Stabilizer of axonemal microtubules 2

Overview
NameStabilizer of axonemal microtubules 2
Smed IDSMED30019761
Length (bp)1881
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Stabilizer of axonemal microtubules 2 (SMED30019761) t-SNE clustered cells

Violin plots show distribution of expression levels for Stabilizer of axonemal microtubules 2 (SMED30019761) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019761

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30019761SMESG000067510.1 SMESG000067500.1 SmedASXL_007636SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30019761SMESG000067510.1 SMESG000067500.1 SmedASXL_007636SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
testis primordiumSMED30019761SMESG000067510.1 SMESG000067500.1 Contig3936_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testis primordiumSMED30019761SMESG000067510.1 SMESG000067500.1 PL08001B1C12_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Human
Match: SAXO1 (stabilizer of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:28566])

HSP 1 Score: 156.762 bits (395), Expect = 6.640e-41
Identity = 137/480 (28.54%), Postives = 210/480 (43.75%), Query Frame = 1
Query:  244 VKLPCVCEICNCGRHRCPHKMCKPGPWDK----CNLSEYNTQY-VPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARL-VPAKFEGESTNRRDYIPWDIPPATRRKP----DDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWD---VPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKP---APHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNINNAND 1635
            +K  C+CE+C+CGRH CPH   K   +DK    C LSEY   Y   H   P +S KP  +   G  P+   TT R D+ P      +  +   ++  E  MD  T Y+K++ P  +C     K   ++     K E   T + DY+PW+ P   RR+P      Y   + +FD   +++ DY         S KP+        PL   T+Y+ SYV HP+E R   +   F    +PF++LTT ++ Y      P KS KP       D P  + T  R  ++   + + F   P  Y  PE  +DL TT    Y         S +     K    F+  +  +DD+K W      PV+P+ +   + PT+P +  TT ++ +VPH      S KP    P      P +  T Y   +T K    C AS+         P GY +   DA GH  Y+  +    +Q+  ++++++ +
Sbjct:    1 MKTKCICELCSCGRHHCPHLPTKI--YDKTEKPCLLSEYTENYPFYHSYLPRESFKPRREYQKGPIPMEGLTTSRRDFGPHKVAPVKVHQYDQFVPSEENMDLLTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQP---RREPLRLEHKYQPASVRFDNRTTHQDDYPIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVHEAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQ--LDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPR--GNVPVESQTTYTISFTPKEMGRCLASY-------PEPPGYTFEEVDALGHRIYKPVSQAGSQQSSHLSVDDSEN 464          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Human
Match: SAXO2 (stabilizer of axonemal microtubules 2 [Source:HGNC Symbol;Acc:HGNC:33727])

HSP 1 Score: 134.035 bits (336), Expect = 1.589e-33
Identity = 117/450 (26.00%), Postives = 194/450 (43.11%), Query Frame = 1
Query:  241 SVKLPCVCEICNCGRHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDD-YFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVK-EKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEP-PTDPFEDCTTFKSAFVPHELCKVDSFKPAPHML-SQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRK 1578
            S++  C+C+IC+CG   CP+++ K              ++VP E          +KP  G+                                   +D  T Y+++     +   A  +    ++   K +   T + DY  WD+  +   KP+  Y   T KF    +++ D++P    P +SFKP     +ST P    T +R  Y+ H LE + ++ +  +      F+ LTTHR ++        K  +P    +  +      T  R  F+  ++  P   +  +Y  P G + L +T + DY+   A   V ++     R  + PFQ  +  ++DF  W+      I++    P P+  F+  +TF+S +VPHEL   +S KP      S  PFDD TMY  EYT K +  CPAS+        SP GYI++N +++GH  +RK
Sbjct:    5 SMRSWCLCQICSCGSDYCPYEIVK------------QPRHVPEE----------YKPKQGK-----------------------------------IDLGTTYKRDLNSYKVQPVAIVRPLERQVKKGKLDTVPTYKDDYRAWDLHKSELYKPEQTYHPPTVKFGNSTTFQDDFVPQEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFEDLTTHRCDFQGLIGETAKLCRPVHTRVTQNALFEGSTEFRESFQPWEIPPPEVKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIRPVSQKRSNNFPFQGKSIMKEDFPAWESCRQGLIKKQQQIPNPSGKFDGLSTFRSHYVPHELIPTESCKPLNIAFKSSVPFDDVTMYSVEYTPKRQEICPASY-------PSPPGYIFDNTNSQGHKFFRK 390          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Human
Match: SAXO1 (stabilizer of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:28566])

HSP 1 Score: 117.857 bits (294), Expect = 6.877e-28
Identity = 109/413 (26.39%), Postives = 175/413 (42.37%), Query Frame = 1
Query:  430 LSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARL-VPAKFEGESTNRRDYIPWDIPPATRRKP----DDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWD---VPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKP---APHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNINNAND 1635
            +   TT R D+ P      +  +   ++  E  MD  T Y+K++ P  +C     K   ++     K E   T + DY+PW+ P   RR+P      Y   + +FD   +++ DY         S KP+        PL   T+Y+ SYV HP+E R   +   F    +PF++LTT ++ Y      P KS KP       D P  + T  R  ++   + + F   P  Y  PE  +DL TT    Y         S +     K    F+  +  +DD+K W      PV+P+ +   + PT+P +  TT ++ +VPH      S KP    P      P +  T Y   +T K    C AS+         P GY +   DA GH  Y+  +    +Q+  ++++++ +
Sbjct:    1 MEGLTTSRRDFGPHKVAPVKVHQYDQFVPSEENMDLLTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQP---RREPLRLEHKYQPASVRFDNRTTHQDDYPIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVHEAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQ--LDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPR--GNVPVESQTTYTISFTPKEMGRCLASY-------PEPPGYTFEEVDALGHRIYKPVSQAGSQQSSHLSVDDSEN 399          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Human
Match: SAXO1 (stabilizer of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:28566])

HSP 1 Score: 117.857 bits (294), Expect = 6.877e-28
Identity = 109/413 (26.39%), Postives = 175/413 (42.37%), Query Frame = 1
Query:  430 LSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARL-VPAKFEGESTNRRDYIPWDIPPATRRKP----DDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWD---VPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKP---APHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNINNAND 1635
            +   TT R D+ P      +  +   ++  E  MD  T Y+K++ P  +C     K   ++     K E   T + DY+PW+ P   RR+P      Y   + +FD   +++ DY         S KP+        PL   T+Y+ SYV HP+E R   +   F    +PF++LTT ++ Y      P KS KP       D P  + T  R  ++   + + F   P  Y  PE  +DL TT    Y         S +     K    F+  +  +DD+K W      PV+P+ +   + PT+P +  TT ++ +VPH      S KP    P      P +  T Y   +T K    C AS+         P GY +   DA GH  Y+  +    +Q+  ++++++ +
Sbjct:    1 MEGLTTSRRDFGPHKVAPVKVHQYDQFVPSEENMDLLTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQP---RREPLRLEHKYQPASVRFDNRTTHQDDYPIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVHEAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQ--LDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPR--GNVPVESQTTYTISFTPKEMGRCLASY-------PEPPGYTFEEVDALGHRIYKPVSQAGSQQSSHLSVDDSEN 399          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Celegans
Match: T08G11.3 (pep chromosome:WBcel235:I:8921190:8925327:1 gene:WBGene00011630.1 transcript:T08G11.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T08G11.3)

HSP 1 Score: 62.003 bits (149), Expect = 8.942e-10
Identity = 97/427 (22.72%), Postives = 155/427 (36.30%), Query Frame = 1
Query:  292 CPHKMCKPGPWDKCNLSEYNTQYVPHE---ICPPKSLKPGFKPMLGEGPLSSETTHRVDYI----PRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPA-RLVPAKFEGESTNRRDYIPWDIPPATR----RKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQN-RVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLS-----DETTHRVDFKIHDVDK--PFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVK---EKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIR----RDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQ--EPFDDATMYRTEYTNKCRPYCP 1485
             P K    GP D        TQ V  +   I     L+P     L  G     TTH+ D+     PR   I   R P D     G  + TT  R +F  K    +   + P +  +   +F G +TN+ DY   D   A R    R   D    +  F+G  + + DY           +   +    + P    T  +  Y    +      K P   +    PFD +TT++ ++  K+   Q+ Y  A    Q D  LS     D TT+R DF      +  PFK   +      G   + +T   DY+     +++ ++   +  +  ++APF+  +    DF+       +  R     ++  P    F+  TT ++ F+     +V + KP     S     FD  T Y   +  K     P
Sbjct:   88 APFKFVNTGPLDSGEFLADTTQRVDFQGKSINRQAPLRPTTNG-LQSGEFEGYTTHKSDFDYKGDPRTGVI---RGPQDAQLFSGPFNSTTTNRADFDKKQAERSGILRGPTSTNMFGGQFNGTTTNKTDY---DQKQAERNGIIRGAADAQLFSGPFNGQTTNKSDYDQKQAERSGILRGPTNTEMFSGPFNGQTTNKSDYDQKQVGRSEILKGPANTEMFSGPFDGITTNKADFDKKQADRQQRYPRA----QNDDRLSAGSFYDTTTNRADFDRKQASRPMPFKAADDSQLTSSGPFLVLSTNRADYVKKQGDRSLPIRNTNDTSTHSINAPFEGESTNHADFQRKQAEKSKLTRPHSSSNLLSPNASKFDATTTTRADFIQKPHVRVINVKPKDDSFSGHVSRFDANTTYHDGFQEKSAEKLP 503          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Zebrafish
Match: saxo2 (stabilizer of axonemal microtubules 2 [Source:ZFIN;Acc:ZDB-GENE-051127-27])

