Low-density lipoprotein receptor-related protein

Overview
NameLow-density lipoprotein receptor-related protein
Smed IDSMED30019756
Length (bp)5993
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Low-density lipoprotein receptor-related protein (SMED30019756) t-SNE clustered cells

Violin plots show distribution of expression levels for Low-density lipoprotein receptor-related protein (SMED30019756) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Low-density lipoprotein receptor-related protein (SMED30019756) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Low-density lipoprotein receptor-related protein (SMED30019756) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019756

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30019756SMESG000010476.1 SMESG000010458.1 SmedASXL_016384SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30019756SMESG000010458.1 dd_Smed_v4_10112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30019756SMESG000010458.1 dd_Smed_v4_10112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30019756SMESG000010458.1 dd_Smed_v4_10112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019756SMESG000049782.1 Contig5771GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019756SMESG000010458.1 Contig38340uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019756SMESG000010458.1 Contig38340newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30019756SMESG000010458.1 Contig5771GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Human
Match: LRP5 (LDL receptor related protein 5 [Source:HGNC Symbol;Acc:HGNC:6697])

HSP 1 Score: 266.544 bits (680), Expect = 4.460e-71
Identity = 354/1509 (23.46%), Postives = 605/1509 (40.09%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMR---VQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPCMNRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSR-SLYLFMAD-SIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVE-SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLS--KNIVLRLDNYGFISAVDRTRPYVM--IKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCN 4724
            S + +A DWV   LYW D +   IEV +LN  S        R++L  +++    ++ +DP   Y++W   G    +ER+ +DGS R++I  S ++  + L ID   + L+W   D +   IHR +  G    S R   V+G+     P  LT +   L + + +   + +    TG       +   +P  I ++S++ Q   P    +    N  CS +C L   +  Y C+C TG+    N   C       L +     +  +SLD      + L  ++        YD +   + + D    +I           +R YLD       ++++I  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  +A+  +   ++ T   +    IE   LDG ++  +++++   WP GLALD    +LY+ D  K D I V    G+KR  +L  K       +   +FIYWT+ +  SI  V K   S   ++ +  +L    M + AV+    + T +PC   +  C  LCF      H+  CGC     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   K R     + +A +DG+  M +   V   ++L +D     + W   D+  I    ++ ++                 + +  H +  ++ S Y++  D +++ +  +D +S   R   T I   GH        FV   +   + +          + +  C  HN+     C Q CL +     CGC S Y+L      C   +  L+  +    I  +  +  +  D  +       +     +   KFI   YW+   +NI    D        D T+P+V+  + + +    Q HD                        L+ID  S TL W+   T  I   RL+      E +GV++  R  R +P  I +      L + +     ++           IE + LDG  R VL     I P  L VD   G+++W+D             D  +I +  + G N     D+ +   +G     + +L K+L+W D  QQ+   +   +  K +   G     + +L     T +  +  ++ E+F +         HPC+R     +N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+    RCD   +C D SDE GC  C+ +  + C+R   C+ +  RCDG  DC   SDE  C +     +F C SG+    C+ I  +C+   DC DGSDE  C 
Sbjct:  109 SPDGLACDWVGKKLYWTDSETNRIEVANLNGTS--------RKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTH--PFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQ---PFFHTRCEEDNGGCSHLCLLSPSEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAI-----------RRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILVS------------EDLDEPRAIALHPVMGLMYWTDWGENP-KIECANLDGQERRVLVNASLG-WPNGLALDLQEGKLYWGD-AKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDL----MGLKAVNVAKVVGT-NPCADRNGGCSHLCF---FTPHATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVK---EASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGL--DYPEGMAVDWMGKNLYWADTGT--NRIEVARL-----DGQFRQVLVWRDLDNP--RSLALDPTKGYIYWTEWGGKPR-----IVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQE-------------RVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNR---TLIQ--GH------LDFVMDILVFHSSR---------QDGLNDC-MHNNGQ---CGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLL-FSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFI---YWVDGRQNIKRAKD--------DGTQPFVLTSLSQGQNPDRQPHD------------------------LSIDIYSRTLFWTCEATNTINVHRLSG-----EAMGVVL--RGDRDKPRAIVVNAERGYLYFTNMQDRAAK-----------IERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDA------------DLKRIESCDLSGANRLTLEDANIVQPLG-----LTILGKHLYWIDRQQQMIERVEKTTGDKRTRIQG----RVAHL-----TGIHAVEEVSLEEFSA---------HPCAR-----DNGGCSHICIA-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPDQFACATGEI----------DCIPGAWRCDGFPECDDQSDEEGCPVCSAAQ-FPCARGQ-CVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQ----CVLIKQQCDSFPDCIDGSDELMCE 1371          

