UPF0764 protein C16orf89 homolog

Overview
NameUPF0764 protein C16orf89 homolog
Smed IDSMED30019766
Length (bp)1028
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019766

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30019766h1SMcG0015594 SmedASXL_001670SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30019766h1SMcG0015594 dd_Smed_v4_21285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30019766h1SMcG0015594 dd_Smed_v4_21285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30019766h1SMcG0015594 dd_Smed_v4_21285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30019766h1SMcG0015594 dd_Smed_v6_21285_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30019766h1SMcG0015594 OX_Smed_1.0.12889ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Human
Match: C16orf89 (chromosome 16 open reading frame 89 [Source:HGNC Symbol;Acc:HGNC:28687])

HSP 1 Score: 68.1662 bits (165), Expect = 4.194e-12
Identity = 50/171 (29.24%), Postives = 82/171 (47.95%), Query Frame = 2
Query:   98 ILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILAN--KETRLWKGILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYII--RSETYGERFGDDCMSLLMGTS--GNDKCTITLKCWKMMTAHGFSNYSLTHQVFFFNW 592
            IL+  ++   F+  R   +NLDG++G+R+ +  LKS+     +E  L    L      + L   I ++S+  LK   P Y  +    +  GFWK  LP   I+  +   Y      +++ E   D C+  L+GT    ++ C ++  C  +MT  G S Y L+HQ+ FF W
Sbjct:   39 ILSALERATVFLEQRLPEINLDGMVGVRVLEEQLKSVREKWAQEPLLQPLSLRVGMLGEKLEAAI-QRSLHYLKLSDPKYLREFQLTLQPGFWK--LPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLW 206          

HSP 2 Score: 57.3806 bits (137), Expect = 1.390e-8
Identity = 32/91 (35.16%), Postives = 50/91 (54.95%), Query Frame = 3
Query:  744 DLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPN-GCYGIMENENFNLEN-LDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFL 1010
            D+ ME I  CG  G+   F   +W++AI+SWQ+   GC+G  + E+  L   +   ++ + R KR E     DGC +H +  A++AL  FL
Sbjct:  249 DIFMENIMFCGMGGF-SDFYKLRWLEAILSWQKQQEGCFGEPDAEDEELSKAIQYQQHFSRRVKRREKQFP-DGCSSHNTATAVAALGGFL 337          
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Human
Match: C16orf89 (chromosome 16 open reading frame 89 [Source:HGNC Symbol;Acc:HGNC:28687])

HSP 1 Score: 68.1662 bits (165), Expect = 4.288e-12
Identity = 50/171 (29.24%), Postives = 82/171 (47.95%), Query Frame = 2
Query:   98 ILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILAN--KETRLWKGILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYII--RSETYGERFGDDCMSLLMGTS--GNDKCTITLKCWKMMTAHGFSNYSLTHQVFFFNW 592
            IL+  ++   F+  R   +NLDG++G+R+ +  LKS+     +E  L    L      + L   I ++S+  LK   P Y  +    +  GFWK  LP   I+  +   Y      +++ E   D C+  L+GT    ++ C ++  C  +MT  G S Y L+HQ+ FF W
Sbjct:   39 ILSALERATVFLEQRLPEINLDGMVGVRVLEEQLKSVREKWAQEPLLQPLSLRVGMLGEKLEAAI-QRSLHYLKLSDPKYLREFQLTLQPGFWK--LPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLW 206          
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Human
Match: C16orf89 (chromosome 16 open reading frame 89 [Source:HGNC Symbol;Acc:HGNC:28687])

HSP 1 Score: 67.781 bits (164), Expect = 5.201e-12
Identity = 50/171 (29.24%), Postives = 82/171 (47.95%), Query Frame = 2
Query:   98 ILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILAN--KETRLWKGILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYII--RSETYGERFGDDCMSLLMGTS--GNDKCTITLKCWKMMTAHGFSNYSLTHQVFFFNW 592
            IL+  ++   F+  R   +NLDG++G+R+ +  LKS+     +E  L    L      + L   I ++S+  LK   P Y  +    +  GFWK  LP   I+  +   Y      +++ E   D C+  L+GT    ++ C ++  C  +MT  G S Y L+HQ+ FF W
Sbjct:   39 ILSALERATVFLEQRLPEINLDGMVGVRVLEEQLKSVREKWAQEPLLQPLSLRVGMLGEKLEAAI-QRSLHYLKLSDPKYLREFQLTLQPGFWK--LPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLW 206          
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Zebrafish
Match: C3H16orf89 (si:ch211-76l23.7 [Source:NCBI gene;Acc:566173])

HSP 1 Score: 69.707 bits (169), Expect = 1.125e-25
Identity = 52/179 (29.05%), Postives = 84/179 (46.93%), Query Frame = 2
Query:   92 NEILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGI----LNQIRNQDSLSRRICEK---SIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRS-----ETYGERFGDDCMSLLMGT--SGNDKCTITLKCWKMMTAHGFSNYSLTHQVFFF 586
            + IL +  K + +   +   +NLDG++G  I Q  L+     + TR W       L+Q     S+ +R+ +    +  TL++  P Y+ +  P++   FW  SLP      SS D  ++ +     E Y E   D CM+ L+GT       C +T  C   MT  G  +YSL+HQ+ +F
Sbjct:   29 DNILMSLSKGITYFDMQGSNINLDGVVGYIILQAQLR-----EATRTWPHSDFLSLSQRAAAISMLKRLSKSLSTAASTLQETDPKYFKEFEPILDSSFW--SLPGE---WSSTDPSLVYTSVRAMECYDEHMSDKCMTFLLGTWKDNGTPCIVTKTCRDTMTQFGCPHYSLSHQLLYF 197          