HSP 1 Score: 196.052 bits (497), Expect = 2.404e-55
Identity = 155/458 (33.84%), Postives = 224/458 (48.91%), Query Frame = 1
Query:  238 MSVKLPCVCEICNCGRHRCPHK---MCKPGPWDKCNLSEYNTQYVPHEI-CPPKSLKPGFKPMLGEGPLSSETTHRVDYIPR-CAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAIC-YTASTKQPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDDYFKN-TDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVK--EKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDI-YEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQE-PFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRK 1578
            M +   C+CE+C+CGRHRC H+   + K  P     LSEY  +Y P++    PKSLKP  K    +  + + TT R DYIP      PEK++  +Y    G +D  T Y+++F P  +  +T    +    +V AK +   T + D+  W+I      KPD  ++    KF    +++ D++     P +S+KP      S  P  ++T  + SYV HPLE R  K    +  +  PF  +TTHR++Y        KS KP P  + ++KP    T  R  ++   V  P   +  +Y  P  ++DL TT + DYI       VS K    P+ K S PFQ  T  RDDF+ W       IR+    + P+   ED TTF++ FV HE     SFKP    L  + P    TMYRT++T K    CPASF T       P G+++ N D +GH  +RK
Sbjct:    1 MKMTRLCICEMCSCGRHRCTHRPTTLYKKDPQTNV-LSEYIEKYPPYKGHTRPKSLKPQLKYKAHQDTMDATTTFRTDYIPYPVTHRPEKQQL-EYKPKSGEIDLGTTYKQDFNPYEVQPFTPLRPKERVHVVNAKLDTVPTYKEDFRQWEIIRRELTKPDTTYQPPATKFGNSTTFQDDFVHRGLVPRESYKPSNVAKLSDTPFEKNTSNKLSYVPHPLEARYVKPPEEYKPSSHPFHDVTTHRQDYQGLPSQSTKSCKPEPVKVASNKPFQSSTEFRDQYQHWPVSLPQMQKSVEYTSPTANMDLTTTSHSDYIKHQIQPFVSSKPFSLPA-KSSRPFQGNTTMRDDFQPWVAQRQSIIRKQAELQRPSGKMEDLTTFRAHFVQHEAQPSFSFKPQNSPLHTDIPLQADTMYRTDFTPKKISMCPASFET-------PPGFVFENRDDQGHRFFRK 448          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Xenopus
Match: vcam1 (vascular cell adhesion molecule 1 [Source:Xenbase;Acc:XB-GENE-492444])

HSP 1 Score: 194.512 bits (493), Expect = 1.488e-54
Identity = 143/470 (30.43%), Postives = 226/470 (48.09%), Query Frame = 1
Query:  244 VKLPCVCEICNCGRHRCPHK--MCKPGPWDKCNLSEYNTQYVPHE-ICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTK-QPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDDYFKN-TDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKP---SRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEP-PTDPFEDCTTFKSAFVPHELCKVDSFKPAPHML-SQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNIN 1623
            +K  C+CEIC CGRHRCPH           +C L+EY  +Y  ++ + PPKS+KP  +     G +   TT + DY+P        R   +Y    G ++  T Y +++ P  +   A  +     +  P +F+   T + D+ PW+       K +  ++  T+KF    +++ D+ P    P +SFKP+        P    T +R SYV H +EPR  +++  +  +  PF+ LTTHR  +        KS KP    + ++      T  R  F+   +  P+ ++  +Y  P+  ++  TT + DY+  P    +    +P    R+ + PFQ  +  +DDF+ W+      I+RD   P P+  FE  TTFKS + PHE+    SFKP    L +  PF+ ATMYR+EYT K    CPA++        SP GY++ + D RGH  +RK   P  +   + N N
Sbjct:    1 MKRKCICEICTCGRHRCPHNPTHITEKSGKQCVLTEYVEKYPQYDNVQPPKSMKPKQEYSGEHGRMEGITTFKSDYVPYEILNRPVRAHEEYQPKPGSIELGTTYNRDYNPHRLEPVAPIRPVDKGQANPGRFDTNPTYKDDFRPWEFQKRELAKQERVYQAPTEKFGNSTTFQDDFFPKQIMPRESFKPLGVAKNRDIPFEGTTSHRISYVPHEVEPRFVRQKEEYKPSSQPFEDLTTHRLNFKGAIGEITKSCKPEHGKVGSNAQFEGATEFRDSFQPWSIPAPYVHKSYEYVPPKSHMECDTTTHLDYV--PHQLKLVAPIRPVTHGRRSNVPFQGSSTMKDDFRAWEGGRQEMIKRDHLIPKPSGKFEGLTTFKSHYQPHEINPTQSFKPLNMPLRTSVPFEGATMYRSEYTPKKSELCPANY-------PSPPGYVFESIDNRGHKIFRKILTPEIKAFTNQNGN 461          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Xenopus
Match: vcam1 (vascular cell adhesion molecule 1 [Source:Xenbase;Acc:XB-GENE-492444])

HSP 1 Score: 168.318 bits (425), Expect = 3.489e-45
Identity = 135/461 (29.28%), Postives = 216/461 (46.85%), Query Frame = 1
Query:  268 ICNCGRHRCPHKMCKPGPWDKCNLSEYNTQYVPHE-ICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTK-QPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDDYFKN-TDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKP---SRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEP-PTDPFEDCTTFKSAFVPHELCKVDSFKPAPHML-SQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNINN 1626
            IC C   R   K  K     +C L+EY  +Y  ++ + PPKS+KP  +     G +   TT + DY+P        R   +Y    G ++  T Y +++ P  +   A  +     +  P +F+   T + D+ PW+       K +  ++  T+KF    +++ D+ P    P +SFKP+        P    T +R SYV H +EPR  +++  +  +  PF+ LTTHR  +        KS KP    + ++      T  R  F+   +  P+ ++  +Y  P+  ++  TT + DY+  P    +    +P    R+ + PFQ  +  +DDF+ W+      I+RD   P P+  FE  TTFKS + PHE+    SFKP    L +  PF+ ATMYR+EYT K    CPA++        SP GY++ + D RGH  +RK   P  +   + N N 
Sbjct:    9 ICTCACKRIKVKSGK-----QCVLTEYVEKYPQYDNVQPPKSMKPKQEYSGEHGRMEGITTFKSDYVPYEILNRPVRAHEEYQPKPGSIELGTTYNRDYNPHRLEPVAPIRPVDKGQANPGRFDTNPTYKDDFRPWEFQKRELAKQERVYQAPTEKFGNSTTFQDDFFPKQIMPRESFKPLGVAKNRDIPFEGTTSHRISYVPHEVEPRFVRQKEEYKPSSQPFEDLTTHRLNFKGAIGEITKSCKPEHGKVGSNAQFEGATEFRDSFQPWSIPAPYVHKSYEYVPPKSHMECDTTTHLDYV--PHQLKLVAPIRPVTHGRRSNVPFQGSSTMKDDFRAWEGGRQEMIKRDHLIPKPSGKFEGLTTFKSHYQPHEINPTQSFKPLNMPLRTSVPFEGATMYRSEYTPKKSELCPANY-------PSPPGYVFESIDNRGHKIFRKILTPEIKAFTNQNGNT 455          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Mouse
Match: Saxo1 (stabilizer of axonemal microtubules 1 [Source:MGI Symbol;Acc:MGI:1923061])