HSP 2 Score: 132.109 bits (331), Expect = 7.219e-30
Identity = 192/814 (23.59%), Postives = 336/814 (41.28%), Query Frame = 3
Query:  252 LDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFT-EGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLM------VPRGRRKSPCMNR--VCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTIS--------NLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            LD    + ++   +   + +AVDWV+ NLYW D     IEV  LN  S        R+IL+S ++ +  ++ + P    ++W   G    +E + LDG +RRV+  + L   + LA+D     L+W   D +  +++     G   R     +   P    FT  G  ++  D Q            SI        +   II +   LM      V +    +PC +R   CS +C      A RC C  G+ E +++      P   L   +   I+ +SL+     +  PL  + E + + F    D   + + + D +  +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + VAR+    R      +L W         R   N  P  LA+D    Y++ T    G   I R ++DGT   T++          L +D   Q+LY+ D     + S N  G  + ++A        L+ + ++IYWT+    SI    K  G  R+L+    +     +  I V  ++  D  + C   + +C QLC  I G      CGC++   +  +   CS  +  +++  KS +    + P+       +        V ++  D     IYW++   N  +K A +   Q     F L+S +          +L++D     L+   T  A + I + RL    S  +   V+   + K +   A+ V+++  +L++  T  +DR   A++ +A LDG++  +L   G+     LVVD     + W  +D  +I
Sbjct:  402 LDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS--------RKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWG--DAKTDKIEVINVDGTKRRT--LLEDKLPHIFGFTLLGDFIYWTDWQR----------RSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCF-FTPHATRCGCPIGL-ELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDF----DVSNNHIYWTDVSLKTISRAFMN--GSSVEHVVEFGL--DYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFR-----QVLVW---------RDLDN--PRSLALDPTKGYIYWTEWG-GKPRIVRAFMDGTNCMTLVDKVGR--ANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDF----VMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHR---CGCASHYTLDPSSRNCSPPTTFLLFSQKSAI--SRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQN--IKRAKDDGTQP----FVLTSLSQGQNPDRQPHDLSIDIYSRTLF--WTCEATNTINVHRL----SGEAMGVVLRGDRDKPR---AIVVNAERGYLYF--TNMQDR--AAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRI 1136          

HSP 3 Score: 88.1965 bits (217), Expect = 1.845e-16
Identity = 140/633 (22.12%), Postives = 245/633 (38.70%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLD-------------------------GEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGIT-EPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDF---------NSSSIFSL-DLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASID-TGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCS 2009
            LKT + + ++   +  V++F +   E +AVDW+  NLYWAD     IEV  L  D  F      R++L+ R++ +  SL +DP + Y++W + G    + R+ +DG++   +   +  +++ L ID   + L+W  LD                         G     DY   T  ++       + S    T  +G L F+ D  ++ SS +   G++  +  N                              C  +CL I    +RC C++  T +P +    P  PT  L       I  M  D    P L L            YD +   + +VD          + +  F L  L++   P R           P  +++D  SR ++W     + + V R+S     +   ++L           R  +++P   + V++   YL+ T + D    IER  LDGT++  V+ +T    P  L +D    +L++VD     + S +  G ++  L      + + L+     +YW + +   I  V K  G  R   T+ +   A    + AV   +  + +  PC   +  C  +C  I     +  C C     +L N+  C 
Sbjct:  696 LKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARL--DGQF------RQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKV-GRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQ--DGLNDCMHNNGQ----------------------------CGQLCLAI-PGGHRCGCASHYTLDPSSRNCSP--PTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQNPDR----------QPHDLSIDIYSRTLFWTCEATNTINVHRLSG----EAMGVVL-----------RGDRDKPRA-IVVNAERGYLYFTNMQDRAAKIERAALDGTER-EVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGLTILGKHLYWIDRQQQMIERVEKTTGDKR---TRIQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHIC--IAKGDGTPRCSCPVHLVLLQNLLTCG 1254          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Human
Match: LRP4 (LDL receptor related protein 4 [Source:HGNC Symbol;Acc:HGNC:6696])

HSP 1 Score: 207.223 bits (526), Expect = 1.135e-52
Identity = 300/1327 (22.61%), Postives = 515/1327 (38.81%), Query Frame = 3
Query:   69 VFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPF-------RFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHG--GSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVA---------SLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEI--VNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADS-IYQVTLSDSSSSITRKQLTFISNV----GHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVESR-ECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDW 3959
            V L+A+   + + + HR    +  N     +A D F  R+  VF        +L+    + L+   + +V+   ++S   +AVDWV   LYW D     IEV +L+           R++LL +N+    ++ + P E  ++W   G    +E S +DGS RR+I  + LF  + L ID   + ++W  +D + H ++     G   +   +     P  +T  E  L + +     ++S    TG +  +  N    P+ I +  H    P G+ +    N  C+ +CLP   + Y C+C TG  + I++  C     + L       I  +S D       E LS++  IP           +DS    + + D ++ +I     +  GT Q   +D  + S  P  +A+D  +  +YW +     + VA      R    T+L+            ++    P D+ V+ +  Y++ T     +  IER  +D + +  +ISS N  WP GLA+D   Q+LY+ D     M ++ + G  GSKR  ++  +      L+ +   IYWT+ +T SI S      +  L  +T   +   +  I V         +PC   +  C  LC     N   FSC C    ++L +   CS      + F + + I      + D  Y       +DV V          ++ +D    ++YW +   + I +  +N D  +   I      T   LAVD I   +Y       W+     R+   + D S   V+V   + +    A+ ++ ++ F++W      D    A+L ++ +DGS + +LI   +   + L VD+ ++ + W  + + +I   ++   NR                        + P      L + DS IY       + SI R      SNV     +  G+     V R+  +   K               C + N      CS  CLP  S   C C +   L  DG TC    +  ++ ++ G I  I  +  +  D  +   E                        N V+ LD       V  T  ++ + +   L+              N+         +   LA+D ++  L W+D     I A RL+    +     V+IN   S   P  IA+ P    L W   D+           H   IE ++LDG+ R VL+    G P+ LT+D  + RIYW+D   +++    ++    Q+   HV  H   +T                    ++++WTDW
Sbjct:  441 VLLFANRIDIRQVLPHRSEYTLLLNNLENAIALD-FHHRRELVFWSDVTLDRILR----ANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLD--------GAHRKVLLWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYW--VDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHT-LHPQRQPAGKNRCGDNNGGCTHLCLPSGQN-YTCACPTGFRK-ISSHACAQSLDKFLLFARRMDIRRISFD------TEDLSDDV-IPLADVRSAVALDWDSRDDHVYWTDVSTDTISRAKWD--GTGQEVVVDTSLES--PAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMR----TVLI------------WENLDRPRDIVVEPMGGYMYWTDWG-ASPKIERAGMDASGRQVIISS-NLTWPNGLAIDYGSQRLYWADA---GMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQSAD---RLTGLDRETLQENLENLMDIHVFHRRRPPVSTPCAMENGGCSHLCL-RSPNPSGFSCTCPTGINLLSDGKTCSPGMNSFLIFARRIDIR---MVSLDIPYF------ADVVVPINITMKNTIAIGVDPQEGKVYWSDSTLHRISR--ANLDGSQHEDIITTGLQTTDGLAVDAIGRKVY-------WTDTGTNRIEVGNLDGSMRKVLVWQNLDSPR--AIVLYHEMGFMYW-----TDWGENAKLERSGMDGSDRAVLINNNLGWPNGLTVDKASSQLLWADAHTERIEAADLNGANRH---------------------TLVSPVQHPYGLTLLDSYIYWTDW--QTRSIHRADKGTGSNVILVRSNLPGLMDMQAVDRAQPLGFNK---------------CGSRNG----GCSHLCLPRPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPE-----------------------LNNVISLDYDSVDGKVYYTDVFLDVIRRADLN------------GSNMETVIGRGLKTTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRK-----VLIN--NSLDEPRAIAVFPRKGYLFW--TDWG----------HIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHV-SHPFALTQQD-----------------RWIYWTDW 1574          