HSP 2 Score: 66.6254 bits (161), Expect = 1.125e-25
Identity = 39/113 (34.51%), Postives = 61/113 (53.98%), Query Frame = 3
Query:  678 LCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQ-RPNGCYGIMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFLN 1013
             CSN+ + +  + +N L     D+ +E I LCG  G +  F    W+ +I++WQ +  GC+G  E+ +   E    A +   R KR E  ++ DGC +H + VA+SAL  FLN
Sbjct:  229 FCSNMMKSNQDIFKNSLTGQMQDIFIENILLCGLVG-FSDFYKLDWLQSILTWQDQEAGCFGKEEDISHIFEEFLDAPHK--RVKRREKTLT-DGCSSHMTGVAVSALGGFLN 337          
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Mouse
Match: AU021092 (expressed sequence AU021092 [Source:MGI Symbol;Acc:MGI:2146559])

HSP 1 Score: 74.3294 bits (181), Expect = 1.716e-27
Identity = 52/175 (29.71%), Postives = 86/175 (49.14%), Query Frame = 2
Query:   89 TNEILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGILNQI-----RNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGTS--GNDKCTITLKCWKMMTAHGFSNYSLTHQVFFFNW 592
             N IL   +K   F+  R   +NLDG++G ++ +  L+ +   +E    K +L  +     +  ++LS  + +KSI  LK+  P Y  +  P I  GFWK        N S +  ++   +++ E   D C+  L+GT    +  C ++  C  +MT  G S YSL+HQ+ FF W
Sbjct:   32 ANLILTALEKATLFLEDRLPTINLDGVVGFQVLEVQLRGV---QEKWAHKPLLQPLSMRAGQMANTLSA-LLQKSIFYLKQSDPTYLREFQPSIQPGFWKLPNDWTRTNASLVYPWLEPLDSFSEESSDVCLVQLLGTGTDSSQPCRLSNFCRTLMTKAGCSGYSLSHQLLFFLW 202          

HSP 2 Score: 67.781 bits (164), Expect = 1.716e-27
Identity = 39/115 (33.91%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  669 MDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPN-GCYGIMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFL 1010
            MD  C+N+   ++     G      DL ME I  CG AG +  F   +W++AI+SWQ P  GC+G  + +    E   P + G  R+ R    +  DGC  H +  A++AL  FL
Sbjct:  220 MDIFCANMMELNHRAEAVGYAYPTQDLFMENIMFCGMAG-FSDFYKLRWLEAILSWQNPQVGCFGRPDTKGEPSEV--PHQQGILRRVRRREKLFADGCSCHNTATAVAALGGFL 331          
BLAST of UPF0764 protein C16orf89 homolog vs. UniProt/SwissProt
Match: sp|Q3UST5|CP089_MOUSE (UPF0764 protein C16orf89 homolog OS=Mus musculus OX=10090 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 1.023e-26
Identity = 52/175 (29.71%), Postives = 86/175 (49.14%), Query Frame = 2
Query:   89 TNEILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGILNQI-----RNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGTS--GNDKCTITLKCWKMMTAHGFSNYSLTHQVFFFNW 592
             N IL   +K   F+  R   +NLDG++G ++ +  L+ +   +E    K +L  +     +  ++LS  + +KSI  LK+  P Y  +  P I  GFWK        N S +  ++   +++ E   D C+  L+GT    +  C ++  C  +MT  G S YSL+HQ+ FF W
Sbjct:   32 ANLILTALEKATLFLEDRLPTINLDGVVGFQVLEVQLRGV---QEKWAHKPLLQPLSMRAGQMANTLSA-LLQKSIFYLKQSDPTYLREFQPSIQPGFWKLPNDWTRTNASLVYPWLEPLDSFSEESSDVCLVQLLGTGTDSSQPCRLSNFCRTLMTKAGCSGYSLSHQLLFFLW 202          

HSP 2 Score: 67.781 bits (164), Expect = 1.023e-26
Identity = 39/115 (33.91%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  669 MDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPN-GCYGIMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFL 1010
            MD  C+N+   ++     G      DL ME I  CG AG +  F   +W++AI+SWQ P  GC+G  + +    E   P + G  R+ R    +  DGC  H +  A++AL  FL
Sbjct:  220 MDIFCANMMELNHRAEAVGYAYPTQDLFMENIMFCGMAG-FSDFYKLRWLEAILSWQNPQVGCFGRPDTKGEPSEV--PHQQGILRRVRRREKLFADGCSCHNTATAVAALGGFL 331          
BLAST of UPF0764 protein C16orf89 homolog vs. UniProt/SwissProt
Match: sp|A7MCS3|CP089_DANRE (UPF0764 protein C16orf89 homolog OS=Danio rerio OX=7955 PE=2 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 6.833e-25
Identity = 52/179 (29.05%), Postives = 84/179 (46.93%), Query Frame = 2
Query:   92 NEILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGI----LNQIRNQDSLSRRICEK---SIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRS-----ETYGERFGDDCMSLLMGT--SGNDKCTITLKCWKMMTAHGFSNYSLTHQVFFF 586
            + IL +  K + +   +   +NLDG++G  I Q  L+     + TR W       L+Q     S+ +R+ +    +  TL++  P Y+ +  P++   FW  SLP      SS D  ++ +     E Y E   D CM+ L+GT       C +T  C   MT  G  +YSL+HQ+ +F
Sbjct:   29 DNILMSLSKGITYFDMQGSNINLDGVVGYIILQAQLR-----EATRTWPHSDFLSLSQRAAAISMLKRLSKSLSTAASTLQETDPKYFKEFEPILDSSFW--SLPGE---WSSTDPSLVYTSVRAMECYDEHMSDKCMTFLLGTWKDNGTPCIVTKTCRDTMTQFGCPHYSLSHQLLYF 197          