HSP 1 Score: 164.466 bits (415), Expect = 8.172e-44
Identity = 138/465 (29.68%), Postives = 202/465 (43.44%), Query Frame = 1
Query:  256 CVCEICNCGRHRCPHKMCKPGPWDKCN----LSEYNTQY-VPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAK--FEGESTNRRDYIPWDIPP-ATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIY-EPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQE-PFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNI 1620
            C+C +C+CGRHRCPH   K   +DK      LSEY   Y +     P  S KP +       P+   TT R D+           +P  Y+  +  MD  T Y+ +F     C     K   ++        +   T + DY+PW+ P     R P  Y   + KF+   +++ DY         S KP         PL   T+Y+ SYV HP+E R  K+   ++   +PF+ LTTH++ Y      P KS KP   F   D P ++ T  +  F+     +     P  Y  PE  +DL TT    Y  L     ++ +  PS K S  F+  T  +DDFK W     +PIR  ++   P +P +  TT K+ FV H     +++KP    L +  P +  T Y   +T K    CPAS++        P GYI+   D+ GH  YR  +     QN  ++I
Sbjct:    6 CICNLCSCGRHRCPHLPTKI--YDKTEKTRLLSEYTENYPIYQSYLPRNSFKPEWCYRKPSAPMEGLTTCRRDFGLHKMLPVTFHQPDTYVPSQETMDLLTTYKHDFNYLPTCPVGLIKPRDSKFPNGDKIMQYLPTYKVDYLPWNQPRRELLRPPHKYRPESSKFENRTTHQDDYTMKGLVTTVSCKPPSKSKIYNIPLEDLTNYKMSYVPHPVEKRFVKEAEKYIPCDIPFENLTTHKESYRGLLGEPAKSTKPPAKFPVHDAPFTNTTEVQEKFQAWPTPQMVPKAPVVYVPPEEKMDLLTTVQTHYKYLKGSPAITCRPVPSIKKSKCFESSTTTKDDFKQWAAVNTKPIRPTLHLSLPAEPLDCQTTTKTCFVAHPPIITENYKPPWVGLRRNIPVEGQTTYSINFTPKDLGKCPASYM-------EPPGYIFEEVDSMGHKIYRSISQTGSRQNSSISI 461          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Mouse
Match: Saxo2 (stabilizer of axonemal microtubules 2 [Source:MGI Symbol;Acc:MGI:1914618])

HSP 1 Score: 151.369 bits (381), Expect = 9.461e-40
Identity = 116/378 (30.69%), Postives = 180/378 (47.62%), Query Frame = 1
Query:  481 IPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVP--------AKFEGESTNRRDYIPWDIPPATRRKPDDYFKNTD-KFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSA-PFQDGTNYRDDFKNWDVPPVRPIRRDIYEP-PTDPFEDCTTFKSAFVPHELCKVDSFKPAPHML-SQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRK 1578
            IPE+ KP      +G +D  T Y+++F P  +       QP  ++ P         K +   T + DY  WDI      KP+  +   D KF    +++ DY+P    P +SFKP      S  P   DT +R+ YV H LE +  + +  +     PF+ LTTHR ++        K  +PA   +  +      T  R  F+  ++  P   +  +Y  P G + L +T + DY+   A + V+++    R+ S  PFQ  +  ++DF  W++     I++    P P+  FE  +TF+S FVPHEL   +S KP    L S  P DD TMY  ++T K +  CPAS+        SP GYI+ N +++GH  +RK
Sbjct:   28 IPEEYKPK-----QGKIDLGTTYKRDFNPYKV-------QPLIKVRPVERQQVKKGKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPDVKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKEIYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSFQPWEIPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQFTPKKQEICPASY-------PSPPGYIFENTNSQGHKFFRK 386          

HSP 2 Score: 84.7297 bits (208), Expect = 4.702e-17
Identity = 71/277 (25.63%), Postives = 118/277 (42.60%), Query Frame = 1
Query:  262 CEICNCGRHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKA-----ICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVP-----FDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDF 1062
            CE+C       P +   P      N + +   YVP EI P +S KP        GP + +T+HR DY+P   E+   R    Y   +   +D T +R +F   A     IC  A T+         +F+G +  R  + PW+IPP   +K  +Y   +       +   DY+P+  +   + +PV    QS  P    +  ++ +        I ++     Q ++P     F+ L+T R  + P E+ P +S KP    +++  PL D T + + F
Sbjct:   91 CELCK------PEQAYHPPDVKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKEIYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQN----IQFKGSTEFRDSFQPWEIPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAW----EICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQF 353          
BLAST of Stabilizer of axonemal microtubules 2 vs. UniProt/SwissProt
Match: sp|Q4R7D3|SAXO1_MACFA (Stabilizer of axonemal microtubules 1 OS=Macaca fascicularis OX=9541 GN=SAXO1 PE=2 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 2.723e-44
Identity = 141/480 (29.38%), Postives = 213/480 (44.38%), Query Frame = 1
Query:  244 VKLPCVCEICNCGRHRCPHKMCKPGPWDK----CNLSEYNTQY-VPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARL-VPAKFEGESTNRRDYIPWDIPPATRRKP----DDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWD---VPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKP---APHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNINNAND 1635
            +K  C+CE+C+CGRH CPH   K   +DK    C LSEY   Y   H   P +S KP  +   G  P+   TT R D+ P      +  +   ++  E  MD  T Y+K++ P  +C     K   ++     K E   T + DY+PW+ P   RR+P      Y   + +FD   +++ DY         S KP+        PL   T+Y+ SYV HP+E R   +   F    +PF++LTTH++ Y      P KS KP       D P S+ T  R  ++     + F   P  Y  PE  +DL TT    Y         S +  P  + S  F+  +  +DD+K W      PV+PI +  +  PT+P +  TT ++ +VPH      S KP    P      P +  T Y   +T K    C AS+         P GY +   DA GH  Y+  +    +Q+  ++++++ +
Sbjct:    1 MKTKCICELCSCGRHHCPHLPTKI--YDKTEKPCLLSEYTENYPCYHSYLPRESFKPRREYQKGSIPMEGLTTSRRDFGPHKVAPVKAHQYDQFVPSEENMDLLTTYKKDYNPYTVCRVDPIKPRDSKYPYSNKMEYLPTYKADYLPWNQP---RRQPLRLEHKYQPASVRFDNRTTHQDDYPIKGLVKTVSCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVHEAEKFRPCEIPFESLTTHKQSYRGLMGEPAKSLKPLARPPGLDMPFSNTTEFRDKYQAWPTPQMFSKAPITYVPPEDSMDLLTTVQAHYTYPKGVPARSCRPAPQIRKSGRFEGSSTTKDDYKQWSSMRTEPVKPIPQLDF--PTEPLDCLTTTRAHYVPHPPINTKSCKPHWSGPR--GNVPVEGQTTYTISFTPKEMSKCLASY-------PEPPGYTFEEVDALGHRIYKPVSQAGSQQSSHLSVDDSEN 464          
BLAST of Stabilizer of axonemal microtubules 2 vs. UniProt/SwissProt
Match: sp|Q8IYX7|SAXO1_HUMAN (Stabilizer of axonemal microtubules 1 OS=Homo sapiens OX=9606 GN=SAXO1 PE=1 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 3.189e-40
Identity = 137/480 (28.54%), Postives = 210/480 (43.75%), Query Frame = 1
Query:  244 VKLPCVCEICNCGRHRCPHKMCKPGPWDK----CNLSEYNTQY-VPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARL-VPAKFEGESTNRRDYIPWDIPPATRRKP----DDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWD---VPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKP---APHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNINNAND 1635
            +K  C+CE+C+CGRH CPH   K   +DK    C LSEY   Y   H   P +S KP  +   G  P+   TT R D+ P      +  +   ++  E  MD  T Y+K++ P  +C     K   ++     K E   T + DY+PW+ P   RR+P      Y   + +FD   +++ DY         S KP+        PL   T+Y+ SYV HP+E R   +   F    +PF++LTT ++ Y      P KS KP       D P  + T  R  ++   + + F   P  Y  PE  +DL TT    Y         S +     K    F+  +  +DD+K W      PV+P+ +   + PT+P +  TT ++ +VPH      S KP    P      P +  T Y   +T K    C AS+         P GY +   DA GH  Y+  +    +Q+  ++++++ +
Sbjct:    1 MKTKCICELCSCGRHHCPHLPTKI--YDKTEKPCLLSEYTENYPFYHSYLPRESFKPRREYQKGPIPMEGLTTSRRDFGPHKVAPVKVHQYDQFVPSEENMDLLTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQP---RREPLRLEHKYQPASVRFDNRTTHQDDYPIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVHEAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQ--LDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPR--GNVPVESQTTYTISFTPKEMGRCLASY-------PEPPGYTFEEVDALGHRIYKPVSQAGSQQSSHLSVDDSEN 464          
BLAST of Stabilizer of axonemal microtubules 2 vs. UniProt/SwissProt
Match: sp|Q8BQB6|SAXO2_MOUSE (Stabilizer of axonemal microtubules 2 OS=Mus musculus OX=10090 GN=Saxo2 PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 6.618e-39
Identity = 116/378 (30.69%), Postives = 180/378 (47.62%), Query Frame = 1
Query:  481 IPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVP--------AKFEGESTNRRDYIPWDIPPATRRKPDDYFKNTD-KFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSA-PFQDGTNYRDDFKNWDVPPVRPIRRDIYEP-PTDPFEDCTTFKSAFVPHELCKVDSFKPAPHML-SQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRK 1578
            IPE+ KP      +G +D  T Y+++F P  +       QP  ++ P         K +   T + DY  WDI      KP+  +   D KF    +++ DY+P    P +SFKP      S  P   DT +R+ YV H LE +  + +  +     PF+ LTTHR ++        K  +PA   +  +      T  R  F+  ++  P   +  +Y  P G + L +T + DY+   A + V+++    R+ S  PFQ  +  ++DF  W++     I++    P P+  FE  +TF+S FVPHEL   +S KP    L S  P DD TMY  ++T K +  CPAS+        SP GYI+ N +++GH  +RK
Sbjct:   28 IPEEYKPK-----QGKIDLGTTYKRDFNPYKV-------QPLIKVRPVERQQVKKGKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPDVKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKEIYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSFQPWEIPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQFTPKKQEICPASY-------PSPPGYIFENTNSQGHKFFRK 386          