HSP 2 Score: 145.976 bits (367), Expect = 5.207e-34
Identity = 155/625 (24.80%), Postives = 266/625 (42.56%), Query Frame = 3
Query:  126 VDIFFNTDLKLLAADVFLSRKLYVFVIQENGK-----SLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIAL-KTN-PNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNR 1976
            +DI +  D+ ++  ++ +   + + V  + GK     S L   + + LD  +  D++   +Q+ + +AVD +   +YW D     IEV +L+           R++L+ +N+    ++V+     +++W   G    LERS +DGSDR V+  + L   + L +D+    L W   D    R++     G +     +  Q  P  LT  +  + + + +   +   + GTG ++ L ++N P +  +  + R      P G  K    N  CS +CLP   S + C+C TGI    +   C   P   L   +   I  +SLD      + +            YDSV   + Y D     I   DLN              +      +AVD  +RN+YW +   + +  +R+    R     +L++     +  E R         +AV     YLF T        IER  LDG+++  +I+ T+  WP GL LD   +++Y+VD     + S + +G  +++L        +L+  D +IYWT+ +T SI  V K+ G  R+  T   N++   M +I VS      T + C   +  C  LCF        F C C + 
Sbjct: 1064 LDIPYFADV-VVPINITMKNTIAIGVDPQEGKVYWSDSTLHRISRANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLD--------GSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSDRAVLINNNLGWPNGLTVDKASSQLLW--ADAHTERIEAADLNGANRHTLVSPVQ-HPYGLTLLDSYIYWTDWQTRSIHRADKGTGSNVILVRSNLPGLMDMQAVDRAQ----PLGFNKCGSRNGGCSHLCLP-RPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVISLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTD----GLAVDWVARNLYWTDTGRNTIEASRLDGSCR----KVLIN----NSLDEPRA--------IAVFPRKGYLFWTDWGH-IAKIERANLDGSERKVLIN-TDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSG--RNKETVLANVEG-LMDIIVVSPQRQTGTNA-CGVNNGGCTHLCF---ARASDFVCACPDE 1642          

HSP 3 Score: 57.7658 bits (138), Expect = 3.133e-7
Identity = 47/129 (36.43%), Postives = 62/129 (48.06%), Query Frame = 3
Query: 4356 CDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCC---GS-----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            C  +Q PC +G  F    G+    C++   RCD   DC D SDE  C T   +       S  C+ ++ RCDG  DC  +SDE+ C   GS      +F C +G    RC+     CNG+ DC D SDE
Sbjct:  225 CSSHQ-PCRSG-EFMCDSGL----CINAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCHSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCALDQFLCWNG----RCIGQRKLCNGVNDCGDNSDE 343          

HSP 4 Score: 55.4546 bits (132), Expect = 1.671e-6
Identity = 55/190 (28.95%), Postives = 72/190 (37.89%), Query Frame = 3
Query: 4326 GFCVKSQLVKCD-------RYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNT------CNISHLY--------------------------SCSR------------SDVCLPITKRCDGVMDCD--SDEQ-----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            G+C++S L  CD            C       K+   S  SC++    CD   DC DGSDE  C +      CN+                               CS             S +C+    RCDG  DCD  SDE+      C +++F C SG    RC+ +S RC+G  DC D SDE  C
Sbjct:  120 GYCIRS-LWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEENCPSAVPAPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCHSG----RCVRLSWRCDGEDDCADNSDEENC 304          

HSP 5 Score: 54.299 bits (129), Expect = 3.716e-6
Identity = 58/262 (22.14%), Postives = 104/262 (39.69%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLST 4205
             LA+D + D L W+D  T  I    L+    ++          ++  +P  IA+ P+  ++ W   D+  +            IE S +DG+ R ++       P+ LT+D    R+YW+D K            ++ I   ++ G + K  +   L +       ++ V +  L+WTDW  +     S+NS  K +        N + +++KL   + I   + P            Q  P  +      N  C+HLCL +
Sbjct:  515 GLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVL-------LWQNLEKPRAIALHPMEGTIYW--TDWGNTPR----------IEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAK------------HHVIERANLDGSHRKAVISQGLPHPF-----AITVFEDSLYWTDWHTK-----SINSANKFTGK------NQEIIRNKLHFPMDIHT-LHP------------QRQPAGKNRCGDNNGGCTHLCLPS 716          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Human
Match: LRP6 (LDL receptor related protein 6 [Source:HGNC Symbol;Acc:HGNC:6698])

