984 bits (907), Expect = 7.882e-117
Identity = 201/459 (43.79%), Postives = 274/459 (59.69%), Query Frame = 1
Query:  115 LLQAFVFILLVIFSDYDSR-----IDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNS--KNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALV-EKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARS-------------TRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKD-KEEQYFNDEPFWEVPDFIPGNYSVVDTEKKISIELEE 1422
            ++Q    +L  +F  Y+       IDA   G+AN         S YP FQD+Q MIF+GFGFLMTFL+KYGYS+ G   F+A + +QWA+++ GF+     +I L   ++++A+ A A  LIS G +LG+TTPIQ+L MS  E+ LF  NEY+  H+  + D G SI VH FGAYFGL ++ ++      N   K E + Y SD+FAMIGT  LW++WPSFNS   +G    RA++NTF SL A+T+ TF++SALV  + K++MVH+ N+TL+GGVAVG   NL+L   GA LIG+IAG VS LGY+Y+TP +   +  HDTCGV+NLHGMP LI+ I  AI     T   Y   +  IF A                R A+ QAGYQ+  + VT  IA   G LTG +LK      N+++ K++++  DE +WEVP            E K   ELE+
Sbjct:   16 IVQIIFLVLFWLFVRYEKTALPLAIDAEDAGSANEH------VSKYPQFQDIQVMIFIGFGFLMTFLRKYGYSATGFTLFMAALVVQWAVLMKGFLHMEGGKISLSLENIIDADIAAAVPLISMGALLGRTTPIQLLCMSVFEVALFAANEYLALHVFSICDCGGSITVHAFGAYFGLAVALMLRPASDQNETGKLEGASYTSDIFAMIGTTFLWVYWPSFNSVLADGAGGERAILNTFLSLAAATVTTFVVSALVSHENKLDMVHVQNSTLAGGVAVGTVCNLLLGAHGAVLIGIIAGTVSVLGYRYLTPWMTANLRLHDTCGVHNLHGMPALISAIASAIYASMATVGEYQSELQDIFPAMVGTNGTETKIMGGLGRNATSQAGYQLFGIAVTLLIAIGGGILTGAVLKY----TNFRNLKKDEHHQDEHYWEVP----------AAENKEEYELEK 454          
BLAST of Ammonium transporter Rh type B vs. Ensembl Fly
Match: Rh50 (gene:FBgn0028699 transcript:FBtr0345597)

HSP 1 Score: 353.984 bits (907), Expect = 7.882e-117
Identity = 201/459 (43.79%), Postives = 274/459 (59.69%), Query Frame = 1
Query:  115 LLQAFVFILLVIFSDYDSR-----IDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNS--KNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALV-EKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARS-------------TRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKD-KEEQYFNDEPFWEVPDFIPGNYSVVDTEKKISIELEE 1422
            ++Q    +L  +F  Y+       IDA   G+AN         S YP FQD+Q MIF+GFGFLMTFL+KYGYS+ G   F+A + +QWA+++ GF+     +I L   ++++A+ A A  LIS G +LG+TTPIQ+L MS  E+ LF  NEY+  H+  + D G SI VH FGAYFGL ++ ++      N   K E + Y SD+FAMIGT  LW++WPSFNS   +G    RA++NTF SL A+T+ TF++SALV  + K++MVH+ N+TL+GGVAVG   NL+L   GA LIG+IAG VS LGY+Y+TP +   +  HDTCGV+NLHGMP LI+ I  AI     T   Y   +  IF A                R A+ QAGYQ+  + VT  IA   G LTG +LK      N+++ K++++  DE +WEVP            E K   ELE+
Sbjct:   16 IVQIIFLVLFWLFVRYEKTALPLAIDAEDAGSANEH------VSKYPQFQDIQVMIFIGFGFLMTFLRKYGYSATGFTLFMAALVVQWAVLMKGFLHMEGGKISLSLENIIDADIAAAVPLISMGALLGRTTPIQLLCMSVFEVALFAANEYLALHVFSICDCGGSITVHAFGAYFGLAVALMLRPASDQNETGKLEGASYTSDIFAMIGTTFLWVYWPSFNSVLADGAGGERAILNTFLSLAAATVTTFVVSALVSHENKLDMVHVQNSTLAGGVAVGTVCNLLLGAHGAVLIGIIAGTVSVLGYRYLTPWMTANLRLHDTCGVHNLHGMPALISAIASAIYASMATVGEYQSELQDIFPAMVGTNGTETKIMGGLGRNATSQAGYQLFGIAVTLLIAIGGGILTGAVLKY----TNFRNLKKDEHHQDEHYWEVP----------AAENKEEYELEK 454          
BLAST of Ammonium transporter Rh type B vs. Ensembl Fly
Match: Rh50 (gene:FBgn0028699 transcript:FBtr0073354)

HSP 1 Score: 353.214 bits (905), Expect = 1.226e-116
Identity = 196/437 (44.85%), Postives = 268/437 (61.33%), Query Frame = 1
Query:  115 LLQAFVFILLVIFSDYDSR-----IDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNS--KNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALV-EKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARS-------------TRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKD-KEEQYFNDEPFWEVP 1356
            ++Q    +L  +F  Y+       IDA   G+AN         S YP FQD+Q MIF+GFGFLMTFL+KYGYS+ G   F+A + +QWA+++ GF+     +I L   ++++A+ A A  LIS G +LG+TTPIQ+L MS  E+ LF  NEY+  H+  + D G SI VH FGAYFGL ++ ++      N   K E + Y SD+FAMIGT  LW++WPSFNS   +G    RA++NTF SL A+T+ TF++SALV  + K++MVH+ N+TL+GGVAVG   NL+L   GA LIG+IAG VS LGY+Y+TP +   +  HDTCGV+NLHGMP LI+ I  AI     T   Y   +  IF A                R A+ QAGYQ+  + VT  IA   G LTG +LK      N+++ K++++  DE +WEVP
Sbjct:   16 IVQIIFLVLFWLFVRYEKTALPLAIDAEDAGSANEH------VSKYPQFQDIQVMIFIGFGFLMTFLRKYGYSATGFTLFMAALVVQWAVLMKGFLHMEGGKISLSLENIIDADIAAAVPLISMGALLGRTTPIQLLCMSVFEVALFAANEYLALHVFSICDCGGSITVHAFGAYFGLAVALMLRPASDQNETGKLEGASYTSDIFAMIGTTFLWVYWPSFNSVLADGAGGERAILNTFLSLAAATVTTFVVSALVSHENKLDMVHVQNSTLAGGVAVGTVCNLLLGAHGAVLIGIIAGTVSVLGYRYLTPWMTANLRLHDTCGVHNLHGMPALISAIASAIYASMATVGEYQSELQDIFPAMVGTNGTETKIMGGLGRNATSQAGYQLFGIAVTLLIAIGGGILTGAVLKY----TNFRNLKKDEHHQDEHYWEVP 442          
BLAST of Ammonium transporter Rh type B vs. Ensembl Zebrafish
Match: rhbg (Rh family, B glycoprotein (gene/pseudogene) [Source:NCBI gene;Acc:337596])

HSP 1 Score: 382.874 bits (982), Expect = 5.303e-128
Identity = 196/431 (45.48%), Postives = 283/431 (65.66%), Query Frame = 1
Query:  148 IFSDYDSRIDASITGNANHTG-VQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNE-SSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIF-EA--RSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPDFIPGNYSVVDTEKKISIE 1413
            +  +Y+   DA      N T    +     YP FQDV  MIF+GFGFLMTFLQ+YG+SS+G NF IA  S+QWA ++ GF    H  +I++   S++NA+F T  +LISFG VLGKT+P+Q+L+M+ +E+ LF +NEYI   +L  +D G S+ +HTFGAYFGL ++R++H+  +  SK++ SS+YHSDLFAMIGT+ LWMFWPSFNS   + G+ +HR   NT+ SL A T+ TF  S+LV  +GK++MVHI NA L+GGVAVG +  +ML P+G+ ++G +AG +S LGYKY+TP + +K+   DTCG++NLHGMPG++  IV A+     + + YG  + K+F EA   S  +A  + G+Q  +L VT GIA I G +TG +LK+ +        + Q F D  +WEVP     ++ + +   +  +E
Sbjct:   28 VLVEYNDDTDAKKWNKNNSTDPATNEFYYRYPSFQDVHVMIFVGFGFLMTFLQRYGFSSMGFNFLIAAFSLQWATLMQGFFHGMHHGKIHVGVTSMINADFCTGAVLISFGAVLGKTSPVQLLVMAILEVTLFAVNEYILLSILGANDAGGSMTIHTFGAYFGLMVTRILHRPNLDKSKHKNSSVYHSDLFAMIGTIFLWMFWPSFNSAITQYGDPQHRTAANTYYSLAACTLATFGFSSLVNPEGKLDMVHIQNAALAGGVAVGTAGEMMLTPFGSMIVGFLAGTISVLGYKYLTPFMESKLKIQDTCGIHNLHGMPGILGAIVGAVTAALASRDVYGNGLDKVFLEAADNSQWSAQTKGGFQAISLAVTLGIALIGGLITGFLLKLPIYGT---PPDTQCFEDAVYWEVPGEEEDHHELNEVSTQNEVE 455          
BLAST of Ammonium transporter Rh type B vs. Ensembl Zebrafish
Match: rhag (Rh associated glycoprotein [Source:ZFIN;Acc:ZDB-GENE-030131-8229])

HSP 1 Score: 356.295 bits (913), Expect = 5.523e-118
Identity = 192/431 (44.55%), Postives = 276/431 (64.04%), Query Frame = 1
Query:   67 FLTQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNS-KNESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFW 1347
            + T M+  L F I A +L+    +L  +F  YD+  D     +   +   ++  ++YP FQDV  MIF+GFGFLMTFL++YG++SVG+N  +A   +QW L++      H  +I +    ++NA+F+TAT+LISFG VLGKT+P+Q+LIM+ +E+  F +NEY+   +L VSDVG S+ +H FGAYFGL ++RV+++  + N   N+ S+YHSDLFAMIGT+ LWMFWPSFNS     G+ + RAVVNT+ SL A  +  +  S+LVE KGK++MVHI NATL+GGVAVG  A++ ++P+GA LIG+ AG +ST+G+K++TP L +K+G  DTCGV+NLHGMPG++ G                  V  I  A   R       YQ A L  + G A + G +TGLI+KI  L    +  ++  F+D  +W
Sbjct:    4 YSTNMR--LKFPILALILEIITIVLYALFVVYDTGDDKGHGDHHEKSNQTESPMTLYPMFQDVHVMIFIGFGFLMTFLKRYGFTSVGVNLLLAAFGLQWGLLLQNVWHMHGGKIRVSIDRMINADFSTATVLISFGAVLGKTSPVQLLIMTLLEITTFCINEYLVVEILGVSDVGASMTIHAFGAYFGLSVARVLYRPGLRNGHDNDGSVYHSDLFAMIGTVYLWMFWPSFNSAIATPGDHQLRAVVNTYFSLAACALAAYATSSLVEKKGKLDMVHIQNATLAGGVAVGTCADMDIQPFGAMLIGITAGIISTVGFKFLTPILASKLGIQDTCGVHNLHGMPGILGG------------------VAGILAAALKRKEGVSPTYQAAGLASSLGFALVGGLITGLIMKIPFLG---QPPDQNCFDDSIYW 411          
BLAST of Ammonium transporter Rh type B vs. Ensembl Zebrafish
Match: rhcga (Rh family, C glycoprotein a [Source:ZFIN;Acc:ZDB-GENE-070424-81])

HSP 1 Score: 350.132 bits (897), Expect = 9.042e-115
Identity = 189/466 (40.56%), Postives = 280/466 (60.09%), Query Frame = 1
Query:    7 YIEISKNFYCQQAFHLLFYEFLTQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSS----VYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHAT---RIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISAL-VEKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNK-IGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKN-VVKIF---EARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            ++E  + F+C              ++  LP  I   + Q  + IL  +F  YD   DA    +  H  +   + +     YP FQDV  MIF+GFGFLMTFL++Y + +VG NF +A   +QWAL++ G+  S       I +   SL+NA+F  A  LI++G +LGK +P+Q+++M+   + L+ + EYI  +LL V D G S+ +HTFGAY+GL +S ++++ K+  +K+   S+YHSD+FAMIGTL LWMFWPSFNS     G+ +HRA +NT+ SL AS + TF IS++  +KGK++MVHI NATL+GGVA+G +A  M+ P+G+ ++G   G +ST GY  ITP + K +   DTCGV+NLH MPGLI GIV AI     +   YG+  +V +F      + R+ + Q GYQ A + V      + G + G IL++ +        +E  F+DE +WEVP+
Sbjct:    4 FVECCRGFWCGPK--------NPNVRVSLP--IVCFIWQIAMIILFGLFVRYDIESDAHWAEHKKHENITSDIENDFYFRYPSFQDVHVMIFVGFGFLMTFLKRYSFGAVGFNFLVAAFGLQWALLMQGWFHSLDPVDGTIKIGVESLINADFCVAGCLIAYGALLGKVSPVQLMVMTLFGITLYAVEEYIILNLLHVRDAGGSMVIHTFGAYYGLTISWILYRPKLDQAKHLNGSVYHSDVFAMIGTLFLWMFWPSFNSAISNHGDGQHRAAINTYLSLAASVLTTFAISSMSAKKGKVDMVHIQNATLAGGVAMGTAAEFMISPYGSLIVGFCCGIISTFGYVVITPFMEKYLKIQDTCGVHNLHAMPGLIGGIVGAITAAAASPTVYGQEGLVNLFGFTGDYANRSPATQGGYQAAGIAVALAFGIVGGIIVGCILRLPIWG---DPSDENCFDDEVYWEVPE 456          
BLAST of Ammonium transporter Rh type B vs. Ensembl Zebrafish
Match: rhcgb (Rh family, C glycoprotein b [Source:NCBI gene;Acc:792274])