HSP 2 Score: 84.7297 bits (208), Expect = 3.289e-16
Identity = 71/277 (25.63%), Postives = 118/277 (42.60%), Query Frame = 1
Query:  262 CEICNCGRHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKA-----ICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVP-----FDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDF 1062
            CE+C       P +   P      N + +   YVP EI P +S KP        GP + +T+HR DY+P   E+   R    Y   +   +D T +R +F   A     IC  A T+         +F+G +  R  + PW+IPP   +K  +Y   +       +   DY+P+  +   + +PV    QS  P    +  ++ +        I ++     Q ++P     F+ L+T R  + P E+ P +S KP    +++  PL D T + + F
Sbjct:   91 CELCK------PEQAYHPPDVKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKEIYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQN----IQFKGSTEFRDSFQPWEIPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAW----EICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQF 353          
BLAST of Stabilizer of axonemal microtubules 2 vs. UniProt/SwissProt
Match: sp|Q6AYP6|SAXO1_RAT (Stabilizer of axonemal microtubules 1 OS=Rattus norvegicus OX=10116 GN=Saxo1 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 7.326e-36
Identity = 142/484 (29.34%), Postives = 209/484 (43.18%), Query Frame = 1
Query:  256 CVCEICNCGRHRCPH-------KMCKPGPWDKCNLSEYNTQYVPH-EICPPKSLKPGFKPMLGEGPLSSETTHRVDY-----IPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPAR------LVPAKFEGESTNRRDYIPWDIPP-ATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWD---VPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKP---APHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNINNA 1629
            C+C++C+CG+H CPH       K  KP     C  SEY  +Y  +    P +S KP  +      P+   +T + D+     +P    +PEK  P   I+ E  MD  T Y + +      Y  + +  P +          K E   T + DY+PW+    ++ R P  Y   + +FD   +++ DY         S+KP         PL   T Y+ SYV HP+E R   +   +  + VPFD+LTTH+  Y      P K++KPAP+    D P    T  R  F+     K    E   Y  PEG +DL TT   DY         S +     K S  F+  T  R+DFK+W      PV+P  +  +    +P E  TT ++ +VPH      S KP    P +    P +  T Y T +T K    CPAS+         P GYI++  DA GH  YR  +    +++  +   +A
Sbjct:    5 CICDLCSCGKHHCPHLPTKIYEKTEKP-----CFFSEYTEKYPTYLSYVPRESFKPKLEYQKVNIPMEGLSTTKRDFGTFNIVPVKHHLPEKATP---IQDE--MDFLTTYNQHYN-----YCPANRVNPIKPRDNKHQCNDKMECVPTYKADYLPWNQQKRSSIRPPQSYRPASCRFDHRTTHQDDYPIKNPVDTVSYKPPHGPKLCNIPLESMTSYKSSYVAHPMEKRCVYEGEKYKPSEVPFDSLTTHKDSYRGLIGEPAKTWKPAPNHPGLDIPFPSNTEFREKFQPWPTPKIVPKESIAYIPPEGKMDLLTTVQADYKCPNGVPAQSCRPVIHLKKSDRFESSTTNREDFKHWANIRREPVKPNHQLKFS--DEPMEYMTTNRAHYVPHAPANTKSCKPTWSGPRV--NIPLEGQTTYSTSFTPKEIQRCPASY-------PEPPGYIFDEVDAVGHRLYRPASGATSQESNHLGFGDA 462          
BLAST of Stabilizer of axonemal microtubules 2 vs. UniProt/SwissProt
Match: sp|Q658L1|SAXO2_HUMAN (Stabilizer of axonemal microtubules 2 OS=Homo sapiens OX=9606 GN=SAXO2 PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.631e-33
Identity = 117/450 (26.00%), Postives = 194/450 (43.11%), Query Frame = 1
Query:  241 SVKLPCVCEICNCGRHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDD-YFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVK-EKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEP-PTDPFEDCTTFKSAFVPHELCKVDSFKPAPHML-SQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRK 1578
            S++  C+C+IC+CG   CP+++ K              ++VP E          +KP  G+                                   +D  T Y+++     +   A  +    ++   K +   T + DY  WD+  +   KP+  Y   T KF    +++ D++P    P +SFKP     +ST P    T +R  Y+ H LE + ++ +  +      F+ LTTHR ++        K  +P    +  +      T  R  F+  ++  P   +  +Y  P G + L +T + DY+   A   V ++     R  + PFQ  +  ++DF  W+      I++    P P+  F+  +TF+S +VPHEL   +S KP      S  PFDD TMY  EYT K +  CPAS+        SP GYI++N +++GH  +RK
Sbjct:    5 SMRSWCLCQICSCGSDYCPYEIVK------------QPRHVPEE----------YKPKQGK-----------------------------------IDLGTTYKRDLNSYKVQPVAIVRPLERQVKKGKLDTVPTYKDDYRAWDLHKSELYKPEQTYHPPTVKFGNSTTFQDDFVPQEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFEDLTTHRCDFQGLIGETAKLCRPVHTRVTQNALFEGSTEFRESFQPWEIPPPEVKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIRPVSQKRSNNFPFQGKSIMKEDFPAWESCRQGLIKKQQQIPNPSGKFDGLSTFRSHYVPHELIPTESCKPLNIAFKSSVPFDDVTMYSVEYTPKRQEICPASY-------PSPPGYIFDNTNSQGHKFFRK 390          
BLAST of Stabilizer of axonemal microtubules 2 vs. TrEMBL
Match: A0A267F5A9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028915g1 PE=4 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 8.794e-93
Identity = 184/461 (39.91%), Postives = 252/461 (54.66%), Query Frame = 1
Query:  256 CVCEICNCGRHRC---PHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDDYFKN-TDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKV-SAPFQDGTNYRDDFKNWDVPP-VRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHML-SQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMN 1617
            C+CEICNCGRHRC   P++    GP   C LSEYN +Y+ H + P  S KP  +P  G+GPLS +TT+RVDY+P   E P   +P  Y +PEG  +DTTMY+K++  K        K+   R    +F+GE T + DY  W++    R  P + ++   D F GIP+Y+ DY+P+   P  SFKP  +   S  PL   TDYRQSYV HPLE R +++   + +  VPFD ++T  ++YT K    +   KP      +D P  D+TTHRVD+K  ++ +PF ++ + Y  PEG ID  TTY KDY   P  +    K KP R + S PF D T+Y+D+++ W +   VR      Y+P   PFE  +T  S +VPH L    SFKP       +EPFD  T+YR EY  K    CPA+FL TN        + Y   D RGH  Y    + V     D++
Sbjct:    9 CICEICNCGRHRCKVHPNRPVSDGP---CTLSEYNNKYIQHPMQPVSSYKPAARPAAGDGPLSDQTTNRVDYVPHPLERPHFHQPDQYRQPEGSFEDTTMYKKDYTQKQGDRAQPIKREVKRGALGEFQGEPTYKHDYRQWELTKPDRGGPQNTWQPPRDPFGGIPTYQTDYVPYAVRPTASFKPNEAAKLSQAPLEDMTDYRQSYVPHPLERRQERERLGWSRPAVPFDGMSTFTRDYTAKGTAVRAPMKPDARPHASDAPFHDDTTHRVDYKPWELSRPFVHQSDTYVPPEGTIDDTTTYGKDYPAHPLVRQTYSK-KPDRGLPSGPFDDATDYKDNYRQWQMGSRVRAGPNQQYQPNPAPFEGQSTTSSHYVPHPLDLRRSFKPTQGAARGEEPFDGTTLYRMEYVPKHTEPCPAAFLETNSSR-----FRYQGNDERGHQVYVPKDLSVGTTVTDLS 460          
BLAST of Stabilizer of axonemal microtubules 2 vs. TrEMBL
Match: A0A074Z9A4 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_11491 PE=4 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.627e-92
Identity = 177/445 (39.78%), Postives = 245/445 (55.06%), Query Frame = 1
Query:  256 CVCEICNCGRHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHE-LCKVDSFKPAPHMLSQEPFDDATMYRTEYTNK-CRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTA 1584
            C+CEIC CGRH+CPH+     PW  C +SEY  QY P  + P K + P         P+S +TTHR DY+P   E P  +KP  Y  P G M+D+T+YR E+  K    +   K    R+  AKF+G+ T R DY  WD+PP   +KP     N  KFD  P YRR+++P C    KS+KP  +     +P   DT YR  YV   +EP    K   + ++++PF+ LTT+RK++TPKE+CP + +KP      +  P+S  TT+R D+K      P +    +Y+  EGD    +TY  D+   P C  V+VK    ++  A F D TNYR ++K W+VPP +P ++D + P   PF+D TT + ++VPH  +       P P      PFDD T YRTEY  K   P CPA FL T+   VSPDGY++++ D RGH  YR   
Sbjct:    8 CICEICCCGRHKCPHRPKAIEPWGPCVMSEYTAQYHPQCVEPNKVIVPPSNIFASGDPMSGKTTHRNDYVPHPYERPYVQKPIPYKAPCGKMEDSTLYRNEYTAKNCAPSLPVKPLERRMCSAKFDGQPTYRSDYRSWDLPPMRPQKPKQERPNLPKFDAEPVYRREFVPKCIEKLKSYKP-ENRPTPDEPFRSDTMYRTEYVPRQVEPPAPIKPALYAKSKMPFETLTTNRKDFTPKEMCPNRPFKPQNLLFASADPMSKATTNRTDYKDWGPSYPERGAKPEYKPLEGDQSFDSTYRNDFNEKPICPVVNVKPFEPKRCDAKFDDLTNYRHEYKQWEVPPPKPAKKDEWAPSDAPFDDSTTNRVSYVPHPCVVAPQPITPKPQSWYSGPFDDRTNYRTEYVPKEVCPCCPAGFLPTD--DVSPDGYVFDHFDERGHQIYRNVT 449          
BLAST of Stabilizer of axonemal microtubules 2 vs. TrEMBL
Match: A0A1I8HXT3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028915g2 PE=4 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.752e-92
Identity = 184/461 (39.91%), Postives = 252/461 (54.66%), Query Frame = 1
Query:  256 CVCEICNCGRHRC---PHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDDYFKN-TDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKV-SAPFQDGTNYRDDFKNWDVPP-VRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHML-SQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMN 1617
            C+CEICNCGRHRC   P++    GP   C LSEYN +Y+ H + P  S KP  +P  G+GPLS +TT+RVDY+P   E P   +P  Y +PEG  +DTTMY+K++  K        K+   R    +F+GE T + DY  W++    R  P + ++   D F GIP+Y+ DY+P+   P  SFKP  +   S  PL   TDYRQSYV HPLE R +++   + +  VPFD ++T  ++YT K    +   KP      +D P  D+TTHRVD+K  ++ +PF ++ + Y  PEG ID  TTY KDY   P  +    K KP R + S PF D T+Y+D+++ W +   VR      Y+P   PFE  +T  S +VPH L    SFKP       +EPFD  T+YR EY  K    CPA+FL TN        + Y   D RGH  Y    + V     D++
Sbjct:    9 CICEICNCGRHRCKVHPNRPVSDGP---CTLSEYNNKYIQHPMQPVSSYKPAARPAAGDGPLSDQTTNRVDYVPHPLERPHFHQPDQYRQPEGSFEDTTMYKKDYTQKQGDRAQPIKREVKRGALGEFQGEPTYKHDYRQWELTKPDRGGPQNTWQPPRDPFGGIPTYQTDYVPYAVRPTASFKPNEAAKLSQAPLEDMTDYRQSYVPHPLERRQERERLGWSRPAVPFDGMSTFTRDYTAKGTAVRAPMKPDARPHASDAPFHDDTTHRVDYKPWELSRPFVHQSDTYVPPEGTIDDTTTYVKDYPAHPLVRQTYSK-KPDRGLPSGPFDDATDYKDNYRQWQMGSRVRAGPNQQYQPNPAPFEGQSTTSSHYVPHPLDLRRSFKPTQGAARGEEPFDGTTLYRMEYVPKHTEPCPAAFLETNSSR-----FRYQGNDERGHQVYVPKDLSVGTTVTDLS 460          
BLAST of Stabilizer of axonemal microtubules 2 vs. TrEMBL
Match: A0A4S2LC95 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008356 PE=4 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 4.340e-92
Identity = 180/453 (39.74%), Postives = 247/453 (54.53%), Query Frame = 1
Query:  256 CVCEICNCGRHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHE-LCKVDSFKPAPHMLSQEPFDDATMYRTEYTNK-CRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYR-----KTAIPV 1593
            C+CEIC CGRH+CPH+     PW  C +SEY  QY P  + P K + P         P+S +TT R DY+P   E P  RKP  Y  P G M+D+T+YR E+  K    +   K    R+  AKF+G+ T R DY PWD+PP   +KP     N  KFD  P YRR+++P C    KS+KP     +  +P   DT YR  YV   +EP    K   + ++++PF+ LTT+RK++TPKE+CP   +KP      +  P+S  TT R D+K      P +    +Y+  EGD    +TY  D+   P C  VSVK    ++  A F   TNYR ++K W+VPP +P +++ + P   PF+D TT + ++VPH  +       P P   +  PFDD T YRTEY  K   P CPA FL T+   VSPDGY++++ D RGH  YR     KT +P 
Sbjct:    8 CICEICCCGRHKCPHRPKAIEPWGPCVMSEYTAQYHPQCVEPNKLIVPTNNIFASGDPMSGKTTQRNDYVPHPYERPYVRKPVPYKAPCGKMEDSTLYRNEYTAKNCAPSLPVKPLERRMCSAKFDGQPTYRSDYRPWDLPPVRPQKPKQERPNLPKFDAEPIYRREFVPKCIEKLKSYKP-EDRPRPDEPFRSDTMYRTEYVPRQVEPPAPVKPALYAKSKMPFENLTTNRKDFTPKEMCPNPPFKPQNLLFASTDPMSKATTSRTDYKDWGPSYPERGAKPEYKPLEGDQSFDSTYRNDFNEKPICPVVSVKPLEPKRCDAKFDGLTNYRHEYKPWEVPPPKPAKKEEWTPSDAPFDDSTTNRVSYVPHPCVVAPQPITPKPQRWNSGPFDDRTNYRTEYVPKEVCPCCPAGFLPTD--DVSPDGYVFDHFDERGHQMYRNVTGDKTTLPA 457          
BLAST of Stabilizer of axonemal microtubules 2 vs. TrEMBL
Match: A0A564YFN4 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5833 PE=4 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 7.156e-91
Identity = 176/455 (38.68%), Postives = 243/455 (53.41%), Query Frame = 1
Query:  244 VKLPCVCEICNCGRHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEP-EKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDV--PPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQEPFDDATMYRTEYT-NKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQ 1596
            +K PC+CE+C CGRH CPH+  +   W  C +SEYN ++  H  CP + + P    +  +G +S  TT+R DY+P+  E  + R    Y  P    D  T YR  + PK +C       PP    PA+F+G  T + DY PW +PP  RRK   Y  +   F+G+ + R DY+P       S KP     QS  PL   T+YR  +V HPLEPR   K+   ++   PFD LTT+R +YTPK+IC  +S KP    I++++PLS +TT+RVD+  H +    K+ P ++YR P+  ++  TTY  DY  LP C+   V      K   PF   T Y  D+K WDV    V+PIR   Y PP  P E  +T  + +VP + C+  S KPA  +L+   FD  T Y TEYT  K   +CPA+FL  N   +S DGY +   D  GH HY+    P +
Sbjct:   18 MKEPCICEVCICGRHHCPHQKRQVVKWGPCVISEYNAKFRAHSACPRRPIMPTTVALHSDGSMSDRTTNREDYVPKTIERRQGRPKETYKPPSTAFDHDTNYRLTYTPKQVCPPEPYHPPPILRCPARFDGNPTYKNDYRPWSVPPPERRKVSAYKPSDAPFNGLSTSRADYVPKGNCKRPSLKPSQKLTQSDQPLDSATNYRTDFVQHPLEPRECSKKEYQVKTLAPFDGLTTNRTDYTPKDICIPRSLKPTDTLIRSNEPLSGDTTNRVDYIPHKLQPQQKHRPYDEYRVPDVPMEKGTTYKLDYPVLPICRPEPVTHPEYPKCPTPFDGKTMYNTDYKTWDVRRQIVKPIR--TYTPPNVPMETLSTNMADYVPKQACRAASVKPAAKLLTSGDFDSKTNYMTEYTPKKFDWHCPAAFL--NKEKISRDGYAFEATDPCGHEHYKMVGNPTE 468          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Cavefish
Match: saxo2 (stabilizer of axonemal microtubules 2 [Source:NCBI gene;Acc:103022203])