HSP 1 Score: 161.77 bits (408), Expect = 7.006e-39
Identity = 181/810 (22.35%), Postives = 336/810 (41.48%), Query Frame = 3
Query:  219 KSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICL-PIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            +  +K   F+K +   +++V+   + S + +A DW+   LYW D +   IEV +L+           R++L  + +    ++ +DP   +++W   G +  +ER+ +DGS R +I  S ++  + L +D   + L+W   D +   IH+ +  G T     V+G+     P  LT  E  L + +     + +    TG  +    +   +P+ I +   Q   P         N  CS +CL   V   Y+C+C TG+    N   C    T  L +     +  +SLD      + L  E+        YD V   + + D    +I    ++  G+       F +++ I  P  IAVD  +RN+YW +     + V R++   R     +L+S            +  + P  + +D +  Y++ T   +    IER  LDG+ +  V+ +T+  WP GLALD    ++Y+ D     +  +N  G  +R+L + K       +   +++YWT+ +  SI  V    + R ++      D   +    V R   +   +PC   +  C  LC           C C     ++ ++  C      +++  ++ +    L  N +   I L   +   + ++L  D   N+IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + +L   H  V     + S +       A+++     F++W E   K +     + +A +DGS+   +   V   + L +D     + W   D+  I
Sbjct:   72 EEAIKRTEFNKTE--SVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLD--------GSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYW--ADAKLNFIHKSNLDG-TNRQAVVKGSLPH--PFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQ-PNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGS------QFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMR----KILIS------------EDLEEPRAIVLDPMVGYMYWTDWGE-IPKIERAALDGSDR-VVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLP-DLMGLKATNVHR---VIGSNPCAEENGGCSHLCL---YRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVK---EASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGL--DYPEGMAVDWLGKNLYWADTGT--NRIEVSKLDGQHRQVLVWKDLDSPR-------ALALDPAEGFMYWTEWGGKPK-----IDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLI 815          

HSP 2 Score: 151.754 bits (382), Expect = 7.122e-36
Identity = 197/811 (24.29%), Postives = 344/811 (42.42%), Query Frame = 3
Query:  276 VLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLM------VPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLD-ARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCF--PIRGNQHSFSCGCSNRAHVLLNISR--CSYSSEMIVYFNKS----MLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTIS----NLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            V+   +   + +AVDWV+ NLYW D     IEV  LN           R+IL+S ++ +  ++V+DP   Y++W   G I  +ER+ LDGSDR V+  + L   + LA+D     ++W   D +  +++     G   RV    K   P    FT  G  V+  D Q            SI      +     II +   LM      V R    +PC   N  CS +CL       RC+C  G  E I++      P   L       I  +SL+     +  PL  + E + + F    D   + + + D +  +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + V+++   +R      +L W+   +           P  LA+D    +++ T    G   I+R  +DG+++ T++ +       GL +D  +++LY+ D     + S N  G ++ ++A        L+ + ++IYWT+    SI    K  G  R+++    +LD    + V   SR +  +    C S++  C  LC   P+ G    F CGC   AH  LN     CS  +  +++  KS    M+I    +P+       +    S   V ++  D    Q+YWI+   N I K   +      + +  + S  +     +L++D     +Y   T  A + I + RL          +V V  K +     AV V+ +  ++++    T  ++   ++ +A LDG++  +L + G++    L +D +   + W  SD  +I
Sbjct:  397 VVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLN--------GTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWG--DAKTDKIEVMNTDGTGRRVLVEDK--IPHIFGFTLLGDYVYWTDWQR----------RSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCL-YRPQGLRCACPIGF-ELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDF----DVTDNRIYWTDISLKTISRAFMN--GSALEHVVEFGL--DYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQ-----VLVWKDLDS-----------PRALALDPAEGFMYWTEWG-GKPKIDRAAMDGSERTTLVPNVGR--ANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG--HLDYVMDILVFHSSRQSGWNE---CASSNGHCSHLCLAVPVGG----FVCGCP--AHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDI------ILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYW--TCEATNVINVTRL-------DGRSVGVVLKGEQDRPRAVVVNPEKGYMYF----TNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRI 1126          

HSP 3 Score: 112.079 bits (279), Expect = 7.979e-24
Identity = 148/634 (23.34%), Postives = 232/634 (36.59%), Query Frame = 3
Query: 2985 CSQFCL--PVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLV-KNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSVALSACSFAIIYIC 4859
            CS  CL  PV    CGC + YSL+AD  TC   +  L+    +     I   +++E+      +    L              +YW+                        MI+K ++   Q   +   +  S+NL       E   Y L+ID  S  + W+   T +I   RL+        +GV++  +  + RP  + + P    + + +      +           IE + LDG  R VL       P  L +D   G+++W D+            D  +I +  + G N  V  DS +   VG     + V + +L+W D  QQ+   I +                    + + K   RI         K  +L    Q HPC++     +N  CSH+CL                  + DG  RCSCP+ + +          C   +   C   Q  C  G +           C+ V  RCD   +C D SDE+ C  C+ S  + C+ S  C+    RC+G  +C   SDE+ C       +F C +G+    C+    +C+  VDC D SDE  C          T +PA         TV  + G +     S  + +IC
Sbjct:  900 CSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSA----INRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSR-------------------QNMIRKAQEDGSQGFTVVVSSVPSQNL-------EIQPYDLSIDIYSRYIYWTCEATNVINVTRLDG-----RSVGVVL--KGEQDRPRAVVVNPEKGYMYFTNLQERSPK-----------IERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADS------------DLRRIESSDLSGANRIVLEDSNILQPVG-----LTVFENWLYWIDKQQQMIEKIDMTG-----------------REGRTKVQARIAQLSDIHAVKELNLQEYRQ-HPCAQ-----DNGGCSHICLV-----------------KGDGTTRCSCPMHLVLLQDELS----C--GEPPTCSPQQFTCFTGEI----------DCIPVAWRCDGFTECEDHSDELNCPVCSESQ-FQCA-SGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQ----CIGKHKKCDHNVDCSDKSDELDC--------YPTEEPAPQA----TNTVGSVIGVIVTIFVSGTVYFIC 1394          