HSP 1 Score: 348.591 bits (893), Expect = 2.996e-114
Identity = 186/443 (41.99%), Postives = 271/443 (61.17%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSS----VYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHAT--RIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSGGI-EGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYG----KNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            T ++  LP V    + Q  + IL  +F  Y+   D +         +   + +     YP FQDV  MIF+GFGFLMTFL++Y + +VG NF IA   +QWAL++ G+ S      +I +    L+NA+F  A+ LI++G VLGK +P+Q+L+M+   + L+ + E+I   +L   D G S+ +HTFGAY+GL +SRV+++  +  S +   S+YHSD+FAMIGTL LWMFWPSFNS     G+ +HRA +NT+ +L ++ + T  IS++ EK GK++MVHI N+TL+GGVAVG +A  ML P+G+ ++G   G +STLGY Y+TP L  ++   DTCG++NLH MPG+I GIV AI+    + E YG    +N+     +  TR  + Q GYQ AAL V        G   GL+LK+ +        +E  FNDE +WEVP+
Sbjct:   17 TNIRLSLPAV--CFVWQVSMIILFGVFVRYNEEADTNWVYTKKEKNITSDIENDFYFRYPSFQDVHVMIFVGFGFLMTFLKRYSFGAVGFNFLIAAFGLQWALLMQGWFSPLGDDGKIKIGIEKLINADFCVASCLIAYGAVLGKVSPVQLLVMTLFGITLYAVEEFIILSVLNAKDAGGSMVIHTFGAYYGLSISRVLYRPNLNKSNHMNGSVYHSDVFAMIGTLFLWMFWPSFNSAICNHGDGQHRAAINTYLALASTVLTTVAISSMFEKTGKLDMVHIQNSTLAGGVAVGTAAEFMLMPYGSLIVGFFCGIISTLGYIYLTPFLEERLKIQDTCGIHNLHAMPGVIGGIVGAISAAAASKEVYGDLGLENIFSFEGSNVTRLPTVQGGYQAAALCVALCFGIGGGTFVGLVLKLPIWG---DPADEHCFNDEMYWEVPE 454          
BLAST of Ammonium transporter Rh type B vs. Ensembl Zebrafish
Match: rhcgl1 (Rh family, C glycoprotein, like 1 [Source:ZFIN;Acc:ZDB-GENE-060209-2])

HSP 1 Score: 341.658 bits (875), Expect = 8.367e-112
Identity = 189/443 (42.66%), Postives = 279/443 (62.98%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDA----SITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS---HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNK-IGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYG-KNVVKI--FEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            T ++  LP V    + Q  + IL  +F  YD   D+    +   N   T +++     YP FQDV  MIF+GFGFLMTFL++Y + SVG NF IA   IQWAL++ G+  S      +I +   +L+NA+F  A  LI++G  LGK +P+Q+++++   + L+ + EYI  ++L V D G S+ +HTFGAY+GL +S V+++  +  S + + S+YHSD+FAMIGTL LWMFWPSFNS     G+ +HRA +NT+ SL AS + TF +S+L +K GK++MVHI NATL+GGVA+G ++  M+ P+G+ ++G  +G VSTLGY ++TP + K +   DTCGV+NLH MPG+I GIV A+     +   YG + ++ +  FE +  RTAS Q GYQ A + V      + GAL G ILK+ +        +   F+D+ +WEVP+
Sbjct:    5 TNIRISLPAV--CFVWQIAMIILFGVFIRYDEESDSHWIETRKKNNISTDLENDFYYRYPSFQDVHVMIFVGFGFLMTFLKRYSFGSVGFNFLIAAFGIQWALLMQGWFHSFDKEDLKIKIGVENLINADFCVAGCLIAYGACLGKVSPVQLMVLTLFGVTLYAVEEYIILYVLHVRDAGGSMVIHTFGAYYGLTISWVLYRPFLSQSNHLQRSVYHSDVFAMIGTLFLWMFWPSFNSAIADHGDGQHRAAINTYLSLAASVLTTFALSSLSKKYGKLDMVHIQNATLAGGVAMGTASEFMITPYGSLIVGFCSGIVSTLGYVFLTPLMEKTLKIQDTCGVHNLHAMPGVIGGIVGAVTAACASESVYGHEGLINMFGFEGKVNRTASVQGGYQAAGIFVAIAFGLVGGALVGGILKLPIWG---DPTDSNCFDDDIYWEVPE 442          
BLAST of Ammonium transporter Rh type B vs. Ensembl Xenopus
Match: rhbg (Rh family B glycoprotein (gene/pseudogene) [Source:NCBI gene;Acc:496595])

HSP 1 Score: 390.963 bits (1003), Expect = 4.591e-131
Identity = 209/455 (45.93%), Postives = 291/455 (63.96%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNA--NHT--GVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFE--ARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPDFIPGNYSVVDTEKKI 1404
            T M+  LP  +   LL+    IL  +F  YD   DA    +   NH+    ++     YP FQDV  MIF+GFGFLMTFL++YG+SSV  NF IA   +QW+ +I GF    H  +I++   S++NA+F T  +LISFG VLGKT+P+Q+++M+ IE+ LF +NEYI  +++   D G S+ +HTFGAYFGL +SRV+++  +  S+  E S+YHSDLFAMIGT+ LWMFWPSFNS     G+ +HR V+NT+ SL A T+ TF  SAL+  +GK++MVHI NA L+GGVAVG S  +ML P+GA + G +AG +S LGYKY+TP L+ K+   DTCGV+NLHGMPG++  ++ AI  +F T E YG  +  +F   +  +RTA QQ+ YQ  ALLV  G A + G + G ILK+ +        + + F D  +WEV    P     +  E++I
Sbjct:    6 TNMRIKLP--VFCLLLEFITIILFAVFVRYDHESDAKQWHDEMRNHSVQNAENDFYFRYPSFQDVHVMIFIGFGFLMTFLKRYGFSSVAFNFLIAAFGLQWSTLIQGFFHGFHDGKIHVGIESMINADFCTGAVLISFGAVLGKTSPVQLIVMTLIEVTLFGINEYIILNIVGAKDAGGSMTIHTFGAYFGLIVSRVLYRDDLEKSRQREGSVYHSDLFAMIGTIYLWMFWPSFNSAITAHGDDQHRTVMNTYYSLAACTLATFGFSALLNGEGKLDMVHIQNAALAGGVAVGTSGEMMLTPFGAMIAGTLAGMISVLGYKYLTPVLDSKLKIQDTCGVHNLHGMPGILGALIGAIVALFATAEIYGAGMEDVFPLISDGSRTAKQQSLYQFLALLVALGFAILGGLVVGFILKLPIFGT---PSDAECFEDAVYWEVRSVAP-PLQCISAEERI 454          
BLAST of Ammonium transporter Rh type B vs. Ensembl Xenopus
Match: rhbg (Rh family B glycoprotein (gene/pseudogene) [Source:NCBI gene;Acc:496595])

HSP 1 Score: 388.652 bits (997), Expect = 3.672e-130
Identity = 208/440 (47.27%), Postives = 288/440 (65.45%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNA--NHT--GVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMV-SDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFE--ARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVP 1356
            T M+  LP  +   LL+    IL  +F  YD   DA    +   NH+    ++     YP FQDV  MIF+GFGFLMTFL++YG+SSV  NF IA   +QW+ +I GF    H  +I++   S++NA+F T  +LISFG VLGKT+P+Q+++M+ IE+ LF +NEYI  +++ V +D G S+ +HTFGAYFGL +SRV+++  +  S+  E S+YHSDLFAMIGT+ LWMFWPSFNS     G+ +HR V+NT+ SL A T+ TF  SAL+  +GK++MVHI NA L+GGVAVG S  +ML P+GA + G +AG +S LGYKY+TP L+ K+   DTCGV+NLHGMPG++  ++ AI  +F T E YG  +  +F   +  +RTA QQ+ YQ  ALLV  G A + G + G ILK+ +        + + F D  +WEVP
Sbjct:    6 TNMRIKLP--VFCLLLEFITIILFAVFVRYDHESDAKQWHDEMRNHSVQNAENDFYFRYPSFQDVHVMIFIGFGFLMTFLKRYGFSSVAFNFLIAAFGLQWSTLIQGFFHGFHDGKIHVGIESMINADFCTGAVLISFGAVLGKTSPVQLIVMTLIEVTLFGINEYIILNIVGVRTDAGGSMTIHTFGAYFGLIVSRVLYRDDLEKSRQREGSVYHSDLFAMIGTIYLWMFWPSFNSAITAHGDDQHRTVMNTYYSLAACTLATFGFSALLNGEGKLDMVHIQNAALAGGVAVGTSGEMMLTPFGAMIAGTLAGMISVLGYKYLTPVLDSKLKIQDTCGVHNLHGMPGILGALIGAIVALFATAEIYGAGMEDVFPLISDGSRTAKQQSLYQFLALLVALGFAILGGLVVGFILKLPIFGT---PSDAECFEDAVYWEVP 440          
BLAST of Ammonium transporter Rh type B vs. Ensembl Xenopus
Match: rhbg (Rh family B glycoprotein (gene/pseudogene) [Source:NCBI gene;Acc:496595])

HSP 1 Score: 388.652 bits (997), Expect = 6.034e-130
Identity = 206/438 (47.03%), Postives = 285/438 (65.07%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNA--NHT--GVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFE--ARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEV 1353
            T M+  LP  +   LL+    IL  +F  YD   DA    +   NH+    ++     YP FQDV  MIF+GFGFLMTFL++YG+SSV  NF IA   +QW+ +I GF    H  +I++   S++NA+F T  +LISFG VLGKT+P+Q+++M+ IE+ LF +NEYI  +++   D G S+ +HTFGAYFGL +SRV+++  +  S+  E S+YHSDLFAMIGT+ LWMFWPSFNS     G+ +HR V+NT+ SL A T+ TF  SAL+  +GK++MVHI NA L+GGVAVG S  +ML P+GA + G +AG +S LGYKY+TP L+ K+   DTCGV+NLHGMPG++  ++ AI  +F T E YG  +  +F   +  +RTA QQ+ YQ  ALLV  G A + G + G ILK+ +        + + F D  +WEV
Sbjct:    6 TNMRIKLP--VFCLLLEFITIILFAVFVRYDHESDAKQWHDEMRNHSVQNAENDFYFRYPSFQDVHVMIFIGFGFLMTFLKRYGFSSVAFNFLIAAFGLQWSTLIQGFFHGFHDGKIHVGIESMINADFCTGAVLISFGAVLGKTSPVQLIVMTLIEVTLFGINEYIILNIVGAKDAGGSMTIHTFGAYFGLIVSRVLYRDDLEKSRQREGSVYHSDLFAMIGTIYLWMFWPSFNSAITAHGDDQHRTVMNTYYSLAACTLATFGFSALLNGEGKLDMVHIQNAALAGGVAVGTSGEMMLTPFGAMIAGTLAGMISVLGYKYLTPVLDSKLKIQDTCGVHNLHGMPGILGALIGAIVALFATAEIYGAGMEDVFPLISDGSRTAKQQSLYQFLALLVALGFAILGGLVVGFILKLPIFGT---PSDAECFEDAVYWEV 438          
BLAST of Ammonium transporter Rh type B vs. Ensembl Xenopus
Match: rhcg (Rh family C glycoprotein [Source:NCBI gene;Acc:445260])

HSP 1 Score: 358.607 bits (919), Expect = 4.919e-118
Identity = 190/438 (43.38%), Postives = 277/438 (63.24%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDAS----ITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHAT-RIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALV-EKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKI---FEAR-STRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFW 1347
            + M+  LP V    L +  + +L  IF  Y+   D      +      + +Q+     YP FQDV  MIF+GFGFLMTFL++YG+ SV  NF +A   IQWA+++ G+  +    +I +   SL+NA+F   ++ I+FG +LGK +P+Q+++M+  ++ LF +NE+I  +LL V+D G S+ +HTFGAYFGL ++ ++++ ++  + + E S+Y SDLF+MIGTL LWMFWPSFNS     G+ +HRA +NT+CSL A  + T  IS++V +KGK+ MVHI NATL+GGVAVG +A +ML P+G+ ++G I G VSTLG+ Y +P L NK+  HDTCG++NLH MPGLI GIV A+     T   Y  + +K    FE   +TRT S Q GYQ A L V+     + G + G ILK+ +        +E  F+DE +W
Sbjct:   20 SNMRLRLPVV--CFLWEIAMIVLFGIFVRYNDEADPHWSEFMKAQNITSDIQNDYYFRYPSFQDVHVMIFVGFGFLMTFLKRYGFGSVAFNFLLAAFGIQWAILMQGWFHTFKNGKILIGVESLINADFCVGSVCIAFGAILGKVSPVQIMVMTLFQVTLFAVNEWILLNLLHVNDAGGSMTIHTFGAYFGLTVAWILNRPRLKQTNDKEGSVYVSDLFSMIGTLFLWMFWPSFNSAVSYHGDAQHRAAINTYCSLAACVLTTVAISSVVNKKGKLEMVHIQNATLAGGVAVGTAAEMMLTPYGSLIVGFICGIVSTLGFTYCSPFLSNKLRLHDTCGIHNLHAMPGLIGGIVGAVTAACATEAVYTADGLKKMFRFEGDYATRTPSMQGGYQAAGLCVSLAFGLVGGTVVGCILKLPIWG---DPSDENCFDDEVYW 452          
BLAST of Ammonium transporter Rh type B vs. Ensembl Xenopus
Match: rhbg (Rh family B glycoprotein (gene/pseudogene) [Source:NCBI gene;Acc:496595])