HSP 2 Score: 66.6254 bits (161), Expect = 6.833e-25
Identity = 39/113 (34.51%), Postives = 61/113 (53.98%), Query Frame = 3
Query:  678 LCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQ-RPNGCYGIMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFLN 1013
             CSN+ + +  + +N L     D+ +E I LCG  G +  F    W+ +I++WQ +  GC+G  E+ +   E    A +   R KR E  ++ DGC +H + VA+SAL  FLN
Sbjct:  229 FCSNMMKSNQDIFKNSLTGQMQDIFIENILLCGLVG-FSDFYKLDWLQSILTWQDQEAGCFGKEEDISHIFEEFLDAPHK--RVKRREKTLT-DGCSSHMTGVAVSALGGFLN 337          
BLAST of UPF0764 protein C16orf89 homolog vs. UniProt/SwissProt
Match: sp|Q6UX73|CP089_HUMAN (UPF0764 protein C16orf89 OS=Homo sapiens OX=9606 GN=C16orf89 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 2.498e-11
Identity = 50/171 (29.24%), Postives = 82/171 (47.95%), Query Frame = 2
Query:   98 ILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILAN--KETRLWKGILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYII--RSETYGERFGDDCMSLLMGTS--GNDKCTITLKCWKMMTAHGFSNYSLTHQVFFFNW 592
            IL+  ++   F+  R   +NLDG++G+R+ +  LKS+     +E  L    L      + L   I ++S+  LK   P Y  +    +  GFWK  LP   I+  +   Y      +++ E   D C+  L+GT    ++ C ++  C  +MT  G S Y L+HQ+ FF W
Sbjct:   39 ILSALERATVFLEQRLPEINLDGMVGVRVLEEQLKSVREKWAQEPLLQPLSLRVGMLGEKLEAAI-QRSLHYLKLSDPKYLREFQLTLQPGFWK--LPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLW 206          
BLAST of UPF0764 protein C16orf89 homolog vs. TrEMBL
Match: A0A267DP07 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013278g1 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.781e-44
Identity = 57/146 (39.04%), Postives = 81/146 (55.48%), Query Frame = 3
Query:  606 CNNNIEKMAASVKGS-------QTMPMIMDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYGIMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFLNNEI 1022
            C  N+ ++A S   S         +  ++D+ C  +   +      G  +   DL MEQIGLC  +GY   F  P W  A++SWQR NGCYG   NE    EN +PARYG YR+KR+E+LM   GCL+H+++VA+ AL  F   ++
Sbjct:  224 CLYNLTELAQSRPASVDLSGDGSPLQRLLDKFCGRILVAAAAQEAAGFPVINRDLFMEQIGLCSASGYVAEFGQPSWHRAVLSWQRANGCYGAFPNELVARENFNPARYGNYRRKRSEALMGSGGCLSHRTSVALDALVGFTRQQV 369          

HSP 2 Score: 86.2705 bits (212), Expect = 3.781e-44
Identity = 47/180 (26.11%), Postives = 88/180 (48.89%), Query Frame = 2
Query:   95 EILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYII---------------RSETYGERFGDDCMSLLMGTSGNDKCTITLKCW-KMMTAHGFSNYSLTHQVFFF 586
            + L    + + FM   ++  NLDG IG+R  +G   ++L+N  +RL   ++ ++++    +  + +++ + ++K TPVYY     +I+D  W    P R +++      +                  + + E+F DDC+    G  G   CTI+ +CW  M+ + G  +Y LTHQVF+ 
Sbjct:   37 DTLDALDRAVAFMGGHSETANLDGGIGLRTVEGQFGALLSNYWSRLPLWLVARLKSIQQRASLVAKETAKAVQKNTPVYYANAGQLIADHSWDIFFPSRRLSLRFAAALLEEAAATIDAAASGDNQEEDGFDEKFSDDCIHEFYGRDGQPPCTISHRCWDAMVRSEGRRDYYLTHQVFYL 216          
BLAST of UPF0764 protein C16orf89 homolog vs. TrEMBL
Match: A0A267DXH3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011858g1 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.964e-44
Identity = 57/146 (39.04%), Postives = 81/146 (55.48%), Query Frame = 3
Query:  606 CNNNIEKMAASVKGS-------QTMPMIMDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYGIMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFLNNEI 1022
            C  N+ ++A S   S         +  ++D+ C  +   +      G  +   DL MEQIGLC  +GY   F  P W  A++SWQR NGCYG   NE    EN +PARYG YR+KR+E+LM   GCL+H+++VA+ AL  F   ++
Sbjct:  224 CLYNLTELAQSRPASVDLSGDGSPLQRLLDKFCGRILVAAAEQEAAGFPVINRDLFMEQIGLCSASGYVAEFGQPSWRRAVLSWQRANGCYGAFPNELVARENFNPARYGNYRRKRSEALMGSGGCLSHRTSVALDALVGFTRQQV 369          

HSP 2 Score: 86.2705 bits (212), Expect = 7.964e-44
Identity = 47/180 (26.11%), Postives = 88/180 (48.89%), Query Frame = 2
Query:   95 EILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYII---------------RSETYGERFGDDCMSLLMGTSGNDKCTITLKCW-KMMTAHGFSNYSLTHQVFFF 586
            + L    + + FM   ++  NLDG IG+R  +G   ++L+N  +RL   ++ ++++    +  + +++ + ++K TPVYY     +I+D  W    P R +++      +                  + + E+F DDC+    G  G   CTI+ +CW  M+ + G  +Y LTHQVF+ 
Sbjct:   37 DTLDALDRAVAFMGGHSETANLDGGIGLRTVEGQFGALLSNYWSRLPLWLVARLKSIQQRASLVAKETAKAVQKNTPVYYANAGQLIADHSWDIFFPSRRLSLRFAAALLEEAAATRDAAASGDNQEEDGFDEKFSDDCIHEFYGRDGQPPCTISHRCWDAMVRSEGRRDYYLTHQVFYL 216          
BLAST of UPF0764 protein C16orf89 homolog vs. TrEMBL
Match: A0A267H6B7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015391g3 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 3.392e-43
Identity = 53/142 (37.32%), Postives = 81/142 (57.04%), Query Frame = 3
Query:  597 ETECNNNIEKMAASVKGSQT---MPMIMDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYGIMENENFNLENLDPARYGTY--RKKRAESLMSRDGCLAHKSTVAISALSTF 1007
            +  C +N+   A +   + T   +  + D  C+ ++ E++ L   G      DL MEQ+GLCG AGY   F+  +W+  ++SWQR NGC+G    E  N  N DP  YG Y  R+KRAE  M  +GCL+H+++VAI+ L+ +
Sbjct:  210 QAGCLSNLTAQARAHPPAGTDGSLAGVFDNFCARIFVEASKLETAGFPKPDRDLFMEQVGLCGLAGY-PEFARWRWLPVLLSWQRANGCFGEFPGELINPSNFDPGLYGNYKRRRKRAEMRMP-EGCLSHRTSVAIAGLTAY 349          