HSP 4 Score: 106.686 bits (265), Expect = 4.348e-22
Identity = 132/599 (22.04%), Postives = 254/599 (42.40%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFIN--DEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI---PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQK----FTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSR-NASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLL 1991
            LKT + + ++   +  V++F +   E +AVDW+  NLYWAD     IEV  L+         + R++L+ +++    +L +DP E +++W + G    ++R+ +DGS+R  +  ++  +++ L ID  ++ L+W  LD  +  ++     G +  V        P  LT  +  + + +     +  ++   G   +I       +  I +     Q     G  +    N  CS +CL +    + C C    +   +N  C + PT  L       I  M +D    P + L   +        YD +   L ++D   + I     +            P S ++   P  +++D  SR IYW     + + V R+      +   ++L           + +Q++P   + V+    Y++ T + + +  IER  LDGT++    F+ +S      P  LALD    +L++ D+    + S +  G ++ +L      + + L+ F+N++YW + +   I   K D + R   TK +   A+   + AV   N       PC   +  C  +C  ++G+    +  CS   H++L
Sbjct:  683 LKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLD--------GQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNV-GRANGLTIDYAKRRLYWTDLDTNL--IESSNMLGLNREVIAD-DLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQ----SGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTC-SAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVP-SQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDG----RSVGVVL-----------KGEQDRPRA-VVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSK-----PIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIE--KIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICL-VKGDG---TTRCSCPMHLVL 1236          

HSP 5 Score: 70.8626 bits (172), Expect = 2.921e-11
Identity = 164/802 (20.45%), Postives = 292/802 (36.41%), Query Frame = 3
Query: 1983 VLLNISRCSY-----SSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNT--DIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDG-SQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEI--VNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFS---FVSRSI-AISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCL--PVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRY----------SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQF-WIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSV 4301
            VL ++  CS+     ++ +++Y N+  L     T   +   I +G G  D         H    IYW + +   I +T  N    +Q  +    LS D    LA D++   LY       W+     R+  ++ D S   V+   ++      A+++     F++W      D   V ++ +A +DG S+ ++I   +   + L +D +   + W  +    I++  +   NR+                  +      P+  +L LF  D +Y    S  S            N     G+R      F    I A S ++   A +  G ++              CS  CL  PV+   +C C +   L  +G TC D +  L+++         R ++     D  DF +                         IVL+L++     A+D    Y  ++ Y   +  E            + + F     S++           +A+D ++  L W+D  T  I   RLN    +I          E    P  I + P+   + W               W +   IE + LDG+ R VLV    G P+ L +D   G+IYW D KT+K+  ++              G   +V V+  + +  GF+     +L  Y++WTDW ++    +   S  +            + + D+L  ++ +         K++++  ++ ++PC+      EN  CSHLCL   P  L                 RC+CP+   +
Sbjct:    4 VLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVG-GLEDAAAVDFVFSH--GLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPD---GLACDWLGEKLY-------WTDSETNRIEVSNLDGSLRKVLFWQELDQP--RAIALDPSSGFMYW-----TDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQ------------------AVVKGSLPHPFALTLF-EDILYWTDWSTHS--------ILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNG------------GCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLAR-------RTDLRRISLDTPDFTD-------------------------IVLQLEDIRHAIAID----YDPVEGYIYWTDDE---------VRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKIL-------ISEDLEEPRAIVLDPMVGYMYWTD-------------WGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTD------------GTGRRVLVEDKIPHIFGFT-----LLGDYVYWTDWQRRSIERVHKRSAER------------EVIIDQLPDLMGL---------KATNVHRVIGSNPCAE-----ENGGCSHLCLYR-PQGL-----------------RCACPIGFEL 620          

HSP 6 Score: 64.3142 bits (155), Expect = 3.292e-9
Identity = 55/192 (28.65%), Postives = 88/192 (45.83%), Query Frame = 3
Query:  459 SLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPT 1025
            ++VV+P + Y+++  +      +ER+ LDG++R V+  S L K   LA+D     LFW   D ++ R++    +G +  V        P  LT  E  L +I+ +Q  +   +  TG     K    IA ++ I    +L + +  R+ PC   N  CS ICL   D   RCSC   +    +   C   PT
Sbjct: 1061 AVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFW--ADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDM-TGREGRTKVQARIAQLSDIHAVKELNL-QEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPT 1248          

HSP 7 Score: 57.7658 bits (138), Expect = 3.295e-7
Identity = 67/306 (21.90%), Postives = 112/306 (36.60%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFW--------IEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSR 4316
             +A+D +   L W+D  T  I   +L+    ++                           L+W   D  ++   D +    +W        I+ + +DG+ R+ LV N G  + LT+D    R+YW D  TN             I + +++G N +V  D  L +  G +       + Y++WTDW ++     +  S    +   G    +L Y+ D L              F SS        + C+ +     N  CSHLCL+ +P+                G F C CP   S+   +R
Sbjct:  709 GMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQV---------------------------LVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTN------------LIESSNMLGLNREVIADD-LPHPFGLTQ-----YQDYIYWTDWSRRSIERANKTSGQNRTIIQG----HLDYVMDILV-------------FHSSRQSGW---NECASS-----NGHCSHLCLA-VPV----------------GGFVCGCPAHYSLNADNR 927          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Human
Match: LRP6 (LDL receptor related protein 6 [Source:HGNC Symbol;Acc:HGNC:6698])