HSP 1 Score: 357.066 bits (915), Expect = 7.348e-118
Identity = 196/440 (44.55%), Postives = 280/440 (63.64%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNA--NHT--GVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNV-VKIFEARSTRTASQQAGYQMA--ALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVP 1356
            T M+  LP  +   LL+    IL  +F  YD   DA    +   NH+    ++     YP FQDV  MIF+GFGFLMTFL++YG+SSV  NF IA   +QW+ +I GF    H  +I++   S++NA+F T  +LISFG VLGKT+P+Q+++M+ IE+ LF +NEYI  +++   D G S+ +HTFGAYFGL +SRV+++  +  S+  E S+YHSDLFAMIGT+ LWMFWPSFNS     G+ +HR V+NT+ SL A T+ TF  SAL+  +GK++MVHI NA L+GGVAVG S  +ML P+GA + G +AG +S LGYKY+TP L+ K+   DTCGV+NLHGMPG++  ++ AI  +F T E YG  + V +    +T   +    ++    ++++T  +A+      G ILK+ +        + + F D  +WEVP
Sbjct:    6 TNMRIKLP--VFCLLLEFITIILFAVFVRYDHESDAKQWHDEMRNHSVQNAENDFYFRYPSFQDVHVMIFIGFGFLMTFLKRYGFSSVAFNFLIAAFGLQWSTLIQGFFHGFHDGKIHVGIESMINADFCTGAVLISFGAVLGKTSPVQLIVMTLIEVTLFGINEYIILNIVGAKDAGGSMTIHTFGAYFGLIVSRVLYRDDLEKSRQREGSVYHSDLFAMIGTIYLWMFWPSFNSAITAHGDDQHRTVMNTYYSLAACTLATFGFSALLNGEGKLDMVHIQNAALAGGVAVGTSGEMMLTPFGAMIAGTLAGMISVLGYKYLTPVLDSKLKIQDTCGVHNLHGMPGILGALIGAIVALFATAEIYGAGIGVALGSLGATSAFNDWLVFEPCCNSIIMTPNVASFP---AGFILKLPIFGT---PSDAECFEDAVYWEVP 437          
BLAST of Ammonium transporter Rh type B vs. Ensembl Mouse
Match: Rhbg (Rhesus blood group-associated B glycoprotein [Source:MGI Symbol;Acc:MGI:1927379])

HSP 1 Score: 372.474 bits (955), Expect = 5.968e-124
Identity = 198/414 (47.83%), Postives = 280/414 (67.63%), Query Frame = 1
Query:  136 ILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFE--ARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVP 1356
            +L  IF  Y+   DA++    NH+ V +     YP FQDV  M+F+GFGFLM FLQ+YG+SSVG  F +A +++QWA ++ GF+ S H   I++   SL+NA+F    +LISFG VLGKT P Q+L+M+ +E  LF +NE+I   LL V D G S+ +HTFGAYFGLFLS V+++ ++  S++ +SS+Y+SDLFAMIGT+ LW+FWPSFNS     G+ +HR VVNT+ SL AST+ TF +SALV   G+++MVH+ NA L+GGV VG S+ +ML P+GA   G +AG VSTLGYK+ TP L ++    DTCGV+NLHGMPG++  I+  +     T+E YG  +  +F   A+  R+A+ QA YQ+  + VT   A++ G+L GL+L++  L+      + Q F D+ +WEVP
Sbjct:   25 LLFAIFVRYNHETDAALWHWGNHSNVDNEFYFRYPSFQDVHVMVFVGFGFLMVFLQRYGFSSVGFTFLVASLTLQWATLLQGFLHSFHGGHIHVGVESLINADFCAGAVLISFGAVLGKTGPAQLLLMALLEAVLFSVNEFILLSLLGVRDAGGSMTIHTFGAYFGLFLSWVLYRSQLEKSRHRQSSVYNSDLFAMIGTIFLWVFWPSFNSAPTALGDGQHRTVVNTYYSLTASTLSTFALSALVSGDGRLDMVHVQNAALAGGVVVGTSSEMMLTPFGALAAGFLAGTVSTLGYKFFTPILESRFKLQDTCGVHNLHGMPGVLGAILGVVVAALATHEAYGDGLQSVFPLIAKGQRSATSQAVYQLFGMFVTLVFASVGGSLGGLLLRLPFLD---SPPDSQCFEDQVYWEVP 435          
BLAST of Ammonium transporter Rh type B vs. Ensembl Mouse
Match: Gm38392 (predicted gene, 38392 [Source:MGI Symbol;Acc:MGI:5613632])

HSP 1 Score: 356.295 bits (913), Expect = 6.365e-118
Identity = 193/394 (48.98%), Postives = 270/394 (68.53%), Query Frame = 1
Query:  196 ANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFE--ARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVP 1356
            AN   +Q  LSS    FQDV  M+F+GFGFLM FLQ+YG+SSVG  F +A +++QWA ++ GF+ S H   I++   SL+NA+F    +LISFG VLGKT P Q+L+M+ +E  LF +NE+I   LL V D G S+ +HTFGAYFGLFLS V+++ ++  S++ +SS+Y+SDLFAMIGT+ LW+FWPSFNS     G+ +HR VVNT+ SL AST+ TF +SALV   G+++MVH+ NA L+GGV VG S+ +ML P+GA   G +AG VSTLGYK+ TP L ++    DTCGV+NLHGMPG++  I+  +     T+E YG  +  +F   A+  R+A+ QA YQ+  + VT   A++ G+L GL+L++  L+      + Q F D+ +WEVP
Sbjct:   27 ANFLTIQTKLSS---GFQDVHVMVFVGFGFLMVFLQRYGFSSVGFTFLVASLTLQWATLLQGFLHSFHGGHIHVGVESLINADFCAGAVLISFGAVLGKTGPAQLLLMALLEAVLFSVNEFILLSLLGVRDAGGSMTIHTFGAYFGLFLSWVLYRSQLEKSRHRQSSVYNSDLFAMIGTIFLWVFWPSFNSAPTALGDGQHRTVVNTYYSLTASTLSTFALSALVSGDGRLDMVHVQNAALAGGVVVGTSSEMMLTPFGALAAGFLAGTVSTLGYKFFTPILESRFKLQDTCGVHNLHGMPGVLGAILGVVVAALATHEAYGDGLQSVFPLIAKGQRSATSQAVYQLFGMFVTLVFASVGGSLGGLLLRLPFLD---SPPDSQCFEDQVYWEVP 414          
BLAST of Ammonium transporter Rh type B vs. Ensembl Mouse
Match: Rhag (Rhesus blood group-associated A glycoprotein [Source:MGI Symbol;Acc:MGI:1202713])

HSP 1 Score: 355.91 bits (912), Expect = 8.978e-118
Identity = 193/436 (44.27%), Postives = 276/436 (63.30%), Query Frame = 1
Query:   97 FVITASLLQAFVFILLVIFSDYD----------SRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKM-GNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPDF 1362
            F + A  L+  + +L  +F +Y+          S  +AS  GN + +  +D    +YP FQDV  MIF+GFGFLMTFL+KYG+S VG N F+A + +QW  ++ G + SH    +    +++NA+F+TAT+LISFG VLGKT+PIQMLIM+ +E+ +F  NEY+   L   SD G S+ +H FGAYFGL ++ V+++  +     N+ S+YHSDLFAMIGTL LW+FWPSFNS     G+ ++RA+VNT+ SL A  I  + +S+LVE +G+++MVHI NATL+GGVAVG  A++ +  + A  IG IAG +S LGYK+ +P L NK+  HDTCGV+NLHG+PG+  G+                ++V I    ST + + QA    AAL  + G A + G LTGLILK+ + N   +  +E  ++D   W+VP F
Sbjct:    5 FPLMAISLEVAMIVLFGLFVEYETPQNASQKNASHQNASQQGNTSSSAKKDQFFQLYPLFQDVHVMIFVGFGFLMTFLKKYGFSGVGFNLFLAALGLQWGTIMQGLLHSHGKEFHFGIYNMINADFSTATVLISFGAVLGKTSPIQMLIMTILEIAVFAGNEYLVTELFEASDTGASMTIHAFGAYFGLAVAGVLYRPGLRCEHPNDESVYHSDLFAMIGTLFLWIFWPSFNSAIADPGDHQYRAIVNTYMSLAACVITAYALSSLVERRGRLDMVHIQNATLAGGVAVGTCADMEIPLYAAMTIGSIAGIISVLGYKFFSPLLANKLMIHDTCGVHNLHGLPGVFGGLA---------------SIVAISWGMSTASMAMQA----AALGSSIGSAIVGGLLTGLILKLPIWN---QPPDEYCYDDSVSWKVPKF 418          
BLAST of Ammonium transporter Rh type B vs. Ensembl Mouse
Match: Rhag (Rhesus blood group-associated A glycoprotein [Source:MGI Symbol;Acc:MGI:1202713])

HSP 1 Score: 335.109 bits (858), Expect = 2.920e-110
Identity = 182/405 (44.94%), Postives = 258/405 (63.70%), Query Frame = 1
Query:   97 FVITASLLQAFVFILLVIFSDYD----------SRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKM-GNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTG 1269
            F + A  L+  + +L  +F +Y+          S  +AS  GN + +  +D    +YP FQDV  MIF+GFGFLMTFL+KYG+S VG N F+A + +QW  ++ G + SH    +    +++NA+F+TAT+LISFG VLGKT+PIQMLIM+ +E+ +F  NEY+   L   SD G S+ +H FGAYFGL ++ V+++  +     N+ S+YHSDLFAMIGTL LW+FWPSFNS     G+ ++RA+VNT+ SL A  I  + +S+LVE +G+++MVHI NATL+GGVAVG  A++ +  + A  IG IAG +S LGYK+ +P L NK+  HDTCGV+NLHG+PG+  G+                ++V I    ST + + QA    AAL  + G A + G LTG
Sbjct:    5 FPLMAISLEVAMIVLFGLFVEYETPQNASQKNASHQNASQQGNTSSSAKKDQFFQLYPLFQDVHVMIFVGFGFLMTFLKKYGFSGVGFNLFLAALGLQWGTIMQGLLHSHGKEFHFGIYNMINADFSTATVLISFGAVLGKTSPIQMLIMTILEIAVFAGNEYLVTELFEASDTGASMTIHAFGAYFGLAVAGVLYRPGLRCEHPNDESVYHSDLFAMIGTLFLWIFWPSFNSAIADPGDHQYRAIVNTYMSLAACVITAYALSSLVERRGRLDMVHIQNATLAGGVAVGTCADMEIPLYAAMTIGSIAGIISVLGYKFFSPLLANKLMIHDTCGVHNLHGLPGVFGGLA---------------SIVAISWGMSTASMAMQA----AALGSSIGSAIVGGLLTG 390          
BLAST of Ammonium transporter Rh type B vs. Ensembl Mouse
Match: Rhcg (Rhesus blood group-associated C glycoprotein [Source:MGI Symbol;Acc:MGI:1888517])