HSP 1 Score: 192.586 bits (488), Expect = 4.333e-54
Identity = 155/473 (32.77%), Postives = 225/473 (47.57%), Query Frame = 1
Query:  244 VKLPCVCEICNCGRHRCPHK---MCKPGPWDKCNLSEYNTQYVPHEI-CPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVP--AKFEGESTNRRDYIPWDIPPATRRKPDD-YFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVK--EKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPP------TDPFEDCTTFKSAFVPHELCKVDSFKPAPH-MLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTA----IPVQEQ 1602
            +K  CVCEICNCGRHRCPH+   + + G  +   ++EY  ++  HE   PPK LKP ++     G +   TT + D+IP        ++  +Y    G +D  T Y+++F P  +      K P   + P   K     T + D+  W+IP     KPD+ Y     KF    +++ D++P      +SFKP+    Q+  P    T  + SY+ HP+E R  K    +  +  PF  LTTHRK+Y        KS+KP    I ++ P    T  R  F+   V  P  ++  +Y  P  D+DL TT    YI       +S+K   KP+R   APF   T  +DDFK W    V   R   +  P      +   ED TTF++ F+ H L    S+KPA     +  P +++T YRT++T K    CPASF        SP G+I+ N D RGH  +R+ +    I VQ Q
Sbjct:    1 MKRLCVCEICNCGRHRCPHQPTVLYRKGS-EGYAVTEYVEKFPAHESRQPPKILKPKYEYTADRGKMEGTTTFKSDFIPYEVSRRPGKQQAEYQPNPGEIDLGTTYKQDFNPYQLQPVTPLK-PKVMIRPTSGKLNAVPTYKEDFRAWEIPKRELSKPDETYHPPPGKFGNTTTFQDDFVPRGPVLRESFKPLNVAKQNDAPFEGVTSNQLSYIPHPVEARFIKAPEEYKPSSQPFQDLTTHRKDYQGISGPMPKSFKPERVKISSEAPFQSSTEFRERFQQWPVSLPQVHKSVEYVSPTADMDLTTTTKTTYIKHKVQPFISIKPFPKPNRS-PAPFHSNTTMKDDFKPW----VTARRLSTFHKPEEIQRASGKMEDLTTFRAHFIQHPLQPNISYKPAAAPPRTDVPLEESTSYRTDFTPKKVSVCPASF-------ESPPGFIFQNSDERGHRFFRRVSDQDKIQVQLQ 459          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Cavefish
Match: ENSAMXT00000002606.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:25802480:25804640:1 gene:ENSAMXG00000002546.2 transcript:ENSAMXT00000002606.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 2.405e-9
Identity = 74/305 (24.26%), Postives = 125/305 (40.98%), Query Frame = 1
Query:  430 LSSETTHRVDYIPR-CAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQ------PPARLVPAKFEGESTNRRDYIPWDIPPATRRKP----DDYFKNTDKFDGIPSYRRDY-IPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKE---KPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRR 1299
            + ++TT R+DY+P        K     YI P+G M  T+ Y +++    +      K+      P A++ P      S  +  + PW +    R +P    D+   N  KF    +++ DY      +P K+FKP+   ++S  P    T+Y+ +Y+ HP++ R  K                   K+Y P          P+  F         E+T++ DF      K  + E  K  KP G++D  +T + DY+    C+ +   E       KV  PFQ  +  ++D++ WD      I R
Sbjct:    1 MENKTTFRLDYVPHHVIRRSPKAGKQLYIPPDGTMMLTSTYTEDYREHQVQKLLVNKKTEKYCNPTAKMAPM-----SLYKEQFKPWCVE---RLRPFKITDNLQLNQGKFVNTTTFQDDYSAKGSTSPRKNFKPITQIVESL-PFDGTTNYKLNYITHPVQSRKPKT------------------KKYRP----------PSASF-------HGESTYKQDF------KGLRTEAPKPIKPVGNMDFLSTTHADYV-AHKCQRIQRVEPLIHAWEKVKKPFQGTSVMKEDYQPWDAAHQTSIMR 254          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Sea Lamprey
Match: saxo2 (stabilizer of axonemal microtubules 2 [Source:ZFIN;Acc:ZDB-GENE-051127-27])