HSP 1 Score: 161.77 bits (408), Expect = 7.006e-39
Identity = 181/810 (22.35%), Postives = 336/810 (41.48%), Query Frame = 3
Query:  219 KSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICL-PIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            +  +K   F+K +   +++V+   + S + +A DW+   LYW D +   IEV +L+           R++L  + +    ++ +DP   +++W   G +  +ER+ +DGS R +I  S ++  + L +D   + L+W   D +   IH+ +  G T     V+G+     P  LT  E  L + +     + +    TG  +    +   +P+ I +   Q   P         N  CS +CL   V   Y+C+C TG+    N   C    T  L +     +  +SLD      + L  E+        YD V   + + D    +I    ++  G+       F +++ I  P  IAVD  +RN+YW +     + V R++   R     +L+S            +  + P  + +D +  Y++ T   +    IER  LDG+ +  V+ +T+  WP GLALD    ++Y+ D     +  +N  G  +R+L + K       +   +++YWT+ +  SI  V    + R ++      D   +    V R   +   +PC   +  C  LC           C C     ++ ++  C      +++  ++ +    L  N +   I L   +   + ++L  D   N+IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + +L   H  V     + S +       A+++     F++W E   K +     + +A +DGS+   +   V   + L +D     + W   D+  I
Sbjct:   72 EEAIKRTEFNKTE--SVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLD--------GSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYW--ADAKLNFIHKSNLDG-TNRQAVVKGSLPH--PFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQ-PNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGS------QFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMR----KILIS------------EDLEEPRAIVLDPMVGYMYWTDWGE-IPKIERAALDGSDR-VVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLP-DLMGLKATNVHR---VIGSNPCAEENGGCSHLCL---YRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVK---EASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGL--DYPEGMAVDWLGKNLYWADTGT--NRIEVSKLDGQHRQVLVWKDLDSPR-------ALALDPAEGFMYWTEWGGKPK-----IDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLI 815          

HSP 2 Score: 151.754 bits (382), Expect = 7.122e-36
Identity = 197/811 (24.29%), Postives = 344/811 (42.42%), Query Frame = 3
Query:  276 VLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLM------VPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLD-ARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCF--PIRGNQHSFSCGCSNRAHVLLNISR--CSYSSEMIVYFNKS----MLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTIS----NLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            V+   +   + +AVDWV+ NLYW D     IEV  LN           R+IL+S ++ +  ++V+DP   Y++W   G I  +ER+ LDGSDR V+  + L   + LA+D     ++W   D +  +++     G   RV    K   P    FT  G  V+  D Q            SI      +     II +   LM      V R    +PC   N  CS +CL       RC+C  G  E I++      P   L       I  +SL+     +  PL  + E + + F    D   + + + D +  +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + V+++   +R      +L W+   +           P  LA+D    +++ T    G   I+R  +DG+++ T++ +       GL +D  +++LY+ D     + S N  G ++ ++A        L+ + ++IYWT+    SI    K  G  R+++    +LD    + V   SR +  +    C S++  C  LC   P+ G    F CGC   AH  LN     CS  +  +++  KS    M+I    +P+       +    S   V ++  D    Q+YWI+   N I K   +      + +  + S  +     +L++D     +Y   T  A + I + RL          +V V  K +     AV V+ +  ++++    T  ++   ++ +A LDG++  +L + G++    L +D +   + W  SD  +I
Sbjct:  397 VVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLN--------GTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWG--DAKTDKIEVMNTDGTGRRVLVEDK--IPHIFGFTLLGDYVYWTDWQR----------RSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCL-YRPQGLRCACPIGF-ELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDF----DVTDNRIYWTDISLKTISRAFMN--GSALEHVVEFGL--DYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQ-----VLVWKDLDS-----------PRALALDPAEGFMYWTEWG-GKPKIDRAAMDGSERTTLVPNVGR--ANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG--HLDYVMDILVFHSSRQSGWNE---CASSNGHCSHLCLAVPVGG----FVCGCP--AHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDI------ILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYW--TCEATNVINVTRL-------DGRSVGVVLKGEQDRPRAVVVNPEKGYMYF----TNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRI 1126          

HSP 3 Score: 112.079 bits (279), Expect = 7.979e-24
Identity = 148/634 (23.34%), Postives = 232/634 (36.59%), Query Frame = 3
Query: 2985 CSQFCL--PVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLV-KNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSVALSACSFAIIYIC 4859
            CS  CL  PV    CGC + YSL+AD  TC   +  L+    +     I   +++E+      +    L              +YW+                        MI+K ++   Q   +   +  S+NL       E   Y L+ID  S  + W+   T +I   RL+        +GV++  +  + RP  + + P    + + +      +           IE + LDG  R VL       P  L +D   G+++W D+            D  +I +  + G N  V  DS +   VG     + V + +L+W D  QQ+   I +                    + + K   RI         K  +L    Q HPC++     +N  CSH+CL                  + DG  RCSCP+ + +          C   +   C   Q  C  G +           C+ V  RCD   +C D SDE+ C  C+ S  + C+ S  C+    RC+G  +C   SDE+ C       +F C +G+    C+    +C+  VDC D SDE  C          T +PA         TV  + G +     S  + +IC
Sbjct:  900 CSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSA----INRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSR-------------------QNMIRKAQEDGSQGFTVVVSSVPSQNL-------EIQPYDLSIDIYSRYIYWTCEATNVINVTRLDG-----RSVGVVL--KGEQDRPRAVVVNPEKGYMYFTNLQERSPK-----------IERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADS------------DLRRIESSDLSGANRIVLEDSNILQPVG-----LTVFENWLYWIDKQQQMIEKIDMTG-----------------REGRTKVQARIAQLSDIHAVKELNLQEYRQ-HPCAQ-----DNGGCSHICLV-----------------KGDGTTRCSCPMHLVLLQDELS----C--GEPPTCSPQQFTCFTGEI----------DCIPVAWRCDGFTECEDHSDELNCPVCSESQ-FQCA-SGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQ----CIGKHKKCDHNVDCSDKSDELDC--------YPTEEPAPQA----TNTVGSVIGVIVTIFVSGTVYFIC 1394          