HSP 1 Score: 333.183 bits (853), Expect = 3.998e-108
Identity = 193/461 (41.87%), Postives = 285/461 (61.82%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANH----TGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVING-FVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALV-EKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGK-NVVKIFEARSTR---TASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPDFIPGNYSVVDTEKKISIEL 1416
            T ++  LP  IT  +LQ  + +L  +F  YD + DA            + V++     YP FQDV  M+F+GFGFLMTFLQ+YG+S+VG NF +A   IQWAL++ G F       I L   +++ A+F  A+  ++FG VLGK +P+Q+LIM+F ++ LF +NE+I  +L+   D G S+ +HTFGAYFGL ++ ++++K +  SK  +SS+YHSDLFAMIGTL LW++WPSFNS     G+ +HRA +NT+ SL AS + T  +S++V +KGK++MVHI NATL+GGV VG +A +ML P+GA ++G   G  STLG+ Y+TP L ++    DTCG++NLHG+PG+I GIV A+   + + + YG+  +V  F   S +       Q   Q+  LL++  +A + G + G ILK+       +  +E  F D  +WEV + +   Y   D   K S  L
Sbjct:    5 TNLRGRLP--ITCLILQVTMVVLFGVFVRYDIQADAHWWLEKKRKNISSDVENEFYYRYPSFQDVHAMVFVGFGFLMTFLQRYGFSAVGFNFLLAAFGIQWALLMQGWFHYFEEGHIVLSVENIIQADFCVASSCVAFGAVLGKVSPMQLLIMTFFQVTLFTVNEFILLNLIEAKDAGGSMTIHTFGAYFGLTVTWILYRKNLDQSKQRQSSVYHSDLFAMIGTLFLWIYWPSFNSASSFHGDAQHRAALNTYLSLAASVLTTVTVSSIVHKKGKLDMVHIQNATLAGGVGVGTAAEMMLTPYGALIVGFFCGIFSTLGFAYLTPFLESRHRIQDTCGIHNLHGIPGIIGGIVGAVTAAYSSPDVYGEPGIVHSFGFGSYKMDWNKRMQGRSQIFGLLLSLAMALVGGIIVGFILKLPFWG---QAADENCFEDSIYWEVHEEVNTVYIPEDLAHKHSTSL 460          
BLAST of Ammonium transporter Rh type B vs. UniProt/SwissProt
Match: sp|Q6DCG4|RHBGB_XENLA (Ammonium transporter Rh type B-B OS=Xenopus laevis OX=8355 GN=rhbg-b PE=2 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 3.278e-131
Identity = 208/439 (47.38%), Postives = 284/439 (64.69%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDA----SITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFE--ARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVP 1356
            T M+  LP      LLQ    IL  +F  YD   DA        N + +   +     YP FQDV  MIF+GFGFLMTFL++YG+SSV  NF IA   +QW+ +I GF    H  +I++   S++NA+F T  +LISFG VLGKT+P+Q++IM+ +E+ LF +NEYI  +++   D G S+ +HTFGAYFGL +SRV++++ +  S+  E S+YHSDLFAMIGT+ LWMFWPSFNS     G+ +HR V+NT+ SL A T+ TF  SAL+  +GK++MVHI NA L+GGVAVG S  +ML P+GA + G +AG +S LGYKY+TP L+ K+   DTCGV+NLHGMPG++  I+ AI  +F T + YG  +  +F   +  +RTA QQ+ YQ  ALLV  G A I G + G ILK+ +        + + F D  +WEVP
Sbjct:    6 TNMRIKLPLFCL--LLQFITIILFAVFVRYDHESDARGWHEELNNHSSSNADNDFYYRYPSFQDVHVMIFIGFGFLMTFLKRYGFSSVAFNFLIAAFGLQWSTLIQGFFHGFHDGKIHVGIESMINADFCTGAVLISFGAVLGKTSPVQLIIMTLVEVTLFGINEYIILNIVGAKDAGGSMTIHTFGAYFGLIVSRVLYREDLEKSRQREGSVYHSDLFAMIGTIYLWMFWPSFNSAVTAHGDDQHRTVMNTYYSLAACTLATFGFSALLNGEGKLDMVHIQNAALAGGVAVGTSGEMMLTPFGAMIAGTLAGMISVLGYKYLTPVLDSKLKIQDTCGVHNLHGMPGILGAIIGAIVALFATADIYGDGMGDVFPLISDGSRTAKQQSLYQFLALLVALGFAIIGGTVVGFILKLPIFGT---PSDAECFEDAIYWEVP 439          
BLAST of Ammonium transporter Rh type B vs. UniProt/SwissProt
Match: sp|Q0IIV2|RHBG_XENTR (Ammonium transporter Rh type B OS=Xenopus tropicalis OX=8364 GN=rhbg PE=2 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 1.683e-130
Identity = 207/439 (47.15%), Postives = 286/439 (65.15%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNA--NHT--GVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFE--ARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVP 1356
            T M+  LP  +   LL+    IL  +F  YD   DA    +   NH+    ++     YP FQDV  MIF+GFGFLMTFL++YG+SSV  NF IA   +QW+ +I GF    H  +I++   S++NA+F T  +LISFG VLGKT+P+Q+++M+ IE+ LF +NEYI  +++   D G S+ +HTFGAYFGL +SRV+++  +  S+  E S+YHSDLFAMIGT+ LWMFWPSFNS     G+ +HR V+NT+ SL A T+ TF  SAL+  +GK++MVHI NA L+GGVAVG S  +ML P+GA + G +AG +S LGYKY+TP L+ K+   DTCGV+NLHGMPG++  ++ AI  +F T E YG  +  +F   +  +RTA QQ+ YQ  ALLV  G A + G + G ILK+ +        + + F D  +WEVP
Sbjct:    6 TNMRIKLP--VFCLLLEFITIILFAVFVRYDHESDAKQWHDEMRNHSVQNAENDFYFRYPSFQDVHVMIFIGFGFLMTFLKRYGFSSVAFNFLIAAFGLQWSTLIQGFFHGFHDGKIHVGIESMINADFCTGAVLISFGAVLGKTSPVQLIVMTLIEVTLFGINEYIILNIVGAKDAGGSMTIHTFGAYFGLIVSRVLYRDDLEKSRQREGSVYHSDLFAMIGTIYLWMFWPSFNSAITAHGDDQHRTVMNTYYSLAACTLATFGFSALLNGEGKLDMVHIQNAALAGGVAVGTSGEMMLTPFGAMIAGTLAGMISVLGYKYLTPVLDSKLKIQDTCGVHNLHGMPGILGALIGAIVALFATAEIYGAGMEDVFPLISDGSRTAKQQSLYQFLALLVALGFAILGGLVVGFILKLPIFGT---PSDAECFEDAVYWEVP 439          
BLAST of Ammonium transporter Rh type B vs. UniProt/SwissProt
Match: sp|Q69D48|RHBGA_XENLA (Ammonium transporter Rh type B-A OS=Xenopus laevis OX=8355 GN=rhbg-a PE=2 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 2.364e-129
Identity = 207/439 (47.15%), Postives = 283/439 (64.46%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGN--ANHT--GVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEA--RSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVP 1356
            T M+  LP      +LQ    IL  +F  YD   DA    +   NH+     +     YP FQDV  MIF+GFGFLMTFL++YG+SSV  NF IA   +QW+ +I GF    H  +I++   S++NA+F T  +LISFG VLGKT+P+Q+++M+ IE+ LF +NEYI  +++   D G S+ +HTFGAYFGL +SRV+++  +  S+  E S+YHSDLFAMIGT+ LWMFWPSFNS     G+ +HR V+NT+ SL A T+ TF  SAL+  +GK++MVHI NA L+GGVAVG S  +ML P+GA + G +AG VS LGYKY+TP L+ K+   DTCGV+NLHGMPG++  ++ AI  +F T + YG  +  +F      +RTA QQ+ YQ  ALLV  G A + G + G ILK+ +        + + F D  +WEVP
Sbjct:    6 TNMRIKLPLFCL--ILQFITIILFAVFVRYDHESDARGWHDELKNHSTANADNDFYFRYPSFQDVHVMIFIGFGFLMTFLKRYGFSSVAFNFLIAAFGLQWSTLIQGFFHGFHDGKIHVGIESMINADFCTGAVLISFGAVLGKTSPVQLIVMTLIEVTLFGINEYIILNIVGAKDAGGSMTIHTFGAYFGLIVSRVLYRADLDKSRQREGSVYHSDLFAMIGTIYLWMFWPSFNSAVTAHGDDQHRTVLNTYYSLAACTLATFGFSALLNGEGKLDMVHIQNAALAGGVAVGTSGEMMLTPFGAMIAGTLAGIVSVLGYKYLTPVLDSKLKIQDTCGVHNLHGMPGILGAVIGAIVALFATADIYGDGMDDVFPMIFDGSRTAKQQSLYQFLALLVALGFAIVGGTVVGFILKLPLFGT---PSDAECFEDAVYWEVP 439          
BLAST of Ammonium transporter Rh type B vs. UniProt/SwissProt
Match: sp|Q7T070|RHBG_DANRE (Ammonium transporter Rh type B OS=Danio rerio OX=7955 GN=rhbg PE=2 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 4.003e-127
Identity = 196/431 (45.48%), Postives = 283/431 (65.66%), Query Frame = 1
Query:  148 IFSDYDSRIDASITGNANHTG-VQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNE-SSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIF-EA--RSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPDFIPGNYSVVDTEKKISIE 1413
            +  +Y+   DA      N T    +     YP FQDV  MIF+GFGFLMTFLQ+YG+SS+G NF IA  S+QWA ++ GF    H  +I++   S++NA+F T  +LISFG VLGKT+P+Q+L+M+ +E+ LF +NEYI   +L  +D G S+ +HTFGAYFGL ++R++H+  +  SK++ SS+YHSDLFAMIGT+ LWMFWPSFNS   + G+ +HR   NT+ SL A T+ TF  S+LV  +GK++MVHI NA L+GGVAVG +  +ML P+G+ ++G +AG +S LGYKY+TP + +K+   DTCG++NLHGMPG++  IV A+     + + YG  + K+F EA   S  +A  + G+Q  +L VT GIA I G +TG +LK+ +        + Q F D  +WEVP     ++ + +   +  +E
Sbjct:   28 VLVEYNDDTDAKKWNKNNSTDPATNEFYYRYPSFQDVHVMIFVGFGFLMTFLQRYGFSSMGFNFLIAAFSLQWATLMQGFFHGMHHGKIHVGVTSMINADFCTGAVLISFGAVLGKTSPVQLLVMAILEVTLFAVNEYILLSILGANDAGGSMTIHTFGAYFGLMVTRILHRPNLDKSKHKNSSVYHSDLFAMIGTIFLWMFWPSFNSAITQYGDPQHRTAANTYYSLAACTLATFGFSSLVNPEGKLDMVHIQNAALAGGVAVGTAGEMMLTPFGSMIVGFLAGTISVLGYKYLTPFMESKLKIQDTCGIHNLHGMPGILGAIVGAVTAALASRDVYGNGLDKVFLEAADNSQWSAQTKGGFQAISLAVTLGIALIGGLITGFLLKLPIYGT---PPDTQCFEDAVYWEVPGEEEDHHELNEVSTQNEVE 455          
BLAST of Ammonium transporter Rh type B vs. UniProt/SwissProt
Match: sp|Q6XL41|RHCG_CHICK (Ammonium transporter Rh type C OS=Gallus gallus OX=9031 GN=RHCG PE=2 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 4.225e-126
Identity = 202/442 (45.70%), Postives = 287/442 (64.93%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANH----TGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVING-FVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKN-VVKIFE---ARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            T M+  LP +    L +  + IL  +F  +    DA            + +++     YP FQDV  MIF+GFGFLMTFL++YG+ +VG NF +A   IQWAL++ G F S    +I +   +L+NA+F   ++ ++FG +LGKT+P+Q+LIM+  ++ LF +NEYI  +LL V D G S+ +HTFGAYFGL ++R +++  +  SK+ E S+YHSDLFAMIGTL LWM+WPSFNS   E G+ +HRA +NT+CSL A  + T   S++++ KGK++MVHI NATL+GGVAVG SA +ML P+G+ ++G I G VST+GY Y+TP L +K+   DTCG++NLHGMPGLI GIV AI     T + YGK   +K F+   +  TRT S Q G+Q A ++V+  +A   G L G ILK+ +        +E  F D+ +WEVP+
Sbjct:   13 TYMRWRLPLICL--LWEVAMIILFGVFVHFGPEADAHWEEEKREMNLTSDIENDFYFRYPSFQDVHVMIFVGFGFLMTFLKRYGFGAVGFNFLLAAFGIQWALLMQGWFHSFQNGKILIGVENLINADFCVGSVCVAFGAILGKTSPVQLLIMTLFQVTLFAVNEYILLNLLHVKDAGGSMTIHTFGAYFGLTVTRFLYRPNLEQSKDKEGSVYHSDLFAMIGTLYLWMYWPSFNSAISEHGDAQHRAAINTYCSLAACVLTTMAFSSMLQKKGKLDMVHIQNATLAGGVAVGTSAEMMLTPYGSLIVGFICGIVSTVGYVYLTPILESKLHIQDTCGIHNLHGMPGLIGGIVGAITAAAATEDVYGKEGFIKAFDFTGSYKTRTPSIQGGFQAAGIVVSLLMAFAGGTLVGAILKLPIWG---DPADENCFEDDIYWEVPE 449          
BLAST of Ammonium transporter Rh type B vs. TrEMBL
Match: A0A4D5R9D1 (Rh-related protein OS=Scolopendra viridis OX=118503 PE=3 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.688e-139
Identity = 209/463 (45.14%), Postives = 301/463 (65.01%), Query Frame = 1
Query:  115 LLQAFVFILLVIFSDYDSRIDASITGNA---NHTGVQDTLSSV---YPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNK-IGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTR----------------------TASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD----FIPGNYSVVDTEKK 1401
            +LQ    IL  +  +YD   DAS   N+    H G     + V   YP FQDV  MIF+GFGFLMTFL++YGYS+VG+N  +  + +QWA +  GF  +H  +I++D  SLLNA+FA+AT+LISFG +LGKT+P+Q+L+M+ +E+ +F  NE++G H+   SDVG S+ VH FGAYFGL +S  +H+  +  +  E ++YHSD+FAMIGT+ LW+FWPSFN+    G  +HR V+NT+ +L A  + TF  S+LV+K  + NMVH+ N+TL+GGVA+G +A+LM++PWGA L+G+ AG +S LGY+YITP + K +  HDTCGV+NLHGMPG++AGI+ AI     + E YGKN+ + +  R+                        +AS QAGYQ+AAL +T  +A + G +TG+IL++  L+    D   Q F+DE FWE+P+     +P + + V  E  
Sbjct:   14 ILQTVFVILFGLLVEYDIEADASDPRNSKGLEHGGPDPDANPVRKYYPMFQDVHVMIFIGFGFLMTFLKRYGYSAVGVNMLLGAVVLQWATLCQGFFHNHGGKIHVDITSLLNADFASATVLISFGALLGKTSPLQLLVMAIVEIVIFAANEWVGLHVFWTSDVGASVLVHVFGAYFGLMVSLALHRPDIHQTNKEGAVYHSDVFAMIGTIFLWLFWPSFNAALAPGHAQHRVVINTYYALAACCVTTFAFSSLVDKHSRFNMVHVQNSTLAGGVAIGTAADLMIEPWGAMLVGIAAGFLSVLGYQYITPFMAKHLRIHDTCGVHNLHGMPGVLAGIIGAILASLASEENYGKNLYEQYPMRAPPANTSELAAITAVMGRIEPGKGWSASSQAGYQLAALFMTLAVACVGGLITGIILRLPFLDPLSTD---QLFDDEDFWEIPEEEPLVVPSHVTPVKQEDS 473          
BLAST of Ammonium transporter Rh type B vs. TrEMBL
Match: D7UQE3 (Rh-related protein OS=Branchiostoma floridae OX=7739 GN=RhR-2 PE=2 SV=1)