HSP 2 Score: 101.679 bits (252), Expect = 3.392e-43
Identity = 52/174 (29.89%), Postives = 98/174 (56.32%), Query Frame = 2
Query:   80 VGKTNEILATTQKL---LDFMFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGTSGNDK-CTITLKCWK-MMTAHGFSNYSLTHQVFFF 586
            V   + + AT   L   +DF+      +NLDG IG+R+ +G  K++LA+  +RL +G + ++    S + R   +++++++++TPVYY     MI + FW    P R +  +++ R   + + + E+F DDC+    G  G    C+++ +CW+ ++   G + YSLTHQ+F+ 
Sbjct:   33 VATADALQATLDALTAAVDFVSNNIDSVNLDGAIGLRMAEGQTKALLAHYWSRLPQGAVARLAELHSRAGRAANRAVQSVRRRTPVYYANAGNMIREHFWDTFYPARPLPPAAV-RAADKDKDFDEKFSDDCIKEFYGPDGKSPGCSVSERCWRGLVLPTGLTGYSLTHQLFYL 205          
BLAST of UPF0764 protein C16orf89 homolog vs. TrEMBL
Match: A0A267F083 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015391g2 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 4.457e-43
Identity = 53/142 (37.32%), Postives = 81/142 (57.04%), Query Frame = 3
Query:  597 ETECNNNIEKMAASVKGSQT---MPMIMDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYGIMENENFNLENLDPARYGTY--RKKRAESLMSRDGCLAHKSTVAISALSTF 1007
            +  C +N+   A +   + T   +  + D  C+ ++ E++ L   G      DL MEQ+GLCG AGY   F+  +W+  ++SWQR NGC+G    E  N  N DP  YG Y  R+KRAE  M  +GCL+H+++VAI+ L+ +
Sbjct:  210 QAGCLSNLTAQARAHPPAGTDGSLAGVFDNFCARIFVEASKLETAGFPKPDRDLFMEQVGLCGLAGY-PEFARWRWLPVLLSWQRANGCFGEFPGELINPSNFDPGLYGNYKRRRKRAEMRMP-EGCLSHRTSVAIAGLTAY 349          

HSP 2 Score: 101.293 bits (251), Expect = 4.457e-43
Identity = 52/174 (29.89%), Postives = 97/174 (55.75%), Query Frame = 2
Query:   80 VGKTNEILATTQKL---LDFMFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGTSGNDK-CTITLKCWK-MMTAHGFSNYSLTHQVFFF 586
            V   + + AT   L   +DF+      +NLDG IG+R+ +G  K++LA+  +RL +G   ++    S + R   +++++++++TPVYY     MI + FW    P R +  +++ R   + + + E+F DDC+    G  G    C+++ +CW+ ++   G + YSLTHQ+F+ 
Sbjct:   33 VATADALQATLDALTAAVDFVSDNIDSVNLDGAIGLRMAEGQTKALLAHYWSRLPQGAAARLAELHSRAGRAANRAVQSVRRRTPVYYANAGKMIREHFWDTFYPARPLPRAAV-RAADKDKDFDEKFSDDCIKEFYGPDGKSPGCSVSERCWRGLVLPTGLTGYSLTHQLFYL 205          
BLAST of UPF0764 protein C16orf89 homolog vs. TrEMBL
Match: A0A267E6V0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026743g1 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 4.566e-43
Identity = 56/146 (38.36%), Postives = 81/146 (55.48%), Query Frame = 3
Query:  606 CNNNIEKMAASVKGS-------QTMPMIMDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYGIMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFLNNEI 1022
            C  N+ ++A S   S         +  ++D+ C  +   +      G  +   DL MEQIGLC  +GY   F  P W  A++SWQ+ NGCYG   NE    EN +PARYG YR+KR+E+LM   GCL+H+++VA+ AL  F   ++
Sbjct:  224 CLYNLTELAQSRPASVDLSGDGSPLQRLLDKFCGRILVAAAEQEAAGFPVINRDLFMEQIGLCSASGYVAEFGQPSWRRAVLSWQQANGCYGAFPNELVARENFNPARYGNYRRKRSEALMGSGGCLSHRTSVALDALVGFTRQQV 369          

HSP 2 Score: 85.8853 bits (211), Expect = 4.566e-43
Identity = 47/180 (26.11%), Postives = 88/180 (48.89%), Query Frame = 2
Query:   95 EILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYII---------------RSETYGERFGDDCMSLLMGTSGNDKCTITLKCW-KMMTAHGFSNYSLTHQVFFF 586
            + L    + + FM   ++  NLDG IG+R  +G   ++L+N  +RL   ++ ++++    +  + +++ + ++K TPVYY     +I+D  W    P R +++      +                  + + E+F DDC+    G  G   CTI+ +CW  M+ + G  +Y LTHQVF+ 
Sbjct:   37 DTLDALDRAVAFMGGHSETANLDGGIGLRTVEGQFGALLSNYWSRLPLWLVARLKSIQQRASLVAKETAKAVQKNTPVYYANAGQLIADHSWDIFFPSRRLSLRFAAALLEEAAATREAAASGDNQEEDGFDEKFSDDCIHEFYGKYGQPPCTISHRCWDAMVRSEGRRDYYLTHQVFYL 216          
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Cavefish
Match: si:ch211-76l23.7 (chromosome 2 C16orf89 homolog [Source:NCBI gene;Acc:103033375])