HSP 4 Score: 106.686 bits (265), Expect = 4.348e-22
Identity = 132/599 (22.04%), Postives = 254/599 (42.40%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFIN--DEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI---PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQK----FTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSR-NASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLL 1991
            LKT + + ++   +  V++F +   E +AVDW+  NLYWAD     IEV  L+         + R++L+ +++    +L +DP E +++W + G    ++R+ +DGS+R  +  ++  +++ L ID  ++ L+W  LD  +  ++     G +  V        P  LT  +  + + +     +  ++   G   +I       +  I +     Q     G  +    N  CS +CL +    + C C    +   +N  C + PT  L       I  M +D    P + L   +        YD +   L ++D   + I     +            P S ++   P  +++D  SR IYW     + + V R+      +   ++L           + +Q++P   + V+    Y++ T + + +  IER  LDGT++    F+ +S      P  LALD    +L++ D+    + S +  G ++ +L      + + L+ F+N++YW + +   I   K D + R   TK +   A+   + AV   N       PC   +  C  +C  ++G+    +  CS   H++L
Sbjct:  683 LKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLD--------GQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNV-GRANGLTIDYAKRRLYWTDLDTNL--IESSNMLGLNREVIAD-DLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQ----SGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTC-SAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVP-SQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDG----RSVGVVL-----------KGEQDRPRA-VVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSK-----PIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIE--KIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICL-VKGDG---TTRCSCPMHLVL 1236          

HSP 5 Score: 70.8626 bits (172), Expect = 2.921e-11
Identity = 164/802 (20.45%), Postives = 292/802 (36.41%), Query Frame = 3
Query: 1983 VLLNISRCSY-----SSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNT--DIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDG-SQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEI--VNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFS---FVSRSI-AISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCL--PVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRY----------SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQF-WIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSV 4301
            VL ++  CS+     ++ +++Y N+  L     T   +   I +G G  D         H    IYW + +   I +T  N    +Q  +    LS D    LA D++   LY       W+     R+  ++ D S   V+   ++      A+++     F++W      D   V ++ +A +DG S+ ++I   +   + L +D +   + W  +    I++  +   NR+                  +      P+  +L LF  D +Y    S  S            N     G+R      F    I A S ++   A +  G ++              CS  CL  PV+   +C C +   L  +G TC D +  L+++         R ++     D  DF +                         IVL+L++     A+D    Y  ++ Y   +  E            + + F     S++           +A+D ++  L W+D  T  I   RLN    +I          E    P  I + P+   + W               W +   IE + LDG+ R VLV    G P+ L +D   G+IYW D KT+K+  ++              G   +V V+  + +  GF+     +L  Y++WTDW ++    +   S  +            + + D+L  ++ +         K++++  ++ ++PC+      EN  CSHLCL   P  L                 RC+CP+   +
Sbjct:    4 VLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVG-GLEDAAAVDFVFSH--GLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPD---GLACDWLGEKLY-------WTDSETNRIEVSNLDGSLRKVLFWQELDQP--RAIALDPSSGFMYW-----TDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQ------------------AVVKGSLPHPFALTLF-EDILYWTDWSTHS--------ILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNG------------GCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLAR-------RTDLRRISLDTPDFTD-------------------------IVLQLEDIRHAIAID----YDPVEGYIYWTDDE---------VRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKIL-------ISEDLEEPRAIVLDPMVGYMYWTD-------------WGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTD------------GTGRRVLVEDKIPHIFGFT-----LLGDYVYWTDWQRRSIERVHKRSAER------------EVIIDQLPDLMGL---------KATNVHRVIGSNPCAE-----ENGGCSHLCLYR-PQGL-----------------RCACPIGFEL 620          

HSP 6 Score: 64.3142 bits (155), Expect = 3.292e-9
Identity = 55/192 (28.65%), Postives = 88/192 (45.83%), Query Frame = 3
Query:  459 SLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPT 1025
            ++VV+P + Y+++  +      +ER+ LDG++R V+  S L K   LA+D     LFW   D ++ R++    +G +  V        P  LT  E  L +I+ +Q  +   +  TG     K    IA ++ I    +L + +  R+ PC   N  CS ICL   D   RCSC   +    +   C   PT
Sbjct: 1061 AVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFW--ADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDM-TGREGRTKVQARIAQLSDIHAVKELNL-QEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPT 1248          