HSP 1 Score: 141.739 bits (356), Expect = 1.162e-36
Identity = 136/478 (28.45%), Postives = 216/478 (45.19%), Query Frame = 1
Query:  283 RHRCPHKMCKPGPWDK----CNLSEYNTQYVPHEICPPK-SLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGES------TNRRDYIPWDIPPATRRKPD-DYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQ---KSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVK-EKPSRKVSAPFQDGTNYRDDFKNWD------VPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKP-APHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNINNANDDKIA 1647
            RHRCPH+    G + +    C ++EY  +Y  + +  P+ S +P       +G +   TT R DYIP  A     R    Y    G M   T Y+ +F    I         PAR +  + +         T + DY  W+I      KP+  Y  +T+K+  + +++ DY      P  SFKP      S       T +R +YV H LE R  ++   +  +   FD+LTT R+++  + + PQ   KS+KP    + +D   +D T     FK+  +  P   +   Y  P G +D  TT + DY+     + +  +     R++S PF   T  R+ +K W       +  V  ++R +       F+D TTF+  +VP  L  + S+KP    + S  PF+  TMYR+EYT K    CPAS+         P GY +  +D RGHL++R+ +   + Q   M I+  +D+ I+
Sbjct:    1 RHRCPHQPT--GIYTQTEKPCLITEYVDRYHEYGLGGPRESFRPQHMYQGPQGKMDGITTFRADYIPYEAGKRPVRPVEAYKPVPGTMSMDTTYKTDFNEMPIHLVL-----PARPMENQHQAHGKMDTIPTYQNDYRQWEILKRENAKPNYTYVPSTNKYGYMTTFQDDYHAKQGGPSTSFKPANVMKPSEGAFEDRTTHRSAYVPHQLEARFAREPERYKPSTQQFDSLTTFRRDF--QSLGPQEPVKSFKPEHVKVGSDDKFNDSTEFNDKFKVWPLSPPPVRKQAMYHPPTGTMDTTTTSHDDYVQHRQERILLARPISRDRRLSLPFDGHTTMREAYKPWAAQREPMIKHVEQMQRSL-----GKFDDMTTFREHYVPLPLIPMHSYKPKGGAVRSSAPFESGTMYRSEYTPKKVAVCPASY-------PQPLGYAFQEKDTRGHLYFRRLSDAHKMQIAAMAID--DDENIS 455          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Nematostella
Match: EDO43170 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN3])

HSP 1 Score: 118.242 bits (295), Expect = 1.270e-28
Identity = 113/421 (26.84%), Postives = 186/421 (44.18%), Query Frame = 1
Query:  283 RHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICP-PKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAK--FEGESTNRRDYIPWDIPPATRR--KPDDYFKNTD-KFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQST-DPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRV--PFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVK-EKPSRKVSAPFQDGTNYRDDFKNWDVPPV-RPIRRDIYEPPTDPFEDCTTFKSAFVPH-----ELCKVDSFKPAPHMLSQEPFDDATMYRTEYTNKCRPYCPASFL 1497
            RHRC H+    GP  KC  +EY  +Y  H      K +KP     + + PL   T +R+DY+      P+KR+   +IKP+G ++D + Y+ ++ P  +   A + +P     P    F+G + ++  + PWD+  +  +  KPD      D + DG   ++ D+  H      + +P  S +++   P+  DT  R  Y    + P  +  +P + +     PF  +TT + ++  K   P  S+KP     Q++ P  D TT R  +    + K    E E YR P G     TT+  DY         S +    S   + PFQD T + D +K W V  V +  + + Y PP+  FE  +T +S F        +  + +  +PA    +  P D  T Y   +     P CPA+ +
Sbjct:    2 RHRCAHRPETRGPTHKCLFTEYQDRYKDHPFGERTKPIKPDRSVRISDAPLEDRTHYRLDYVSHKYAPPKKREKDRWIKPDGRVEDESTYKHDY-PGRMVAPAESAKPACTYQPHDKPFQGSTVHQDTFRPWDLNLSRVKSMKPDTQSMARDGRMDGRTIHQTDFPGHSVPRRPAIRPPNSDLRANCGPMENDTTTRLDYTKKQILP-AQSAKPVYRRPSTGPPFQGITTCQHDFGYKTGRPAASFKPQQGAQQSNAPFEDSTTTRESYPKWAIPKRQMREKEAYRPPSGKFKDDTTFRHDYPEWNVGPAQSARPPVQSFASNQPFQDSTTHSDTYKKWAVQAVPKSTKPEGYRPPSRKFEGESTMQSHFRGQYGPRSKPVRQEMNRPA----TSGPMDLHTTYDDTFKGLHPPPCPAATI 416          
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Nematostella
Match: EDO36385 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIR4])