HSP 1 Score: 75.8702 bits (185), Expect = 2.762e-24
Identity = 50/174 (28.74%), Postives = 86/174 (49.43%), Query Frame = 2
Query:   92 NEILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGI----LNQIRNQDSLSRRI---CEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGT--SGNDKCTITLKCWKMMTAHGFSNYSLTHQVFFF 586
            +++L +  K + F   ++  +NLDG++G  I Q  L      + TR W       L+Q     SL +++      ++R+L++  P YY +  P++   FW       + + S +   +  +E Y E+ GD CM+LL+GT       C +T  C   MT  G  +YSL+HQ+ +F
Sbjct:   30 DDLLESLSKGVSFFEKQSGNINLDGVVGYVILQAQLL-----EATRSWPHSDFVSLSQRSTAMSLIKKLDRSLTHAVRSLQQTDPKYYKEFEPILDTSFWVLPQEWSSTDPSLVYSSLKSTECYDEQLGDKCMTLLLGTWKDNGTPCIVTKSCRDTMTRFGCPHYSLSHQLLYF 198          

HSP 2 Score: 55.4546 bits (132), Expect = 2.762e-24
Identity = 39/138 (28.26%), Postives = 61/138 (44.20%), Query Frame = 3
Query:  678 LCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQ-RPNGCYGIMENENFNLENL--DPARYGTYR-----------------------KKRAESLMSRDGCLAHKSTVAISALSTFLN 1013
             CSN+ + +   + NG+     D+ +E I LCG AG +  F    W+  I+ WQ R  GC+G  E+ +   E     P +    R                       K+R ++L  +DGC +H + VA+S L  +LN
Sbjct:  230 FCSNMMKSNLDSISNGITGQIQDIFIENILLCGLAG-FSDFYKADWLQHILQWQDRELGCFGKDEDYSQMFEEFLDTPHKRAKRRDKAMKEHCSQMFEEFLDIPHKRVKRREKTL--KDGCSSHMTGVAVSTLGGYLN 364          
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Nematostella
Match: EDO43039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZR8])

HSP 1 Score: 72.7886 bits (177), Expect = 4.368e-23
Identity = 53/172 (30.81%), Postives = 85/172 (49.42%), Query Frame = 2
Query:   89 TNEILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILAN---KETRLWKGILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIR-SETYGERFGDDCMSLLMGTSGNDK--CTITLKCWKMMTAHGFSNYSLTHQVFFF 586
            TN +L    ++L F     K +NLDG+ G+R+ +G LK IL      +  L +   N IR   + + +I ++++  L+K  P Y+++    +S G W      R ++V+ +     R S  + E   D CM  + GT G  K  C ++  CW+MM   G   Y+LTHQ  F 
Sbjct:   33 TNNLLDALNRVLTFYDHDHKTVNLDGVYGLRVAEGSLKKILEEFKGGKVFLSRRDFNSIRALWTRAGQISKRALPYLQKHNPAYFHRFKKQVS-GPWLEFKAFRKLDVALIVPVNKRESIEFDEDTSDKCMEEMSGT-GEIKVPCRLSDSCWRMMMFKGAGGYTLTHQALFL 202          

HSP 2 Score: 52.7582 bits (125), Expect = 4.368e-23
Identity = 43/164 (26.22%), Postives = 72/164 (43.90%), Query Frame = 3
Query:  606 CNNNIEKMAASVKGSQTMPMIMDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYGIME-NENFNLENL--------------------DPARYGTYRK----KRAESLMS----RDGCLAHKSTVAISALSTFL 1010
            C N +++     K    +  + DR+C++++ +  +  E   N D  DL MEQ  +CG  GY +  S  + +  I+SWQ   GCYG  E N++ ++ ++                    D     + RK    K   SL+      DGC++H + VA   L  +L
Sbjct:  210 CRNKLDEKIKKSKSGTGLQQVYDRICASMYPQM-VEFEKHPNSDGRDLYMEQAMVCGMMGYSRFLSKDR-LKNILSWQNAKGCYGDDESNDDRDVYDISYDKGRIYGRIPQYEEISRRDIKHVASARKLLSMKTMRSLLVEKALEDGCMSHITGVATGLLGVYL 371          
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Nematostella
Match: EDO43038 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZR7])

HSP 1 Score: 56.225 bits (134), Expect = 9.788e-18
Identity = 45/211 (21.33%), Postives = 85/211 (40.28%), Query Frame = 2
Query:   83 GKTNEILATTQKLLDFMFARAKFLNLDGLIGIRI----------------------------------YQGVLKSILANKETRLWKG-ILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGTSG--NDKCTITLKCWKMMTAHGFSNYSLTHQVFFFNWD*DR 604
            G  + ++ + +++LDF+      +NLD ++G+R+                                  +QGVL   L + E +     +L++I+       ++  + +  L+K   VYY ++  ++S   W      R +N +         +  G +    CM  L G++G  +  C +T  CW  M   G   Y LTHQ  +F +  +R
Sbjct:   29 GTVSPLVQSFERVLDFLEREMSSINLDAVLGLRMAEGLLLNLLRLAPSSGSHIDVLYCVLSFLTFSHFFQGVLLQTLQDPEVQEHHPWVLHRIKGLAHRVSKLIPEILPFLQKSDRVYYQQVGFVVSKT-WSVVRRFRKLNKAPKRHLAFNDKKAGTQAPQPCMEALFGSAGPGSKTCNVTDACWTAMRRPGALGYELTHQALYFMFGEER 238          