HSP 1 Score: 414.075 bits (1063), Expect = 1.760e-136
Identity = 210/441 (47.62%), Postives = 295/441 (66.89%), Query Frame = 1
Query:  130 VFILLV-IFSDYDSRIDASITGNA------NHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARST----------------------RTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            VFI+L  I   YD + +A+ T N+            + L + YP FQDV  M+F+GFGFLMTFL+KYG+ SVG NF +A   +QWA +++GF+  H  +I +D  +LL ++FA A +LIS G VLGK + IQ++IM+F+E+  F +NE++G       DVG S+FVH FGAYFGL ++RV++++ M     E S+YHSD+FAMIGT+ LW+FWPSFN+    G+ +HRAV+NT+ SL A  +VTF IS+ VEK GK+NMVH+ NATL+GGVA+G SA++M+ PWGA LIG IA  +S +GY YITP + +K+  HDTCGVNNLHGMPG++AGI+ AI     +   YG +V +IF AR+                       R+A  QAG+QMAAL+V+  +A ++GALTGL+L++ + +   KD     + DE +WE+P+
Sbjct:   18 VFIVLFGILVVYDDQANATATQNSLTPAQGGADADNNVLRAYYPMFQDVHVMMFIGFGFLMTFLKKYGFGSVGFNFLVAAFVLQWATLMSGFLHLHHGKIVVDITTLLTSDFAAAAVLISMGAVLGKVSHIQLIIMAFVEIIFFSINEWVGLTFFKAVDVGGSMFVHAFGAYFGLAVARVLYREDMVGHSKEGSVYHSDIFAMIGTVFLWLFWPSFNAALAPGDDQHRAVINTYFSLAACAVVTFAISSAVEKDGKVNMVHVQNATLAGGVAIGTSADMMVHPWGALLIGSIAAVLSVVGYSYITPFMADKLKIHDTCGVNNLHGMPGVLAGIIGAIVAAVASPAQYGNSVYQIFPARAPIENSTELATIQAAFPAIEAGNGRSAGLQAGFQMAALIVSVLVALVTGALTGLLLRLPIWDHPEKDS---MYEDEDYWEIPE 455          
BLAST of Ammonium transporter Rh type B vs. TrEMBL
Match: E9HAS9 (Ammonium_transp domain-containing protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_256122 PE=3 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 2.161e-136
Identity = 216/450 (48.00%), Postives = 302/450 (67.11%), Query Frame = 1
Query:   88 YLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQ-DTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLN-KIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARST----------------------RTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            ++PF++   +  AF+ IL  +F +YD   D+    NAN T  + +T+   YP FQDV  M+F+GFGFLMTFL+KYGYS+V +NF IA I +QWA +  GF  +    RI++   SLLNA+FA+AT+LISFG V+G TTP+Q+ +M+  E+ +F  NE++G  +L +SDVG S+ VH FGAYFGL +S V+ +    +S+ E + Y+SD+FAMIGT+ LW+FWPSFN+G  EG+ +HRAV+NT+ SL A  +  F ISALV K  K +MVHI N+TL+GGVA+G +A++M+ P+GA ++G IAG VS LGY+Y+TP +N ++G HDTCGV+NLHGMPG+IAGIV AI     T E YG ++ + F AR+                       R+AS Q GYQ+A L +T  IA   G +TGLIL++ +     K  ++  F+DE  WEVP+
Sbjct:   12 HIPFLL--GIQMAFI-ILFGVFVEYDKEADSGKAINANATTNEGNTIGHYYPMFQDVHVMMFIGFGFLMTFLKKYGYSAVAVNFLIAAIVLQWATLCQGFYHTFDGRRIHITITSLLNADFASATVLISFGAVIGVTTPLQLAVMAVCEIAIFASNEHLGLEILRISDVGASMLVHVFGAYFGLAVSCVLRRDV--SSEKEGATYNSDIFAMIGTIFLWLFWPSFNAGLAEGDAQHRAVINTYYSLAACCVTAFAISALVSKEHKFDMVHIQNSTLAGGVAIGTAADMMIHPFGAMIVGSIAGTVSVLGYRYLTPVVNRRLGIHDTCGVHNLHGMPGMIAGIVGAITAAAATQEEYGYSLYRQFSARAPLAGTPEFKALHHHIEHLEPGLGRSASMQGGYQIATLFITLAIAISGGLVTGLILRLPIFG---KVHQDHLFDDEMCWEVPE 453          
BLAST of Ammonium transporter Rh type B vs. TrEMBL
Match: D7UQE4 (Rh-related protein OS=Branchiostoma floridae OX=7739 GN=RhR-2 PE=2 SV=1)

HSP 1 Score: 412.149 bits (1058), Expect = 1.252e-135
Identity = 208/441 (47.17%), Postives = 295/441 (66.89%), Query Frame = 1
Query:  130 VFILLV-IFSDYDSRIDASITGNA------NHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARST----------------------RTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            VFI+L  I   YD + +A+ T N+            + L + YP FQDV  M+F+GFGFLMTFL+KYG+ SVG NF +A   +QWA +++GF+  H  +I +D  +LL ++FA A +LIS G VLGK + +Q++IM+F+E+  F +NE++G       DVG S+FVH FGAYFGL ++RV++++ M     E S+YHSD+FAMIGT+ LW+FWPSFN+    G+ +HRAV+NT+ SL A  +VTF IS+ VEK GK+NMVH+ NATL+GGVA+G SA++M+ PWGA LIG IA  +S +GY YITP + +K+  HDTCGV+NLHGMPG++AGI+ AI     +   YG +V +IF AR+                       R+A  QAG+QMAAL+V+  +A ++GALTGL+L++ + +   KD     + DE +WE+P+
Sbjct:   18 VFIVLFGILVVYDDQANATATQNSLTPAQGGADADNNVLRAYYPMFQDVHVMMFIGFGFLMTFLKKYGFGSVGFNFLVAAFVLQWATLMSGFLHLHHGKIVVDITTLLTSDFAAAAVLISMGAVLGKVSHVQLIIMAFVEIIFFSINEWVGLTFFKAVDVGGSMFVHAFGAYFGLAVARVLYREDMVGHSKEGSVYHSDIFAMIGTVFLWLFWPSFNAALAPGDDQHRAVINTYFSLAACAVVTFAISSAVEKDGKVNMVHVQNATLAGGVAIGTSADMMVHPWGALLIGSIAAVLSVVGYSYITPFMADKLKIHDTCGVHNLHGMPGVLAGIIGAIVAAVASPAQYGNSVYQIFPARAPIENSTELATIQAAFPAIEAGNGRSAGLQAGFQMAALIVSVLVALVTGALTGLLLRLPIWDHPEKDS---MYEDEDYWEIPE 455          
BLAST of Ammonium transporter Rh type B vs. TrEMBL
Match: D7UQE2 (Rh-related protein OS=Branchiostoma floridae OX=7739 GN=RhR-2 PE=2 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 2.073e-134
Identity = 208/441 (47.17%), Postives = 293/441 (66.44%), Query Frame = 1
Query:  130 VFILLV-IFSDYDSRIDASITGNA------NHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARST----------------------RTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            VFI+L  I   YD + +A+ T N+            + + + YP FQDV  M+F+GFGFLMTFL+KYG+ SVG NF +A   +QWA +++GF+  H  +I +D  +LL ++FA A +LIS G VLGK + IQ++IM+F+E+    +NE++G       DVG S+FVH FGAYFGL ++RV++++ M     E S YHSD+FAMIGT+ LW+FWPSFN+    G+ +HRAV+NT+ SL A  +VTF IS+ VEK GK+NMVH+ NATL+GGVA+G SA++M+ PWGA LIG IA  +S +GY YITP + +K+  HDTCGVNNLHGMPG++AGI+ AI     +   YG +V +IF AR+                       R+A  QAG+QMAAL+V+  +A ++GALTGL+L++ + +   KD     + DE +WE+P+
Sbjct:   18 VFIVLFGILVVYDDQANATATQNSLTPAQGGADADNNVVRAYYPMFQDVHVMMFIGFGFLMTFLKKYGFGSVGFNFLVAAFVLQWATLMSGFLHLHHGKIVVDITTLLTSDFAAAAVLISMGAVLGKVSHIQLIIMAFVEIIFVSINEWVGLTFFKAVDVGGSMFVHAFGAYFGLAVARVLYREDMVGHSKEGSNYHSDIFAMIGTVFLWLFWPSFNAALAPGDDQHRAVINTYFSLAACAVVTFAISSAVEKDGKVNMVHVQNATLAGGVAIGTSADMMVHPWGALLIGSIAAVLSVVGYSYITPFMADKLKIHDTCGVNNLHGMPGVLAGIIGAIVAAVASPAQYGNSVYQIFPARAPIENSTELATIQAAFPAIEAGNGRSAGLQAGFQMAALIVSVLVALVTGALTGLLLRLPIWDQPEKDS---MYEDEDYWEIPE 455          
BLAST of Ammonium transporter Rh type B vs. Ensembl Cavefish
Match: rhbg (Rh family B glycoprotein [Source:NCBI gene;Acc:103039811])

HSP 1 Score: 374.015 bits (959), Expect = 1.636e-124
Identity = 198/440 (45.00%), Postives = 282/440 (64.09%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSS-----VYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNES-SIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALV-EKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFE--ARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVP 1356
            T ++  LP V    +L+  + IL     +YD    A    + N T  +D          YP FQDV  MIF+GFGFLMTFLQ+YG+SSVG NF IA  ++QWA ++ GF    H  +I++   S++NA+F T ++LISFG VLGKT+P+Q+L+M+  E+ LF +NE+I   L    D G S+ +HTFGAYFGL ++RV++++ +  SK+++ S+YHSDLFAMIGT+ LWMFWPSFNS     G+ +HR  +NT+ SL A T+ T+  SALV  +GK++MVHI NA L+GGVAVG +  +ML P+G+ ++G +AG +S LGYKY++P L +K+   DTCGV+NLHGMPG++  +V  +     + E YG  +  +F   A  +  A  QAG Q  +L VT G+A + G + G ILK+ +        + Q F D  +WEVP
Sbjct:    5 TNLRIRLPIVCI--VLEVILIILFGTLVEYDDHTSAH-GWHDNKTKPKDPDYENEFYFRYPSFQDVHVMIFIGFGFLMTFLQRYGFSSVGFNFLIAAFALQWATLMQGFFHGMHHGKIHVGVESMINADFCTGSVLISFGAVLGKTSPVQLLVMAVFEVTLFAVNEFILLSLFGARDAGGSMTIHTFGAYFGLTVTRVLYRQNLEKSKSKNCSVYHSDLFAMIGTIYLWMFWPSFNSAVTAHGDDQHRTALNTYYSLAACTLATYAFSALVSHEGKLDMVHIQNAALAGGVAVGTAGEMMLTPFGSMIVGFLAGTISVLGYKYLSPVLESKLKIQDTCGVHNLHGMPGVLGAVVGIVTAAVASTEAYGNGMEDVFPSIADKSSNAYSQAGMQAVSLGVTLGMALLGGLIVGFILKLPIYGA---PPDTQCFEDSIYWEVP 438          
BLAST of Ammonium transporter Rh type B vs. Ensembl Cavefish
Match: rhag (Rh associated glycoprotein [Source:NCBI gene;Acc:103025823])

HSP 1 Score: 354.369 bits (908), Expect = 2.870e-117
Identity = 195/433 (45.03%), Postives = 279/433 (64.43%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYD----SRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNS-KNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFW 1347
            T M+  L F I A +L+    +L  +F  YD    S  DA    +  H    + ++ +YP FQDV  MIF+GFGFLMTFL++YG+SSVG+N  +A   +QW L++      H  +I +   S++NA+F+TAT+LISFG VLGKT+P+Q+LIM+ +E+  F +NE++   +L  SD+G S+ +H FGAYFGL ++RV+++  + N   NE S+YHSDLFAMIGT+ LWMFWPSFNS   E G  + RA+VNT+ SL A T+  +  S+LVE KGK++MVHI NATL+GGVAVG  A++ + P+GA +IG+ AG +STLG+K+++P L + +G  DTCGV+NLHGMPG++ G+   +A +    E    NV                G Q AAL  + G A + GA+TGLILK+       +  ++  F+D  +W
Sbjct:    6 TNMR--LKFPILALILELVTILLYALFVVYDDGESSGHDAKDNSSDPHHEKSNPVA-LYPMFQDVHVMIFIGFGFLMTFLKRYGFSSVGLNLLLAAFGLQWGLLLQNMWHMHDGKIMVSVGSMINADFSTATVLISFGAVLGKTSPVQLLIMTLLEITTFCINEHLAVTMLGASDIGASMTIHAFGAYFGLAVARVLYRPGLRNGHDNEGSVYHSDLFAMIGTVYLWMFWPSFNSAIAEPGAAQLRAIVNTYFSLAACTLAAYATSSLVEGKGKLDMVHIQNATLAGGVAVGTCADMAIGPFGAMVIGVCAGIISTLGFKFLSPILASSLGIQDTCGVHNLHGMPGILGGLAGILAALLGKKE----NVFP--------------GTQAAALASSIGFALVGGAITGLILKLPFWG---QPPDQNCFDDSIYW 414          
BLAST of Ammonium transporter Rh type B vs. Ensembl Cavefish
Match: rh50 (ammonium transporter Rh type B-like [Source:NCBI gene;Acc:111192686])

HSP 1 Score: 344.739 bits (883), Expect = 7.002e-113
Identity = 188/479 (39.25%), Postives = 291/479 (60.75%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHAT-RIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKM--GNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARST----------------------RTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPDFIPGNYSVVDTEKKISIELEER 1425
            T ++  LP ++ A  L+  + +L + F  YD + +A +  N     +++ +  VYP+F D+Q MIF+GFG L+ F ++YG+  +  NF +A  +IQWA++I GF   +   +I+L   +L+NAEF  A +LISFG VLGKT+P+Q+L+M+ +E+P+F + E+I    L ++D G SI VH F  YFGL  + ++++  +  G+SK E + YHSD+ +++GTL LW+FWPSFN    + G+ +HRA+++TF  L ASTI  F +SA++ K GK++M  + N TL+GGV VGAS ++M+ P  A ++GM+      LGYKY++P L  K+   D CG++NLHG+ GLIA I    A +  + ETYG ++ + F  R+                       RTA +QA YQ+AAL     IAA+ G LTGL+LK+  L       +E  F+DE F+ VP  +  NY V + +  +  E+E +
Sbjct:    6 TNLRVRLPALVFA--LEVMIVVLYIFFVTYDDQTNALLQNNETKP-LENAVYKVYPFFADIQVMIFIGFGCLLAFFRRYGFGGMAFNFLMATFAIQWAILIQGFFQFYDNGKIHLGVINLINAEFVCAVVLISFGAVLGKTSPVQLLVMALLEVPVFAVAEWIVVKYLKINDAGGSILVHLFACYFGLGTTFILYRPSLNKGHSK-ECTSYHSDMLSVLGTLFLWVFWPSFNCALTLRGDDQHRAILHTFIGLSASTITAFALSAMLSKNGKLSMADVQNVTLAGGVTVGASVDMMISPGAAYVLGMLGCTACMLGYKYLSPFLAQKLRIQDQCGIHNLHGLTGLIATIAGICAILLASEETYGTSLYQTFSYRAPQEGDPRLAELQKLIPGLEAGLGRTAQEQALYQLAALGTAIAIAAVGGMLTGLVLKLPYLA---SPTDESCFDDEIFFNVP--LHTNY-VPELQVPVGSEMENK 474          
BLAST of Ammonium transporter Rh type B vs. Ensembl Cavefish
Match: RHCG (ammonium transporter Rh type C 2-like [Source:NCBI gene;Acc:103032157])