HSP 1 Score: 83.9593 bits (206), Expect = 4.446e-17
Identity = 116/504 (23.02%), Postives = 203/504 (40.28%), Query Frame = 1
Query:  283 RHRCPHKMCKPGPW------DKCNLSEYNTQYVPHEICPPKSLKPGFKP---MLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYI----KPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVP-----------AKFEGESTNRRDYIPWDIPPATR-RKPDDYFKNTDKFDGIPSYRRDYIPHCQAP-PKSFKP-VVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKS-YKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKV----SAPFQDGTNYRDDFKNWDVPPVR------PIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQEPFDDATMYRT-EYTNKCRPY----------CPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNINNANDDKIA 1647
            RHRCPH    P         DKC+++EY   Y  H     +   P  +P   +  EG +   TT +  YI      P+K++P  Y+    + E + ++   YR             ++ PPAR+ P           A+ +  ST+  DY  W   P  +  +   Y      F+    +R+D++   Q P P + +P  +    S D    +  Y   +    + P+++KK   ++    PF + +  + +Y      P+ + Y+P       DKP+  ETT   DF+   V+   +  PE+Y++P+G+++ KTT   DY +       + K +P  K+         D TNY   F+ W   PV        +  +I+  P+  F + + F           VD +K    + S+   D++T+++T +   K   Y          CP   L           + + +E   GH  +    +P  + N  MN+  + D  +A
Sbjct:   69 RHRCPHGSSDPNRVINKEREDKCSVTEYKGNY--HRKSAQRG--PFHRPRDLLHPEGDIPDNTTSKTSYITHEVSPPKKKEPEKYVPNPNRFETVSENKDHYR------------GSRAPPARMNPYLKGITMRVPSAQIQYMSTSHGDYRTWKPEPLEKISRSKTYAPPEQPFNETSIHRQDFVRFNQPPRPTARQPDKIRMSGSMDKTTTNLTY---FTPKEIPPKMEKKRDEYVAPEQPFSSTSIFKTDYQDFRNAPKAAMYRPISDLFATDKPMQRETTKNADFQQWRVEARKQKSPERYQRPDGEVECKTT-TMDYGSFGRNAQPAKKTRPRTKLRFGREDALDDSTNYGMSFR-WVANPVAHHSKGPAVINEIFPKPSTSFNETSEF-----------VDRYKRFNVVPSKMYKDNSTLFKTNDKLAKDTVYNGDFDWPDVKCPCDRLQKGSAE-----FTFQHETEAGHKIFE---MPAIDTNGSMNLTASKDASLA 532          
BLAST of Stabilizer of axonemal microtubules 2 vs. Planmine SMEST
Match: SMESG000067500.1 (SMESG000067500.1)

HSP 1 Score: 944.11 bits (2439), Expect = 0.000e+0
Identity = 459/474 (96.84%), Postives = 459/474 (96.84%), Query Frame = 1
Query:  283 RHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRR--------------DYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNINNANDDKIAENYGR 1662
            RHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNR               DYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNINNANDDKIAENYGR
Sbjct:  215 RHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRSCYLLFLILNNCSIGDYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNINNANDDKIAENYGR 688          

HSP 2 Score: 76.2554 bits (186), Expect = 3.968e-14
Identity = 65/213 (30.52%), Postives = 89/213 (41.78%), Query Frame = 1
Query:  955 EYTPKEICPQKSYKPA---------------PHFI-------------QADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRD--------------DFKNWDVPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKP-APHMLSQEPFDDATMYRTEYTN 1464
            ++ P+  CP K  KP                PH I               + PLS ETTHRVD+     + P K +P  Y KPEG +D  T Y K++     C T S K+ P+R V A F+  +  R               D+  WD+PP    + D Y   TD F+   +++  ++PH      SFKP    M S +P    T YR  Y N
Sbjct:  211 KFFPRHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRSCYLLFLILNNCSIGDYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVN 423          
BLAST of Stabilizer of axonemal microtubules 2 vs. Planmine SMEST
Match: SMESG000067510.1 (SMESG000067510.1)

HSP 1 Score: 845.114 bits (2182), Expect = 0.000e+0
Identity = 416/435 (95.63%), Postives = 417/435 (95.86%), Query Frame = 1
Query:  304 MCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRR--------------DYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHL 1566
            MCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIM+DTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNR               DYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFK APHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARG  
Sbjct:    1 MCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMEDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRSCYLLFVILNNCSIGDYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKTAPHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGSF 435          
BLAST of Stabilizer of axonemal microtubules 2 vs. Planmine SMEST
Match: SMESG000072576.1 (SMESG000072576.1)

HSP 1 Score: 319.701 bits (818), Expect = 1.599e-102
Identity = 176/450 (39.11%), Postives = 258/450 (57.33%), Query Frame = 1
Query:  256 CVCEICNCGRHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHY----RKTAIPV 1593
            C+C+ICNCG+H+CPHK      W     SEY  QY       P+S KP + P+L + PLS+ TT+R D++        KR+   Y  P   M+D ++YR EF  K  C     + P       KFE  +TNR  Y+  D+ P   R  + Y   T+ FD   +YR D+IP+ QA   S KP V+ ++S  P    ++ R SYV H +EPR   ++  ++++  PF+++TT+R+++ P E C  +  KP  H ++ DKP + +TT+R D+  H    P K+E EKY KPEG +D++TTYN ++IN P CK++ ++   +   S PF   T+YR +++NW+ PP     R+ Y P T PF+  TT  +++V H + K  S KP    + + PFD  T +RT+Y  KC   CPA+ L+TNPRS+SPDGY YN ED  GHLH+    R   IP+
Sbjct:    8 CICKICNCGKHKCPHKSHPVAGWGPEICSEYGGQYHARPSERPESCKPPYNPILSDCPLSTVTTNRADFVAHDVHPVLKREHQKYEPPCTPMNDQSVYRHEFTEKPHCANRMIRPPATTQDNGKFESATTNRTTYVAHDVCPPELRSREQYKPPTEPFDATNTYRSDFIPYDQAKMSSCKPPVTSLKSDAPFNSVSEQRHSYVQHNVEPRQIAEKIPYVKSDEPFESMTTNRQDFVPMENCKSQLMKPPGHRVECDKPFASDTTNRTDYVAHPSQIPEKFEHEKYVKPEGQMDMRTTYNDNFINQPNCKSMPIRPPITPGNSEPFSSETSYRQNYQNWNQPPNIVQHREKYTPLTAPFDGQTTSGTSYVAHSIDKPQSCKPPVTAMEKLPFDGQTTHRTDYVAKCPHVCPAASLSTNPRSISPDGYCYNGEDNDGHLHFVKGSRGNGIPI 457          
BLAST of Stabilizer of axonemal microtubules 2 vs. Planmine SMEST
Match: SMESG000009389.1 (SMESG000009389.1)

HSP 1 Score: 285.804 bits (730), Expect = 2.805e-89
Identity = 177/462 (38.31%), Postives = 247/462 (53.46%), Query Frame = 1
Query:  256 CVCEICNCGRHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIP-PATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKE-PCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDV---PPVRPIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQEP-FDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAIPVQEQNVDMNIN 1623
            C+CEICNCGRH+CPH          C  SEY  +Y PH   P  S KP    M    PLS +TT RVDY+P   +  +      +  PEG MDDT++Y  E+  K +  T   K    R    KFEGE T R DY  W++  P   +    +    ++F+G+P+Y  DY+ +  AP  S KP VS + S  P    TDYRQSYV HPLE ++K K+   + ++ VPFD LTT ++++TPKE     S KP     Q+  PL  +TT+R+D+K  +V +P  +  + Y+ P+GD+D+ TTY +DY   P  K++++K K   +   PFQ  T+YRD +K W++   P V P  +  Y PP+ PFE  +T  + F+ H L    S KP P   +    FDD T+YR EYT K    CPA+ L + PR+     +IY  +D  GH  Y     PV     D+   
Sbjct:   10 CICEICNCGRHKCPHHPAVRQTAGPCTFSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMHRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAAPQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKAGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQ--YHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTKKHVDPCPAALLES-PRAR----FIYREQDNSGHKFYE----PVSSTVTDLKTG 460          
BLAST of Stabilizer of axonemal microtubules 2 vs. Planmine SMEST
Match: SMESG000042230.1 (SMESG000042230.1)