HSP 2 Score: 51.2174 bits (121), Expect = 9.788e-18
Identity = 35/123 (28.46%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  666 IMDRLCSNVWRESNLLVE-NGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYGIMENENFN--LENLDPARYGTYRKKRAESLMS----RDGCLAHKSTVAISALSTFLN 1013
            + DR+C++ + +   L    G      DL +E   +CG  GY   F + K +  ++ WQ PNGCYG   + N++  L       Y T   +   SL++     +GC +H + VA + +S +L 
Sbjct:  260 VYDRICADTFYQMLALERMRGKTQQEVDLYLEMSAVCGLLGY-SQFLSFKRMGRLLRWQMPNGCYG---DPNYDALLNEAGGVLYQTSHSRATRSLLTVKELEEGCESHITGVATALISVYLR 378          
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Nematostella
Match: EDO43037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZR6])

HSP 1 Score: 53.9138 bits (128), Expect = 4.716e-17
Identity = 44/211 (20.85%), Postives = 85/211 (40.28%), Query Frame = 2
Query:   83 GKTNEILATTQKLLDFMFARAKFLNLDGLIGIRI----------------------------------YQGVLKSILANKETRLWKG-ILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGTSG--NDKCTITLKCWKMMTAHGFSNYSLTHQVFFFNWD*DR 604
            G  + ++ + +++LDF+      +NLD ++G+R+                                  ++GVL   L + E +     +L++I+       ++  + +  L+K   VYY ++  ++S   W      R +N +         +  G +    CM  L G++G  +  C +T  CW  M   G   Y LTHQ  +F +  +R
Sbjct:   29 GTVSLLVQSFERVLDFLEREMSSINLDAVLGLRMAEGLLLNLLRLAPSSGSHIDVLYCVLSFLTFSHFFEGVLLQTLQDPEVQEHHPWVLHRIKGLAHRVSKLIPEILPFLQKSDRVYYQQVGFVVSKT-WSVVRRFRKLNKAPKRHLAFNDKKAGTQAPQPCMEALFGSAGPGSKTCNVTDACWTAMRRPGALGYELTHQALYFMFGEER 238          

HSP 2 Score: 51.2174 bits (121), Expect = 4.716e-17
Identity = 35/123 (28.46%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  666 IMDRLCSNVWRESNLLVE-NGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYGIMENENFN--LENLDPARYGTYRKKRAESLMS----RDGCLAHKSTVAISALSTFLN 1013
            + DR+C++ + +   L    G      DL +E   +CG  GY   F + K +  ++ WQ PNGCYG   + N++  L       Y T   +   SL++     +GC +H + VA + +S +L 
Sbjct:  260 VYDRICADTFYQMLALERMRGKTQQEVDLYLEMSAVCGLLGY-SQFLSFKRMGRLLRWQMPNGCYG---DPNYDALLNEAGGVLYQTSHSRATRSLLTVKELEEGCESHITGVATALISVYLR 378          
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Nematostella
Match: EDO43040 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZR9])

HSP 1 Score: 46.9802 bits (110), Expect = 1.833e-6
Identity = 30/109 (27.52%), Postives = 51/109 (46.79%), Query Frame = 3
Query:  696 RESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYG----IMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFL 1010
            +E+ + V    +L   DL +EQ  +    GY + F + + +  I++WQ P GC+G    I+       E+ D     T  +K   +   +DGC  H S VA+  L  ++
Sbjct:    4 QEAKVFVSVNQSLGDMDLYLEQCVVGSMLGY-EEFLSLRQLQQILAWQHPKGCFGFHGDIIRKPEDEYEDEDTWETKTTMRKLKVAKTLKDGCELHISGVAVGLLGMYI 111          
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Nematostella
Match: EDO27725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8G2])

HSP 1 Score: 48.1358 bits (113), Expect = 2.387e-6
Identity = 40/171 (23.39%), Postives = 74/171 (43.27%), Query Frame = 2
Query:  101 LATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKG-ILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGTSG--NDKCTITLKCWKMMTAHGFSNYSLTHQVFFFNWD*DR 604
            +A+ +KLL     R+       L+  +  +GVL   L + E +     +L++I+       ++  + +  L+K   VYY ++  ++S   W      R ++ +         +  G +    CM  L G++G  +  C +T  CW  M   G   Y LTHQ  +F +  +R
Sbjct:   93 VASARKLLSMKTMRS-------LLVEKALEGVLLQTLQDPEVQEHHPWVLHRIKGLAHRVSKLIPEILPFLQKSDRVYYQQVGFVVSKT-WSVVRRFRKLSKAPKRHLAFNDKKAGTQAPQPCMEALFGSAGPGSKTCNVTDACWTAMRRPGALGYELTHQALYFMFGEER 255          
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Medaka
Match: si:ch211-76l23.7 (chromosome 8 C16orf89 homolog [Source:NCBI gene;Acc:101172164])

HSP 1 Score: 79.337 bits (194), Expect = 8.936e-27
Identity = 50/173 (28.90%), Postives = 87/173 (50.29%), Query Frame = 2
Query:   92 NEILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILA---NKETRLWKGILNQIRNQDSLSRRI---CEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGT--SGNDKCTITLKCWKMMTAHGFSNYSLTHQVFFF 586
            +++L++    + F+  + + +NLDG +G  + Q  LK  +    + +   W     Q  +  +L RR+    +K+   LK+  P YY +  P++S  FWK  L   + + S +    I +E Y E+  D C++LL+GT       C +T  C   MT  G  +YSL+HQ+ +F
Sbjct:   30 DDVLSSLSLGVSFLERQHEHINLDGGVGFVLLQAELKEAVGTWPHTDPVSWA----QRTSAVALLRRLDQALDKAFIALKRNDPKYYKEFEPLLSWTFWKIPLEGDSTDPSLVYPSTISAECYDEQLSDKCLTLLLGTWKENGTPCIVTKPCLDTMTRFGCPHYSLSHQLLYF 198          