HSP 1 Score: 344.354 bits (882), Expect = 1.215e-112
Identity = 186/426 (43.66%), Postives = 262/426 (61.50%), Query Frame = 1
Query:  121 QAFVFILLVIFSDYDSRIDASI-TGNANHTGVQDTLSSVY---PYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHAT---RIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISAL-VEKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNK-IGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKN-VVKIFEARST-RTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            Q  + IL   F  Y+  +DA   T    H    D+ +  Y   P FQDV  MIF+GFGFLMTFL++Y +  VG NF IA   IQWAL++ G+  S       I +   S++NA+F  A+ LI+FG  LGK +P+Q+++M+   + LF + EYI   LL V D G S+ +HTFG YFGL +S V+++  +  SK    S+YHSDLFAMIGTL LWMFWPSFNS     G+ +HRA +NT+ SL AS + ++ IS+L  +KGK++MVHI NATL+GGVA+G ++  M+ P+G+ ++G   G +ST GY  ++P + K +   DTCG++NLH MPG +  IV AI     +   Y K  +  +FE   T RTA QQ GYQ A L V    A + GA+ G IL++ +        ++  F+DE +WE+P+
Sbjct:   32 QIAMIILFGAFVRYNPEVDAHWPTYKKEHNITSDSENDFYYRYPSFQDVHVMIFVGFGFLMTFLKRYSFGGVGFNFLIAAFGIQWALLMQGWFHSLDPVDGTIKIGVESIINADFCVASCLIAFGGCLGKVSPVQLMVMTLFGVTLFAVEEYIILELLHVKDAGGSMTIHTFGGYFGLMVSWVLYRPNLHQSKRLHGSVYHSDLFAMIGTLFLWMFWPSFNSAIASHGDGQHRAAINTYLSLAASVLTSYAISSLSAKKGKLDMVHIQNATLAGGVAMGTASEFMITPYGSLIVGFFCGIISTFGYLVLSPFMEKHMKIQDTCGIHNLHAMPGFLGAIVGAITAATASESIYSKEGLANVFELVGTKRTAGQQGGYQAAGLCVALVFALVGGAIVGFILRLPIWG---DVADDNCFDDEVYWELPE 454          
BLAST of Ammonium transporter Rh type B vs. Ensembl Cavefish
Match: rh50 (ammonium transporter Rh type B-like [Source:NCBI gene;Acc:111192686])

HSP 1 Score: 340.887 bits (873), Expect = 1.812e-111
Identity = 187/479 (39.04%), Postives = 290/479 (60.54%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHAT-RIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKM--GNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARST----------------------RTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPDFIPGNYSVVDTEKKISIELEER 1425
            T ++  LP ++ A  L+  + +L ++F  YD + +A +  N     +++ +   YP+F D+Q MIF+GFG L+ F + YG+  +  NF +A  +IQWA++I GF   +   +I+L   +L+NAEF  A +LISFG VLGKT+P+Q+L+M+ +E+P+F + E+I    L ++D G SI VH F  YFGL  + ++++  +  G+SK E + YHSD+ +++GTL LW+FWPSFN    + G+ +HRA+++TF  L ASTI  F +SA++ K GK++M  + N TL+GGV VGAS ++M+ P  A ++GM+      LGYKY++P L  K+   D CG++NLHG+ GLIA I    A +  + ETYG ++ + F  R+                       RTA +QA YQ+AAL     IAA+ G LTGL+LK+  L       +E  F+DE F+ VP  +  NY V + +  +  E+E +
Sbjct:    6 TNLRVRLPALVFA--LEVMIVVLYIVFVTYDDQTNAFLQNNETKP-LENAVYKDYPFFADIQVMIFIGFGCLLAFFRHYGFGGMAFNFLMATFAIQWAILIQGFFQFYDNGKIHLGVINLVNAEFVCAVVLISFGAVLGKTSPVQLLVMALLEVPVFAVAEWIVVKYLKINDAGGSILVHLFACYFGLGTTFILYRPSLNKGHSK-ECTSYHSDMLSVLGTLFLWVFWPSFNCALTLRGDDQHRAILHTFIGLSASTITAFALSAMLSKNGKLSMADVQNVTLAGGVTVGASVDMMISPGAAYVLGMLGCTACMLGYKYLSPFLAQKLRIQDQCGIHNLHGLTGLIATIAGICAILLASEETYGTSLYQTFSYRAPQEGDPRLAELQKLIPGLEAGLGRTAQEQALYQLAALGTAIAIAAVGGMLTGLVLKLPYLA---SPTDESCFDDEIFFNVP--LHTNY-VPELQVPVGSEMENK 474          
BLAST of Ammonium transporter Rh type B vs. Ensembl Sea Lamprey
Match: rh50 (Rh50-like protein [Source:ZFIN;Acc:ZDB-GENE-000427-1])

HSP 1 Score: 325.865 bits (834), Expect = 1.357e-107
Identity = 177/362 (48.90%), Postives = 257/362 (70.99%), Query Frame = 1
Query:  235 YPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVS---SHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKM--GNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINM---VHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYG-KNVVKIFE---ARSTRTASQQAGYQMAALLVTFGIAAISGALTGLI 1275
            Y  FQDV  M+F+GFGFLMTFLQ+YGYSSVG NF IA   IQWA+++ G+V    S+   I ++  S++NA+F +A++LISFG VLGKT+P+Q+LIM+ IE  +F +NE++G ++L V D G S+ +H FGAYFGL ++R++++K +  G+ K E ++YHSDLFAMIGTL LWMFWPSFNS   + G+ + RAV++T+ SL +  + T +IS+L++  GK++M   VHI NA+L+GGVAVG   ++ML P+GA ++G IA  +ST G+KY+TP L +K+   DTCGV+NLHG+PG++AGI  A+     + E YG + + ++++       RT   Q G+Q   +LVT G+A   G +TG I
Sbjct:   27 YTRFQDVHVMVFVGFGFLMTFLQRYGYSSVGFNFMIAGFGIQWAILVQGWVQHFDSNTGTIKVNLESMINADFCSASVLISFGAVLGKTSPVQLLIMTVIEELIFSVNEFVGIYILRVKDAGGSMIIHIFGAYFGLTVTRMLYRKGLEEGHPK-EGAVYHSDLFAMIGTLFLWMFWPSFNSAIALHGDDQMRAVMHTYFSLASCVLTTIVISSLLDNHGKLDMVPPVHIQNASLAGGVAVGTCGDMMLSPYGALILGFIAAIISTFGFKYLTPILASKLKIQDTCGVHNLHGLPGIVAGIAGAVVAACASEEVYGFRRIAQVYQDIKPGQGRTPLLQGGFQALQILVTLGMAIGGGLVTGEI 387          
BLAST of Ammonium transporter Rh type B vs. Ensembl Nematostella
Match: EDO30704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T012])

HSP 1 Score: 331.257 bits (848), Expect = 1.832e-108
Identity = 181/429 (42.19%), Postives = 265/429 (61.77%), Query Frame = 1
Query:  145 VIFSDYDSRI--DASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALVEKG-KINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARST----------------------RTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEV 1353
            V+F DY   +  DA  T   N         + +P FQD+  ++ +GFG LMTFL+KYG+S +G NF I  + ++WA ++ GF      +I LD  S++  + A  TIL+SFG VLGKT+ +Q+L+MSFIE+  + +N  I    L   D G ++ VH FGAYFGL ++RV++ K     + E+S Y SDLFA +GT+ LW++WPSFNS  ++G  RHRAVVNT+ ++ AS +  F  S+LV K  K++MVHI NATL+GGVAVG  A++++ PWGA L+GM+ G +ST+GYKYI P L   +  HDTCGVN+LHGMPG++A I   +++       Y  ++  +F ARS                       RTA++QAGYQ AAL++T  ++++ G +TG I+K    +      E++ ++D  +WEV
Sbjct:   27 VVFVDYSKDVLPDAQNTLKIN---------TDFPVFQDIHVLLLVGFGLLMTFLKKYGFSGLGYNFLICAVVMEWATLMQGFFEMENNKIQLDIDSMIKGDLAAVTILVSFGAVLGKTSSLQLLLMSFIEVIFYTINRTICTTYLQAVDPGGAVLVHAFGAYFGLTVARVLYNKNSVAHEKEASRYTSDLFATLGTIFLWVYWPSFNSILVQGVLRHRAVVNTYYAMAASCVTVFAFSSLVTKASKLSMVHIQNATLAGGVAVGTIASMIIHPWGAILLGMVGGIISTIGYKYIQPWLIRTLHIHDTCGVNSLHGMPGILAAIASIVSSGLAGFGQYKTSLYTVFPARSPVINSTQYLELVQFVPDARAGLGRTATEQAGYQCAALVMTLAVSSMGGLITGFIVKQSFFD---PMTEDRMYDDLHYWEV 443          
BLAST of Ammonium transporter Rh type B vs. Ensembl Nematostella
Match: EDO37911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SED8])

HSP 1 Score: 321.627 bits (823), Expect = 3.053e-105
Identity = 176/428 (41.12%), Postives = 262/428 (61.21%), Query Frame = 1
Query:   97 FVITASLLQAFVFILLVIFSDY--DSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVING----FVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNK-IGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEV 1353
            F I   LLQ    ++  IF +Y  D+R +     N    G+ + ++  YP FQDV  MIFLG G L+ FL+ + YSS+   FF A I  +W+ +ING     +     +  +D  S +NA+FA A ILIS+ VVLGK + +Q+L+M  IE+ ++VLN +I    L +SD+G SI +H F AYFGL ++RV+H +    +  E S YH+D+F ++GT+ LW++WPSFN+    +   RHR V NT+ S++ + ++ F +S +  + GK N+ H+ NATL+GGVA+G ++N++++PWG+ LIG I GA+ TLGY Y++P L K    HD CGV+NLH +P  ++GI  AIA+     + YG             T SQQAG+Q+AA+ VT GI+ +SG LTG ++K+ +          Q F+DE FW V
Sbjct:    6 FTILTILLQVLFVVIFAIFGEYGDDARPNHK-RPNPGAAGI-NAVNIYYPMFQDVHVMIFLGIGLLLAFLRNHAYSSISYCFFAAAILCEWSTIINGVFWHIIEGGNDKFKIDLFSAINADFAAAVILISYCVVLGKISILQLLVMGVIELAVYVLNSWICFAKLGISDIGASITIHMFAAYFGLGVTRVLHSRDSEGNGKECSSYHNDVFCLVGTIFLWLYWPSFNACLTTDDVMRHRTVTNTYYSMLGACVMVFALSPMFRRDGKFNLSHVQNATLAGGVAIGTASNMIVQPWGSMLIGSIGGAMCTLGYVYLSPFLQKHCKMHDVCGVHNLHALPAFLSGIASAIASSLAAADEYGD-----------ATPSQQAGFQVAAMFVTIGISLLSGILTGFLIKLWIFE---PMSTRQMFDDEDFWMV 417          
BLAST of Ammonium transporter Rh type B vs. Ensembl Nematostella
Match: EDO37910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SED7])

HSP 1 Score: 307.76 bits (787), Expect = 4.072e-100
Identity = 168/400 (42.00%), Postives = 249/400 (62.25%), Query Frame = 1
Query:   97 FVITASLLQAFVFILLVIFSDY--DSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVING----FVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNK-IGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTG 1269
            F I   LLQ    ++  IF +Y  D+R +     N    G+ + ++  YP FQDV  MIFLG G L+ FL+K+ YSS+   FF A I  +W+ +ING     +     +  +D  S +NA+FA A ILIS+ VVLGK + +Q+L+M  IE+ ++VLN +I    L +SD+G SI +H F AYFGL ++RV+H +    +  E S YH+D+F ++GT+ LW++WPSFN+    +   RHR V NT+ S++ + ++ F +S +  + GK N+ H+ NATL+GGVA+G ++N++++PWG+ LIG I GA+ TLGY Y++P L K    HD CGV+NLH +P  ++GI  AIA+     + YG             T  QQAG+Q+AA+ VT GI+ +SG LTG
Sbjct:    6 FTILTILLQVLFVVIFAIFGEYGDDARPNHK-RPNPGAAGI-NAVNIYYPMFQDVHVMIFLGIGLLLAFLRKHAYSSISYCFFAAAILCEWSTIINGVFWHIIEGGNDKFKIDLFSAINADFAAAVILISYCVVLGKISILQLLVMGVIELAVYVLNSWICFAKLGISDIGASITIHMFAAYFGLGVTRVLHSRDSEGNGKECSSYHNDVFCLVGTIFLWLYWPSFNACLTTDDVMRHRTVTNTYYSMLGACVMVFALSPMFRRDGKFNLSHVQNATLAGGVAIGTASNMIVQPWGSMLIGSIGGAMCTLGYVYLSPFLKKHCKMHDVCGVHNLHALPAFLSGIASAIASSLAAADEYGD-----------ATPGQQAGFQVAAMFVTMGISLLSGILTG 392          
BLAST of Ammonium transporter Rh type B vs. Ensembl Nematostella
Match: EDO36089 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJM6])