HSP 1 Score: 234.187 bits (596), Expect = 6.966e-70
Identity = 151/442 (34.16%), Postives = 223/442 (50.45%), Query Frame = 1
Query:  256 CVCEICNCGRHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIPP-ATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPK-SFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPPTD-PFEDCTTFKSAFVPHELCKVDSFKPAPHM-LSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNE-DARGHL 1566
            C+C+IC CGRH CPH+  +      C LSEY  +Y PH+I P  S KP         PL  +T HR+DY+P   E     +   Y   EG  +  T Y  EF PK        K+ P R    KFEG  T + DY  W   P     KP ++   ++ F+GIP+Y  DY+ +    P+ SF+P         P    T+ R+SY+ HP+E R  K +  + +  VPF   +T   ++  K +   +SYKP      + +PL +ETTH  D+K   V+KP+ ++ E+Y  PEG +   TTY +D++     + ++ + K +R+    F   T+Y DDF+ W++   +    +    P+D PFE+ TT  + FVP  L    SFK +    LS EPF+  ++YRTEY  K    CP +F   +PR+     Y +  E D +GHL
Sbjct:    8 CICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCP-TFFMGSPRAT----YEFTGEVDNKGHL 444          
The following BLAST results are available for this feature:
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SAXO16.640e-4128.54stabilizer of axonemal microtubules 1 [Source:HGNC... [more]
SAXO21.589e-3326.00stabilizer of axonemal microtubules 2 [Source:HGNC... [more]
SAXO16.877e-2826.39stabilizer of axonemal microtubules 1 [Source:HGNC... [more]
SAXO16.877e-2826.39stabilizer of axonemal microtubules 1 [Source:HGNC... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T08G11.38.942e-1022.72pep chromosome:WBcel235:I:8921190:8925327:1 gene:W... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
saxo22.404e-5533.84stabilizer of axonemal microtubules 2 [Source:ZFIN... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vcam11.488e-5430.43vascular cell adhesion molecule 1 [Source:Xenbase;... [more]
vcam13.489e-4529.28vascular cell adhesion molecule 1 [Source:Xenbase;... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Saxo18.172e-4429.68stabilizer of axonemal microtubules 1 [Source:MGI ... [more]
Saxo29.461e-4030.69stabilizer of axonemal microtubules 2 [Source:MGI ... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4R7D3|SAXO1_MACFA2.723e-4429.38Stabilizer of axonemal microtubules 1 OS=Macaca fa... [more]
sp|Q8IYX7|SAXO1_HUMAN3.189e-4028.54Stabilizer of axonemal microtubules 1 OS=Homo sapi... [more]
sp|Q8BQB6|SAXO2_MOUSE6.618e-3930.69Stabilizer of axonemal microtubules 2 OS=Mus muscu... [more]
sp|Q6AYP6|SAXO1_RAT7.326e-3629.34Stabilizer of axonemal microtubules 1 OS=Rattus no... [more]
sp|Q658L1|SAXO2_HUMAN7.631e-3326.00Stabilizer of axonemal microtubules 2 OS=Homo sapi... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F5A98.794e-9339.91Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A074Z9A41.627e-9239.78Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A1I8HXT32.752e-9239.91Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4S2LC954.340e-9239.74Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A564YFN47.156e-9138.68Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
saxo24.333e-5432.77stabilizer of axonemal microtubules 2 [Source:NCBI... [more]
ENSAMXT00000002606.22.405e-924.26pep primary_assembly:Astyanax_mexicanus-2.0:16:258... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
saxo21.162e-3628.45stabilizer of axonemal microtubules 2 [Source:ZFIN... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO431701.270e-2826.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363854.446e-1723.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stabilizer of axonemal microtubules 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067500.13.968e-1496.84SMESG000067500.1[more]
SMESG000067510.10.000e+095.63SMESG000067510.1[more]
SMESG000072576.11.599e-10239.11SMESG000072576.1[more]
SMESG000009389.12.805e-8938.31SMESG000009389.1[more]
SMESG000042230.16.966e-7034.16SMESG000042230.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019761 ID=SMED30019761|Name=Stabilizer of axonemal microtubules 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1881bp
AGATTTCTTACCCTTTTTTTACATTAATCCAGGATTTATAAAATTCATTT
AAAAATTTTCAATCATCATTTTGTTTATTAAAACCAAAAGCTTTAACTTT
AAAAAGCATTTTAGCAATTCTAGTGTGCAATTAAATGTATCTTGGTGTAA
AAGTAATTTACATAATTGTTTAAATTAATGACAAATATTAACTTGTGTTA
CGGAAATCAAATAACTAAAATTCCACAACAGGTTTAAATGTCTGTCAAAT
TGCCTTGTGTTTGTGAGATCTGCAATTGCGGGAGACATCGATGCCCCCAT
AAAATGTGCAAACCAGGTCCATGGGATAAATGTAATCTATCAGAATATAA
CACTCAATATGTACCACATGAAATATGCCCTCCCAAATCTCTTAAACCTG
GTTTCAAACCTATGTTAGGAGAAGGTCCATTATCAAGTGAAACTACGCAT
AGAGTTGATTATATTCCACGTTGCGCTGAAATTCCCGAGAAACGTAAACC
ACCAGATTATATAAAACCTGAAGGCATTATGGATGATACAACAATGTATA
GGAAAGAATTTGGTCCAAAAGCTATTTGTTATACAGCATCAACTAAACAA
CCACCTGCTAGATTAGTACCCGCTAAATTTGAGGGAGAATCGACAAACAG
AAGAGATTACATTCCATGGGATATACCTCCAGCAACTAGGCGTAAGCCTG
ATGATTATTTCAAAAATACAGATAAATTTGACGGGATTCCTTCTTATAGA
CGAGATTATATACCGCATTGTCAAGCTCCGCCAAAAAGTTTTAAGCCTGT
TGTTAGTTTTATGCAGAGCACTGATCCGTTAGCACAAGATACAGACTATC
GTCAATCTTACGTAAATCATCCACTTGAACCTAGAATTAAGAAAAAGGAG
CCTTGCTTTCTTCAAAACCGAGTGCCATTCGACGCATTGACGACCCATCG
AAAAGAATATACGCCTAAAGAAATTTGTCCACAAAAAAGTTATAAACCAG
CACCCCATTTTATTCAAGCTGACAAACCTCTGTCTGATGAAACTACCCAT
CGTGTTGATTTCAAGATCCATGATGTTGACAAACCGTTTAAATACGAGCC
AGAAAAATATAGGAAGCCAGAAGGCGATATCGATTTAAAAACGACTTATA
ATAAAGATTATATTAACTTACCAGCATGTAAGACCGTATCTGTTAAAGAA
AAGCCTTCAAGAAAGGTTTCAGCACCGTTTCAGGATGGGACTAACTATCG
CGATGATTTTAAAAATTGGGATGTCCCACCAGTCCGACCGATCAGAAGAG
ATATCTATGAACCCCCAACAGATCCATTCGAAGATTGCACTACTTTTAAA
TCAGCATTTGTTCCACATGAACTCTGTAAAGTTGATTCATTCAAACCCGC
ACCACATATGCTTTCACAAGAACCTTTCGATGATGCCACAATGTATAGAA
CAGAATATACTAATAAATGTCGACCATACTGCCCTGCGTCATTCTTAACA
ACTAATCCTCGATCTGTAAGCCCTGATGGTTATATATATAATAATGAAGA
TGCACGGGGTCATTTACATTATCGTAAAACAGCTATTCCAGTTCAAGAAC
AGAATGTAGACATGAATATCAATAATGCAAATGATGATAAGATAGCAGAA
AATTACGGGCGAAAACTATTAGAGCCTCTTGCTGCTTAAAAGCTTTTTAA
ATTATTAAACTAATTAACAATAAGAAAAAATAAAATGTAAATAAATGAAA
ATAAATTAAGGAATAATCAGAATATATTTTGTTATTGGATATTATATAAT
TAACTGCAAGAGACTTATTTTGGAATATACAAAATGGTATGGTTTGTAAT
CCCATTTAATCTCCCCATCTCGAAATCCTGG
back to top

protein sequence of SMED30019761-orf-1

>SMED30019761-orf-1 ID=SMED30019761-orf-1|Name=SMED30019761-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=484bp
MSVKLPCVCEICNCGRHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPK
SLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDD
TTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRRDYIPWDIPPAT
RRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPKSFKPVVSFMQSTDPLAQ
DTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQK
SYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDL
KTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVR
PIRRDIYEPPTDPFEDCTTFKSAFVPHELCKVDSFKPAPHMLSQEPFDDA
TMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNEDARGHLHYRKTAI
PVQEQNVDMNINNANDDKIAENYGRKLLEPLAA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000419prepharyngeal region
PLANA:0002109X1 cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR033336SAXO1/2
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005814centriole
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005879axonemal microtubule
GO:0031514motile cilium
GO:0036064ciliary basal body
GO:0036126sperm flagellum
GO:0042995cell projection
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
Vocabulary: biological process
TermDefinition
GO:0009631cold acclimation
GO:0030030cell projection organization
GO:0045724positive regulation of cilium assembly
GO:0070417cellular response to cold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR033336Stabilizer of axonemal microtubules 1/2PANTHERPTHR31516FAMILY NOT NAMEDcoord: 1..446
NoneNo IPR availablePANTHERPTHR31516:SF13STABILIZER OF AXONEMAL MICROTUBULES 2coord: 1..446