HSP 2 Score: 60.4622 bits (145), Expect = 8.936e-27
Identity = 44/145 (30.34%), Postives = 70/145 (48.28%), Query Frame = 3
Query:  606 CNNNIEKMAASVKGSQTMPMIMDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQ-RPNGCYG--------IMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFLN 1013
            C+N ++    + + + T     +  CSN+ + +  +V  GL     D+  E I +CG AG +  F    W+  I+  Q +  GC+G        I+ +E   LE L P R    R KR E ++  DGC +H + VA+ AL  +LN
Sbjct:  206 CSNLLKGDTRASRANVTEQQYQNIFCSNMMKTNQDVVAAGLTEQTVDIFTENILICGLAG-FSDFFKADWLQHILGLQDKEVGCFGRDHSILSQIIGDE--LLEQLQPHR----RVKRREKILP-DGCSSHMTAVAVGALGGYLN 342          
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Medaka
Match: si:ch211-76l23.7 (chromosome 8 C16orf89 homolog [Source:NCBI gene;Acc:101172164])

HSP 1 Score: 70.0922 bits (170), Expect = 6.730e-24
Identity = 52/200 (26.00%), Postives = 90/200 (45.00%), Query Frame = 2
Query:   92 NEILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILA---NKETRLWKGILNQIRNQDSLSRRI---CEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGT---SGND--------------------------KCTITLKCWKMMTAHGFSNYSLTHQVFFF 586
            +++L++    + F+  + + +NLDG +G  + Q  LK  +    + +   W     Q  +  +L RR+    +K+   LK+  P YY +  P++S  FWK  L   + + S +    I +E Y E+  D C++LL+GT   SG +                           C +T  C   MT  G  +YSL+HQ+ +F
Sbjct:   30 DDVLSSLSLGVSFLERQHEHINLDGGVGFVLLQAELKEAVGTWPHTDPVSWA----QRTSAVALLRRLDQALDKAFIALKRNDPKYYKEFEPLLSWTFWKIPLEGDSTDPSLVYPSTISAECYDEQLSDKCLTLLLGTWYESGAEPSGFAALLPALTPPSPSRWNRKENGTPCIVTKPCLDTMTRFGCPHYSLSHQLLYF 225          

HSP 2 Score: 59.6918 bits (143), Expect = 6.730e-24
Identity = 44/145 (30.34%), Postives = 70/145 (48.28%), Query Frame = 3
Query:  606 CNNNIEKMAASVKGSQTMPMIMDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQ-RPNGCYG--------IMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFLN 1013
            C+N ++    + + + T     +  CSN+ + +  +V  GL     D+  E I +CG AG +  F    W+  I+  Q +  GC+G        I+ +E   LE L P R    R KR E ++  DGC +H + VA+ AL  +LN
Sbjct:  233 CSNLLKGDTRASRANVTEQQYQNIFCSNMMKTNQDVVAAGLTEQTVDIFTENILICGLAG-FSDFFKADWLQHILGLQDKEVGCFGRDHSILSQIIGDE--LLEQLQPHR----RVKRREKILP-DGCSSHMTAVAVGALGGYLN 369          
BLAST of UPF0764 protein C16orf89 homolog vs. Planmine SMEST
Match: SMESG000041522.1 (SMESG000041522.1)

HSP 1 Score: 316.235 bits (809), Expect = 1.497e-168
Identity = 148/152 (97.37%), Postives = 152/152 (100.00%), Query Frame = 2
Query:  131 MFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGILNQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGTSGNDKCTITLKCWKMMTAHGFSNYSLTHQVFFF 586
            MFARAKFLNLDG+IGIRIYQGVLKSILANKETRLWKGI+NQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKG+LPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGTSGNDKCTITLKCWKMMTAHGFSNYSLTHQVF+F
Sbjct:    1 MFARAKFLNLDGVIGIRIYQGVLKSILANKETRLWKGIINQIRNQDSLSRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGNLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGTSGNDKCTITLKCWKMMTAHGFSNYSLTHQVFYF 152          

HSP 2 Score: 296.204 bits (757), Expect = 1.497e-168
Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 3
Query:  597 ETECNNNIEKMAASVKGSQTMPMIMDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYGIMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFLNNEI 1022
            ETECNNNIEKMAASVKGSQTMPMIMDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYGIMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFLNNEI
Sbjct:  157 ETECNNNIEKMAASVKGSQTMPMIMDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYGIMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFLNNEI 298          
BLAST of UPF0764 protein C16orf89 homolog vs. Planmine SMEST
Match: SMESG000036743.1 (SMESG000036743.1)

HSP 1 Score: 60.4622 bits (145), Expect = 3.461e-20
Identity = 41/149 (27.52%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  597 ETECNNNIEKMAASVKGSQTMPMIMDRLCSNVWRESN--LLVENGLNLDYS---------DLLMEQIGLCGYAGYYKSFSNPKWIDAIISWQRPNGCYGIMENENFNLENLDPARYGTYRKKRAESLMSRDGCLAHKSTVAISALSTFL 1010
            ++ C  N+ +M   +    ++  +    CS ++ E N    +++  N+ +S         DL +EQI +CG  G+ + F + K++  +ISW   NGC        F L N D  +    ++   E     DGCLAHK+++ I+ LS +L
Sbjct:  218 KSSCLVNVNEML--LINHTSIDQLQKEFCSQIFFERNHTFSLQSPKNISHSIIFILPTEQDLFLEQIFVCGSIGFME-FVDLKFLRTVISWISSNGC--------FKLINEDETKSTFGKRDILEEAYFTDGCLAHKTSLGIAVLSLYL 355          