HSP 1 Score: 276.944 bits (707), Expect = 1.289e-87
Identity = 161/397 (40.55%), Postives = 240/397 (60.45%), Query Frame = 1
Query:  262 MIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS--HA-TRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFV-LNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNS--GGIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNK-IGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYG-KNVVKIFEAR----------------------STRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            MIF  F FL++FL+++GYS +   FF A ++ QWA++ +G  +   H    I ++  SL  A++ TA +LI++   +G  +P Q++I+SF  +P+F  L E +  H L+++D G SI +H+FGAY+G+   R++++K   +   E + Y SD+F+M GTL LW++WPSFN   G  + E +HR VVNT+  L++ T++ FI+S L  K GK  M HI NATL+GGVAVG +AN+M+ PWGA L+G + G +STLG+ Y++P L K +  +D  GVNNLHGMPG++ GI  A+ +     ETYG + +  +F AR                      S RTA  Q  YQ A L    GIA I G LTGL+ + +  N     K+ Q ++D  F+ +PD
Sbjct:    1 MIFFAFPFLLSFLKRFGYSGICTAFFGASLAAQWAIICSGVFTGLIHGEAHIQVNIQSLCLADYTTAVVLIAYCTTMGYASPTQLIIISFF-LPIFYGLLEMVLFHYLLIADAGGSILIHSFGAYYGMAFCRMMYRKDAVDHPKEDASYTSDMFSMAGTLFLWIYWPSFNGVFGAPDYEAQHRIVVNTYLGLLSGTVMVFIVSFLTSKDGKFTMAHIQNATLAGGVAVGTAANMMMYPWGALLVGAMGGTISTLGFVYMSPLLLKYLKINDVAGVNNLHGMPGILGGIAGAVISAHAQPETYGHQGLYSVFSARAPMVNTTEYVQLQEMGVAFTPGSGRTARLQGCYQAAGLAAAIGIALIGGLLTGLVARFRAFN---PLKKHQLYDDFDFYVLPD 393          
BLAST of Ammonium transporter Rh type B vs. Ensembl Nematostella
Match: EDO26607 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBK0])

HSP 1 Score: 65.4698 bits (158), Expect = 9.633e-14
Identity = 29/52 (55.77%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  883 VHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNKI 1038
            VHI NATL+GGVA+G ++N+++ PWGA L+G I+G +STLGY Y+T   + I
Sbjct:    1 VHIQNATLAGGVAIGTASNMVIYPWGALLVGSISGTISTLGYAYLTVSFSCI 52          
BLAST of Ammonium transporter Rh type B vs. Ensembl Medaka
Match: rhbg (RhBG-like protein [Source:NCBI gene;Acc:100125813])

HSP 1 Score: 369.392 bits (947), Expect = 1.023e-122
Identity = 205/439 (46.70%), Postives = 287/439 (65.38%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHT----GVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSS-HATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNES-SIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALV-EKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFE--ARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVP 1356
            T M+  LP  IT  +LQ  + IL  +   YD   DA    + NH+     +++     YP FQDV  MIF+GFGFLMTFLQ+YG+SSVG NF IA  S+QWA ++ GF    H  +I++   S++NA+F T ++LISFG VLGKT+P+Q+L M+  E+ LF +NE+I   LL   D G S+ +HTFGAYFGL ++R++++  +  SK+++ S+YHSDLFAMIGTL LWMFWPSFNS   E G+ +HR  +NT+ SL A T+ T+ +S+L    GK++MVHI NA L+GGVA G +  +ML P+G+ ++G +AG +S LG+KY+TP L NK+   DTCG++NLHGMPG++  IV A+     + E YG+ + K+F   A   RTAS Q G Q  +L VT G+A   G + G ILK+ +       ++   F D  +WEVP
Sbjct:    6 TNMRLKLP--ITCFILQIILIILFGVLVQYDEDTDAKKHHHGNHSESKSDIENDFYYRYPSFQDVHVMIFVGFGFLMTFLQRYGFSSVGFNFLIAAFSLQWATLMQGFFHGLHEGKIHIGVESMINADFCTGSVLISFGAVLGKTSPVQLLFMAVFEVTLFAVNEFILLTLLGTRDAGGSMTIHTFGAYFGLMVTRILYRPNLDKSKHKNCSVYHSDLFAMIGTLYLWMFWPSFNSAVTEHGDPQHRTAMNTYYSLAACTLSTYAMSSLTAHDGKLDMVHIQNAALAGGVAAGTAGEMMLTPFGSMIVGFLAGIISVLGFKYLTPILENKLKIQDTCGIHNLHGMPGVLGAIVGAVTASLASKEVYGEGLEKVFPDVASGKRTASDQGGVQAISLAVTLGMALFGGLIVGFILKLPIFGA---PRDTTCFEDSLYWEVP 439          
BLAST of Ammonium transporter Rh type B vs. Ensembl Medaka
Match: rhag (Rh associated glycoprotein [Source:NCBI gene;Acc:101169082])

HSP 1 Score: 352.443 bits (903), Expect = 1.417e-116
Identity = 197/428 (46.03%), Postives = 278/428 (64.95%), Query Frame = 1
Query:  148 IFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNS-KNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALVE-KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRL-NKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD--------FIPGNYSVVDTE 1395
            +F  YD         N+NHT        +YP FQDV  MIF+GFGFLMTFL+KYG+SSVGIN  +A   +QW L++ G       +I +D   ++NA+F+TAT+LISFG VLGKT+P+Q+LIM+ +E+ +F +NE++  ++L  +DVG S+ +H FGAYFGL ++RV+++  + N  +N+ S+YHSDLFAMIGT+ LWMFWPSFNS   E G  +  AV+NT+ SL A  +  + IS+LVE KGK++MVHI NATL+GGVAVG  A++ ++P+GA LIG++AG +STLG+KY++P L +K+G  DTCGV+NLHGMPG++ G+   +A         GK                 A  Q AAL  + G A I GA+TGLI+K+ V     +  ++  F+D  +WEVP+          P ++S   TE
Sbjct:   29 VFVTYDDGKGHGHDANSNHT---SNPVELYPMFQDVHVMIFIGFGFLMTFLKKYGFSSVGINLLLAAFGLQWGLLMQGVWHMDHGKIKVDVFKMINADFSTATVLISFGAVLGKTSPVQLLIMTILEITIFSINEHLVANILSANDVGASMIIHAFGAYFGLAVARVLYRPGLRNGHENDGSVYHSDLFAMIGTVFLWMFWPSFNSAIAEPGFVQLTAVINTYLSLAACVLSAYAISSLVEHKGKLDMVHIQNATLAGGVAVGTCADMNIQPFGAMLIGVVAGIISTLGFKYLSPVLASKLGIQDTCGVHNLHGMPGILGGLAGIVAVAL------GKK-------------DGSAAMQAAALASSLGFALIGGAITGLIMKLPVWG---QPPDQNCFDDSIYWEVPEADEESDGSLAPADHSKNKTE 431          
BLAST of Ammonium transporter Rh type B vs. Ensembl Medaka
Match: rhcgb (Rh family C glycoprotein [Source:NCBI gene;Acc:101168114])

HSP 1 Score: 343.969 bits (881), Expect = 1.028e-112
Identity = 184/437 (42.11%), Postives = 270/437 (61.78%), Query Frame = 1
Query:   73 TQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASI--TGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVS--SHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNK-IGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            T ++  LP V    + Q  + IL  IF  YD   DA    T   N + +++     YP FQDV  MIF+GFGFLMTFL++Y +  VG NF IA   +QWAL++ G+        +I ++  S++NA+F  A  LI++G +LGK +P+Q+++++   + LF + EYI  +L+   D G S+ +HTFGAY+GL +S ++++  +  S   + S+YHSD+FAMIGTL LWMFWPSFNS   E G+ +HRA +NT+ SL ++ +    +S++ +K GK++MVHI NATL+GGVAVG +A  ML P+G+ ++G   G +STLGY YITP L K +   DTCG++NLH MPG+I GIV AI     +   YG   +K+F+       +QQ G+Q  AL V        G L G IL++ +        ++  F+DE +WEVP+
Sbjct:   17 TNIRVSLPAVCI--VWQISMIILFGIFVRYDKESDAHWIETNPKNMSKIENDFYFRYPSFQDVHVMIFVGFGFLMTFLKRYSFGGVGFNFLIAAFGLQWALLMQGWFHHLGDDGKISINVYSMINADFCVAGCLIAYGALLGKVSPVQLMVLTLFGVTLFAVEEYIILNLIYAKDAGGSMVIHTFGAYYGLAISWMLYRPNLDQSSRLQGSVYHSDVFAMIGTLFLWMFWPSFNSAITEHGDGQHRAAINTYLSLASTVLTAVAVSSVYQKHGKLDMVHIQNATLAGGVAVGTAAEFMLMPYGSLIVGFCCGILSTLGYIYITPFLEKYLKIQDTCGIHNLHAMPGVIGGIVGAITAAAASESVYGTEGIKLFK----FPPAQQGGHQAGALCVALCFGIGGGILVGAILRLPIWG---DPADDNCFDDESYWEVPE 444          
BLAST of Ammonium transporter Rh type B vs. Ensembl Medaka
Match: rh50 (50 kD glycoprotein [Source:NCBI gene;Acc:100144346])

HSP 1 Score: 334.339 bits (856), Expect = 5.467e-109
Identity = 181/457 (39.61%), Postives = 275/457 (60.18%), Query Frame = 1
Query:   34 CQQAFHLLFYEFLTQMKDYLPFVITASLLQAFVFILLVIFSDYDSRIDA---SITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVS--SHAT-RIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSG-GIEGEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNK-IGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKN-VVKIF---EARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQY-FNDEPFWEVPD 1359
            C+ A +    +  T ++  LP V    + Q  + +L  +F  YD   DA    +    N T +Q+     YP FQDV  MIF+GFGFLMTFL++Y +S+VG NF IA   +QWAL++ G+     ++T +IY+   SL+NA+F  A  LI++G +LGK +P+Q+++++   + LF + EYI   LL   D G ++ +H FG Y+GL +S V+++  +  SK    S+YHSDLFAMIGTL LWMFWPSFNS     G+ +HR  +NT+ +L +S + T  +S++ +K GK++MVHI NATL+GGVA+G +A  M+ P+G+ ++G   G +ST GY Y+TP L K +   DTCG++NLH +PG++ G + AI     +   Y K  ++  F        R+   Q G+Q A + V      + GA+ G ILK  +    + D  + Y F+DE +WE+P+
Sbjct:    5 CESASNFFGPQKNTNVRVSLPAV--CFVWQIAMIVLFGVFIRYDEESDAHWVELKKTENLTDLQNEFYFRYPSFQDVHVMIFVGFGFLMTFLKRYSFSAVGFNFLIAAFGLQWALLMQGWFHHFDYSTGKIYIGIESLINADFCCAASLIAYGAILGKVSPVQLMVVTLFGVTLFAVEEYIILDLLHCRDSGGAMVIHCFGGYYGLAISWVLYRPNLHRSKRLNGSVYHSDLFAMIGTLFLWMFWPSFNSAIANHGDGQHRTAMNTYIALASSVLTTVALSSMSKKEGKLDMVHIQNATLAGGVAMGTAAEFMITPYGSLIVGFCIGIISTFGYLYVTPFLEKRLKLQDTCGIHNLHAVPGMLGGFIGAIVAATASESVYSKQGLIDTFGFTGKYENRSPGTQGGFQAAGVCVAMAFGLVGGAIVGFILKFPI----WGDAADDYCFDDEAYWELPE 455          
BLAST of Ammonium transporter Rh type B vs. Ensembl Medaka
Match: rhcgb (Rh family C glycoprotein [Source:NCBI gene;Acc:101168114])

HSP 1 Score: 333.954 bits (855), Expect = 6.324e-109
Identity = 176/410 (42.93%), Postives = 257/410 (62.68%), Query Frame = 1
Query:  160 YDSRIDASITGNANHTGVQDTLSS----VYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVS--SHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKN-ESSIYHSDLFAMIGTLVLWMFWPSFNSGGIE-GEQRHRAVVNTFCSLIASTIVTFIISALVEK-GKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNK-IGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            +DS I A  T        +  LS+    V P FQDV  MIF+GFGFLMTFL++Y +  VG NF IA   +QWAL++ G+        +I ++  S++NA+F  A  LI++G +LGK +P+Q+++++   + LF + EYI  +L+   D G S+ +HTFGAY+GL +S ++++  +  S   + S+YHSD+FAMIGTL LWMFWPSFNS   E G+ +HRA +NT+ SL ++ +    +S++ +K GK++MVHI NATL+GGVAVG +A  ML P+G+ ++G   G +STLGY YITP L K +   DTCG++NLH MPG+I GIV AI     +   YG   +K+F+       +QQ G+Q  AL V        G L G IL++ +        ++  F+DE +WEVP+
Sbjct:   30 FDSAIRAGWTDRMEKGLFRYQLSALETRVLPGFQDVHVMIFVGFGFLMTFLKRYSFGGVGFNFLIAAFGLQWALLMQGWFHHLGDDGKISINVYSMINADFCVAGCLIAYGALLGKVSPVQLMVLTLFGVTLFAVEEYIILNLIYAKDAGGSMVIHTFGAYYGLAISWMLYRPNLDQSSRLQGSVYHSDVFAMIGTLFLWMFWPSFNSAITEHGDGQHRAAINTYLSLASTVLTAVAVSSVYQKHGKLDMVHIQNATLAGGVAVGTAAEFMLMPYGSLIVGFCCGILSTLGYIYITPFLEKYLKIQDTCGIHNLHAMPGVIGGIVGAITAAAASESVYGTEGIKLFK----FPPAQQGGHQAGALCVALCFGIGGGILVGAILRLPIWG---DPADDNCFDDESYWEVPE 432          
BLAST of Ammonium transporter Rh type B vs. Planmine SMEST
Match: SMESG000048384.1 (SMESG000048384.1)

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 358/360 (99.44%), Postives = 358/360 (99.44%), Query Frame = 1
Query:   79 MKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALVEKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVV 1158
            MKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALVEKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGK  V
Sbjct:    1 MKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALVEKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKKKV 360          
BLAST of Ammonium transporter Rh type B vs. Planmine SMEST
Match: SMESG000005978.1 (SMESG000005978.1)