HSP 2 Score: 56.6102 bits (135), Expect = 3.461e-20
Identity = 45/184 (24.46%), Postives = 87/184 (47.28%), Query Frame = 2
Query:   92 NEILATTQKLLDFMFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGILNQ------IRNQDSL----------SRRICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIRSETYGERFGDDCMSLLMGTSG---NDKCTITLKCWK-MMTAHGFSNYSLTHQVFF 583
            N+++++ +++++F        NLDG+ G++I QG L +IL   +  L++  L         +N++S           S+ +  K+I  +KK    YY ++   + +  WK  +  R IN +      +RS  + E F D+C+S +   +     + C I  +C   ++   G   Y +THQV +
Sbjct:   31 NDLISSLERIINFYQNNLSSFNLDGIFGLKILQGELTNILTIMDVNLFQLFLKAGDLDFYFKNKNSFITRLKNLRCSSQNLSRKAITYIKKDDFAYYQRMKYFVINE-WKPKILYRKINRAIEIVKGVRS-AFDESFSDECLSSVAKYTNYNFQNTCKILDECRDVLLLRKGLKEYFVTHQVLY 212          
The following BLAST results are available for this feature:
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C16orf894.194e-1229.24chromosome 16 open reading frame 89 [Source:HGNC S... [more]
C16orf894.288e-1229.24chromosome 16 open reading frame 89 [Source:HGNC S... [more]
C16orf895.201e-1229.24chromosome 16 open reading frame 89 [Source:HGNC S... [more]
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C3H16orf891.125e-2529.05si:ch211-76l23.7 [Source:NCBI gene;Acc:566173][more]
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AU0210921.716e-2729.71expressed sequence AU021092 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q3UST5|CP089_MOUSE1.023e-2629.71UPF0764 protein C16orf89 homolog OS=Mus musculus O... [more]
sp|A7MCS3|CP089_DANRE6.833e-2529.05UPF0764 protein C16orf89 homolog OS=Danio rerio OX... [more]
sp|Q6UX73|CP089_HUMAN2.498e-1129.24UPF0764 protein C16orf89 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DP073.781e-4439.04Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DXH37.964e-4439.04Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H6B73.392e-4337.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F0834.457e-4337.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E6V04.566e-4338.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-76l23.72.762e-2428.74chromosome 2 C16orf89 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO430394.368e-2330.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430389.788e-1821.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430374.716e-1720.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430401.833e-627.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277252.387e-623.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-76l23.78.936e-2728.90chromosome 8 C16orf89 homolog [Source:NCBI gene;Ac... [more]
si:ch211-76l23.76.730e-2426.00chromosome 8 C16orf89 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of UPF0764 protein C16orf89 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000041522.11.497e-16897.37SMESG000041522.1[more]
SMESG000036743.13.461e-2027.52SMESG000036743.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019766 ID=SMED30019766|Name=UPF0764 protein C16orf89 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1028bp
ATGATTTCTTCAGTGAATTTTGTTTTACTTTTTGCAGTTTTTTTTCCCGA
GTCAAACGCGATTAGTAAATAACATAAATGTTGGTAAAACAAATGAAATT
TTGGCCACAACACAGAAACTGTTAGATTTCATGTTTGCAAGGGCTAAATT
TTTAAATTTGGATGGACTGATTGGGATCAGAATTTATCAAGGTGTGTTGA
AATCTATTCTTGCTAATAAGGAAACGAGACTGTGGAAAGGAATTCTAAAT
CAAATTAGAAATCAGGATTCCTTATCAAGGAGAATATGTGAAAAATCAAT
TAGAACTTTGAAAAAACAAACACCAGTTTATTATAACAAACTTTGGCCTA
TGATTTCCGATGGATTCTGGAAAGGAAGTCTTCCTCCAAGAAATATTAAT
GTGAGTTCTTTGGATAGATATATAATCCGGTCAGAGACATATGGTGAAAG
GTTCGGAGATGATTGTATGTCATTATTAATGGGAACGTCTGGAAATGACA
AATGCACCATTACTCTGAAATGCTGGAAAATGATGACGGCTCATGGATTT
TCCAATTATTCTTTGACTCATCAAGTTTTCTTTTTTAATTGGGATTGAGA
CCGAGTGCAACAATAATATTGAAAAGATGGCAGCTTCGGTGAAGGGTAGC
CAAACCATGCCGATGATTATGGACCGGCTATGTAGTAATGTCTGGAGAGA
ATCTAATTTATTAGTAGAAAATGGGCTAAATCTGGATTATTCTGATTTAT
TGATGGAACAAATTGGGCTTTGTGGATATGCAGGATATTATAAAAGTTTT
TCTAATCCAAAATGGATAGACGCAATTATTAGTTGGCAACGTCCGAATGG
ATGCTACGGAATTATGGAAAATGAAAATTTTAATTTAGAAAATTTAGATC
CTGCGAGATACGGTACGTATCGCAAAAAACGAGCGGAATCTTTAATGAGT
CGTGACGGATGTCTGGCGCATAAAAGTACTGTAGCAATCTCAGCCCTCTC
GACATTTTTAAATAATGAAATCTGATTA
back to top

protein sequence of SMED30019766-orf-1

>SMED30019766-orf-1 ID=SMED30019766-orf-1|Name=SMED30019766-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MFARAKFLNLDGLIGIRIYQGVLKSILANKETRLWKGILNQIRNQDSLSR
RICEKSIRTLKKQTPVYYNKLWPMISDGFWKGSLPPRNINVSSLDRYIIR
SETYGERFGDDCMSLLMGTSGNDKCTITLKCWKMMTAHGFSNYSLTHQVF
FFNWD*
back to top

protein sequence of SMED30019766-orf-2

>SMED30019766-orf-2 ID=SMED30019766-orf-2|Name=SMED30019766-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=133bp
MAASVKGSQTMPMIMDRLCSNVWRESNLLVENGLNLDYSDLLMEQIGLCG
YAGYYKSFSNPKWIDAIISWQRPNGCYGIMENENFNLENLDPARYGTYRK
KRAESLMSRDGCLAHKSTVAISALSTFLNNEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR031751DUF4735
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005576extracellular region
GO:0005829cytosol
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
Vocabulary: molecular function
TermDefinition
GO:0042803protein homodimerization activity