HSP 1 Score: 401.749 bits (1031), Expect = 1.104e-135
Identity = 213/429 (49.65%), Postives = 285/429 (66.43%), Query Frame = 1
Query:   97 FVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALVE--------KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFVTNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLILKIKVLNVNYKDKEEQYFNDEPFWEVPD 1359
            F I A +LQ    ++      Y   IDA++  + +   V++     Y YFQDVQGM+FLGFGFLM FL+KYG+SS+G NFF+ V +I+WA+++ G        I ++   LLNAEF  A ILISFG VLGK +P+Q ++M+ +E+P+   NEY+GR      D GD+IFVHTFGAYFGL  + VI  K     +NE S Y+SDLF+M+GTLVLW+FWPSFN+GG   +++ RAVVNT  SL  S  +TF+I++ +         KGK NMV+I NATL+GGVAVGA A+LM++PWGA LIG +AG +STLGY+YITP L +I  HDTCGVNNLHGMPG++ GI  A+A     ++ YG  +  +F    TR+AS+QAGYQ+AAL  T  I    GA  G++L+   + +  K K+   FND  FW VP+
Sbjct:    9 FGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVENR----YFYFQDVQGMMFLGFGFLMVFLKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTRIYLHDTCGVNNLHGMPGIMGGIGSAVAASIADSKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTIAIGLAGGAFVGVLLRF--IPICDKPKKHDLFNDNRFWTVPE 431          
The following BLAST results are available for this feature:
BLAST of Ammonium transporter Rh type B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RHBG1.214e-12346.30Rh family B glycoprotein (gene/pseudogene) [Source... [more]
RHCG1.193e-12045.27Rh family C glycoprotein [Source:HGNC Symbol;Acc:H... [more]
RHAG1.902e-11543.56Rh associated glycoprotein [Source:HGNC Symbol;Acc... [more]
RHAG2.286e-11543.56Rh associated glycoprotein [Source:HGNC Symbol;Acc... [more]
RHAG2.160e-11343.53Rh associated glycoprotein [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Ammonium transporter Rh type B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rhr-12.751e-12245.50RH (Rhesus) antigen Related [Source:UniProtKB/TrE... [more]
rhr-12.751e-12245.50RH (Rhesus) antigen Related [Source:UniProtKB/TrE... [more]
rhr-21.266e-10343.58RH (Rhesus) antigen Related [Source:UniProtKB/TrE... [more]
back to top
BLAST of Ammonium transporter Rh type B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rh507.882e-11743.79gene:FBgn0028699 transcript:FBtr0331423[more]
Rh507.882e-11743.79gene:FBgn0028699 transcript:FBtr0345597[more]
Rh501.226e-11644.85gene:FBgn0028699 transcript:FBtr0073354[more]
back to top
BLAST of Ammonium transporter Rh type B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhbg5.303e-12845.48Rh family, B glycoprotein (gene/pseudogene) [Sourc... [more]
rhag5.523e-11844.55Rh associated glycoprotein [Source:ZFIN;Acc:ZDB-GE... [more]
rhcga9.042e-11540.56Rh family, C glycoprotein a [Source:ZFIN;Acc:ZDB-G... [more]
rhcgb2.996e-11441.99Rh family, C glycoprotein b [Source:NCBI gene;Acc:... [more]
rhcgl18.367e-11242.66Rh family, C glycoprotein, like 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Ammonium transporter Rh type B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhbg4.591e-13145.93Rh family B glycoprotein (gene/pseudogene) [Source... [more]
rhbg3.672e-13047.27Rh family B glycoprotein (gene/pseudogene) [Source... [more]
rhbg6.034e-13047.03Rh family B glycoprotein (gene/pseudogene) [Source... [more]
rhcg4.919e-11843.38Rh family C glycoprotein [Source:NCBI gene;Acc:445... [more]
rhbg7.348e-11844.55Rh family B glycoprotein (gene/pseudogene) [Source... [more]
back to top
BLAST of Ammonium transporter Rh type B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rhbg5.968e-12447.83Rhesus blood group-associated B glycoprotein [Sour... [more]
Gm383926.365e-11848.98predicted gene, 38392 [Source:MGI Symbol;Acc:MGI:5... [more]
Rhag8.978e-11844.27Rhesus blood group-associated A glycoprotein [Sour... [more]
Rhag2.920e-11044.94Rhesus blood group-associated A glycoprotein [Sour... [more]
Rhcg3.998e-10841.87Rhesus blood group-associated C glycoprotein [Sour... [more]
back to top
BLAST of Ammonium transporter Rh type B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DCG4|RHBGB_XENLA3.278e-13147.38Ammonium transporter Rh type B-B OS=Xenopus laevis... [more]
sp|Q0IIV2|RHBG_XENTR1.683e-13047.15Ammonium transporter Rh type B OS=Xenopus tropical... [more]
sp|Q69D48|RHBGA_XENLA2.364e-12947.15Ammonium transporter Rh type B-A OS=Xenopus laevis... [more]
sp|Q7T070|RHBG_DANRE4.003e-12745.48Ammonium transporter Rh type B OS=Danio rerio OX=7... [more]
sp|Q6XL41|RHCG_CHICK4.225e-12645.70Ammonium transporter Rh type C OS=Gallus gallus OX... [more]
back to top
BLAST of Ammonium transporter Rh type B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D5R9D11.688e-13945.14Rh-related protein OS=Scolopendra viridis OX=11850... [more]
D7UQE31.760e-13647.62Rh-related protein OS=Branchiostoma floridae OX=77... [more]
E9HAS92.161e-13648.00Ammonium_transp domain-containing protein OS=Daphn... [more]
D7UQE41.252e-13547.17Rh-related protein OS=Branchiostoma floridae OX=77... [more]
D7UQE22.073e-13447.17Rh-related protein OS=Branchiostoma floridae OX=77... [more]
back to top
BLAST of Ammonium transporter Rh type B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhbg1.636e-12445.00Rh family B glycoprotein [Source:NCBI gene;Acc:103... [more]
rhag2.870e-11745.03Rh associated glycoprotein [Source:NCBI gene;Acc:1... [more]
rh507.002e-11339.25ammonium transporter Rh type B-like [Source:NCBI g... [more]
RHCG1.215e-11243.66ammonium transporter Rh type C 2-like [Source:NCBI... [more]
rh501.812e-11139.04ammonium transporter Rh type B-like [Source:NCBI g... [more]
back to top
BLAST of Ammonium transporter Rh type B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rh501.357e-10748.90Rh50-like protein [Source:ZFIN;Acc:ZDB-GENE-000427... [more]
back to top
BLAST of Ammonium transporter Rh type B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ammonium transporter Rh type B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO307041.832e-10842.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379113.053e-10541.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379104.072e-10042.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360891.289e-8740.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266079.633e-1455.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ammonium transporter Rh type B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhbg1.023e-12246.70RhBG-like protein [Source:NCBI gene;Acc:100125813][more]
rhag1.417e-11646.03Rh associated glycoprotein [Source:NCBI gene;Acc:1... [more]
rhcgb1.028e-11242.11Rh family C glycoprotein [Source:NCBI gene;Acc:101... [more]
rh505.467e-10939.6150 kD glycoprotein [Source:NCBI gene;Acc:100144346... [more]
rhcgb6.324e-10942.93Rh family C glycoprotein [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Ammonium transporter Rh type B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000048384.10.000e+099.44SMESG000048384.1[more]
SMESG000005978.11.104e-13549.65SMESG000005978.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019771 ID=SMED30019771|Name=Ammonium transporter Rh type B|organism=Schmidtea mediterranea sexual|type=transcript|length=1630bp
TAAATATATATTGAAATATCTAAGAACTTTTATTGTCAGCAAGCATTTCA
TTTATTGTTTTATGAATTTTTAACACAAATGAAGGACTATCTACCTTTTG
TCATTACAGCTTCACTTCTCCAGGCTTTTGTATTTATTCTTTTAGTTATC
TTCAGTGATTATGACTCCAGAATTGATGCTTCTATTACCGGAAATGCTAA
CCATACTGGTGTACAGGATACCCTTAGCAGTGTCTATCCATACTTTCAGG
ATGTTCAAGGAATGATATTTCTGGGATTTGGATTTTTAATGACTTTTTTA
CAAAAATATGGCTATAGTAGTGTTGGAATCAACTTTTTCATTGCAGTCAT
CAGCATTCAATGGGCTCTTGTTATCAATGGTTTTGTAAGTAGTCACGCAA
CGAGAATCTATTTGGATGGGGCGAGCCTATTGAACGCTGAATTCGCTACC
GCAACGATTTTAATCAGTTTTGGAGTTGTTCTCGGGAAAACGACTCCAAT
ACAAATGCTAATCATGAGCTTCATTGAAATGCCGTTGTTCGTCCTTAATG
AGTATATTGGAAGACATTTATTAATGGTATCTGATGTTGGAGATTCCATC
TTCGTCCACACGTTTGGAGCTTATTTTGGACTGTTTCTGAGCCGAGTCAT
CCACAAGAAGAAAATGGGTAACTCAAAAAACGAAAGTTCAATTTACCATT
CCGATTTGTTTGCAATGATTGGAACCTTGGTACTGTGGATGTTCTGGCCA
AGTTTTAACAGTGGTGGAATAGAAGGTGAACAAAGGCACAGGGCGGTTGT
TAACACATTTTGCTCATTGATAGCATCGACAATTGTCACATTTATAATCA
GTGCTTTAGTTGAAAAGGGAAAAATAAACATGGTTCATATTGCTAATGCT
ACTTTATCTGGAGGAGTGGCTGTGGGAGCATCGGCAAATTTAATGTTGAA
GCCTTGGGGAGCATGTTTAATCGGAATGATTGCTGGGGCAGTGTCTACTC
TCGGATATAAATATATTACGCCAAGACTCAATAAAATTGGATTCCATGAT
ACATGTGGAGTGAATAACCTCCATGGGATGCCGGGATTAATTGCTGGTAT
TGTAATGGCAATAGCTACAGTTTTCGTCACAAATGAAACCTATGGAAAAA
ATGTGGTGAAAATATTTGAAGCAAGATCAACTAGGACAGCAAGCCAACAA
GCAGGATATCAAATGGCCGCACTATTGGTGACGTTTGGAATTGCTGCTAT
TTCGGGTGCTCTCACAGGTTTGATATTGAAAATCAAAGTATTAAATGTGA
ACTACAAAGATAAGGAAGAACAATATTTCAACGATGAACCGTTTTGGGAG
GTTCCTGATTTCATTCCAGGAAATTACAGTGTGGTGGATACCGAAAAGAA
AATTAGCATAGAATTAGAGGAAAGAGCATAAAAATTGTTTCCACAGAAAT
GACAACGACTTTCAGTTTGGAAAATTTTGATTTTTAGTTGTGTTCAATTA
AAAAAAATAGTGTATTTTATTTTATTTTATTATATACCGTCTGTAATGAA
TTAGATACATTTTGCTTTAGTAAGTAAAAAGAATCAAAATATCACAATTT
GAATTTAGTGAAATAAATCTTGTAATCTTC
back to top

protein sequence of SMED30019771-orf-1

>SMED30019771-orf-1 ID=SMED30019771-orf-1|Name=SMED30019771-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=451bp
MKDYLPFVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLS
SVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVIN
GFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIE
MPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSK
NESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIAS
TIVTFIISALVEKGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGM
IAGAVSTLGYKYITPRLNKIGFHDTCGVNNLHGMPGLIAGIVMAIATVFV
TNETYGKNVVKIFEARSTRTASQQAGYQMAALLVTFGIAAISGALTGLIL
KIKVLNVNYKDKEEQYFNDEPFWEVPDFIPGNYSVVDTEKKISIELEERA
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002028dorsal-ventral muscle cell
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR002229RhesusRHD
IPR029020Ammonium/urea_transptr
IPR024041NH4_transpt_AmtB-like_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0016323basolateral plasma membrane
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
Vocabulary: biological process
TermDefinition
GO:0015696ammonium transport
GO:0006810transport
GO:0072488ammonium transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0008519ammonium transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002229Blood group Rhesus C/E/D polypeptidePRINTSPR00342RHESUSRHDcoord: 333..349
score: 25.49
coord: 119..135
score: 52.29
coord: 53..70
score: 57.41
coord: 142..165
score: 23.61
coord: 176..191
score: 44.1
coord: 239..261
score: 38.16
coord: 210..228
score: 83.92
coord: 296..314
score: 41.81
coord: 273..286
score: 71.83
coord: 82..99
score: 33.95
IPR024041Ammonium transporter AmtB-like domainPFAMPF00909Ammonium_transpcoord: 40..404
e-value: 8.0E-73
score: 245.4
IPR029020Ammonium/urea transporterGENE3DG3DSA:1.10.3430.10coord: 2..428
e-value: 3.8E-167
score: 558.6
NoneNo IPR availablePANTHERPTHR11730AMMONIUM TRANSPORTERcoord: 8..408
NoneNo IPR availablePANTHERPTHR11730:SF60RH50, ISOFORM Bcoord: 8..408
NoneNo IPR availableSUPERFAMILYSSF111352Ammonium transportercoord: 55..402
NoneNo IPR availableTMHMMTMhelixcoord: 77..99
NoneNo IPR availableTMHMMTMhelixcoord: 266..288
NoneNo IPR availableTMHMMTMhelixcoord: 205..224
NoneNo IPR availableTMHMMTMhelixcoord: 114..136
NoneNo IPR availableTMHMMTMhelixcoord: 239..261
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 378..400
NoneNo IPR availableTMHMMTMhelixcoord: 143..165
NoneNo IPR availableTMHMMTMhelixcoord: 175..192
NoneNo IPR availableTMHMMTMhelixcoord: 293..315
NoneNo IPR availableTMHMMTMhelixcoord: 328..350