HSP 7 Score: 57.7658 bits (138), Expect = 3.295e-7
Identity = 67/306 (21.90%), Postives = 112/306 (36.60%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFW--------IEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSR 4316
             +A+D +   L W+D  T  I   +L+    ++                           L+W   D  ++   D +    +W        I+ + +DG+ R+ LV N G  + LT+D    R+YW D  TN             I + +++G N +V  D  L +  G +       + Y++WTDW ++     +  S    +   G    +L Y+ D L              F SS        + C+ +     N  CSHLCL+ +P+                G F C CP   S+   +R
Sbjct:  709 GMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQV---------------------------LVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTN------------LIESSNMLGLNREVIADD-LPHPFGLTQ-----YQDYIYWTDWSRRSIERANKTSGQNRTIIQG----HLDYVMDILV-------------FHSSRQSGW---NECASS-----NGHCSHLCLA-VPV----------------GGFVCGCPAHYSLNADNR 927          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Human
Match: LRP6 (LDL receptor related protein 6 [Source:HGNC Symbol;Acc:HGNC:6698])

HSP 1 Score: 160.614 bits (405), Expect = 1.290e-38
Identity = 181/810 (22.35%), Postives = 336/810 (41.48%), Query Frame = 3
Query:  219 KSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICL-PIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            +  +K   F+K +   +++V+   + S + +A DW+   LYW D +   IEV +L+           R++L  + +    ++ +DP   +++W   G +  +ER+ +DGS R +I  S ++  + L +D   + L+W   D +   IH+ +  G T     V+G+     P  LT  E  L + +     + +    TG  +    +   +P+ I +   Q   P         N  CS +CL   V   Y+C+C TG+    N   C    T  L +     +  +SLD      + L  E+        YD V   + + D    +I    ++  G+       F +++ I  P  IAVD  +RN+YW +     + V R++   R     +L+S            +  + P  + +D +  Y++ T   +    IER  LDG+ +  V+ +T+  WP GLALD    ++Y+ D     +  +N  G  +R+L + K       +   +++YWT+ +  SI  V    + R ++      D   +    V R   +   +PC   +  C  LC           C C     ++ ++  C      +++  ++ +    L  N +   I L   +   + ++L  D   N+IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + +L   H  V     + S +       A+++     F++W E   K +     + +A +DGS+   +   V   + L +D     + W   D+  I
Sbjct:   72 EEAIKRTEFNKTE--SVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLD--------GSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYW--ADAKLNFIHKSNLDG-TNRQAVVKGSLPH--PFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQ-PNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGS------QFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMR----KILIS------------EDLEEPRAIVLDPMVGYMYWTDWGE-IPKIERAALDGSDR-VVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLP-DLMGLKATNVHR---VIGSNPCAEENGGCSHLCL---YRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVK---EASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGL--DYPEGMAVDWLGKNLYWADTGT--NRIEVSKLDGQHRQVLVWKDLDSPR-------ALALDPAEGFMYWTEWGGKPK-----IDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLI 815          

HSP 2 Score: 150.984 bits (380), Expect = 1.197e-35
Identity = 197/811 (24.29%), Postives = 344/811 (42.42%), Query Frame = 3
Query:  276 VLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLM------VPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLD-ARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCF--PIRGNQHSFSCGCSNRAHVLLNISR--CSYSSEMIVYFNKS----MLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTIS----NLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            V+   +   + +AVDWV+ NLYW D     IEV  LN           R+IL+S ++ +  ++V+DP   Y++W   G I  +ER+ LDGSDR V+  + L   + LA+D     ++W   D +  +++     G   RV    K   P    FT  G  V+  D Q            SI      +     II +   LM      V R    +PC   N  CS +CL       RC+C  G  E I++      P   L       I  +SL+     +  PL  + E + + F    D   + + + D +  +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + V+++   +R      +L W+   +           P  LA+D    +++ T    G   I+R  +DG+++ T++ +       GL +D  +++LY+ D     + S N  G ++ ++A        L+ + ++IYWT+    SI    K  G  R+++    +LD    + V   SR +  +    C S++  C  LC   P+ G    F CGC   AH  LN     CS  +  +++  KS    M+I    +P+       +    S   V ++  D    Q+YWI+   N I K   +      + +  + S  +     +L++D     +Y   T  A + I + RL          +V V  K +     AV V+ +  ++++    T  ++   ++ +A LDG++  +L + G++    L +D +   + W  SD  +I
Sbjct:  397 VVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLN--------GTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWG--DAKTDKIEVMNTDGTGRRVLVEDK--IPHIFGFTLLGDYVYWTDWQR----------RSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCL-YRPQGLRCACPIGF-ELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDF----DVTDNRIYWTDISLKTISRAFMN--GSALEHVVEFGL--DYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQ-----VLVWKDLDS-----------PRALALDPAEGFMYWTEWG-GKPKIDRAAMDGSERTTLVPNVGR--ANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG--HLDYVMDILVFHSSRQSGWNE---CASSNGHCSHLCLAVPVGG----FVCGCP--AHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDI------ILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYW--TCEATNVINVTRL-------DGRSVGVVLKGEQDRPRAVVVNPEKGYMYF----TNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRI 1126          

HSP 3 Score: 105.916 bits (263), Expect = 6.072e-22
Identity = 131/599 (21.87%), Postives = 253/599 (42.24%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFIN--DEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI---PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQK----FTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSR-NASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLL 1991
            LKT + + ++   +  V++F +   E +AVDW+  NLYWAD     IEV  L+         + R++L+ +++    +L +DP E +++W + G    ++R+ +DGS+R  +  ++  +++ L ID  ++ L+W  LD  +  ++     G +  V        P  LT  +  + + +     +  ++   G   +I       +  I +     Q     G  +    N  CS +CL +    + C C    +   +N  C + PT  L       I  M +D    P + L   +        YD +   L ++D   + I     +            P S ++   P  +++D  SR IYW     + + V R+      +   ++L           + +Q++P   + V+    Y++ T + + +  IER  LDGT++    F+ +S      P  LALD    +L++ D+    + S +  G ++ +L      + + L+ F+N++YW + +   I  +   G  R   TK +   A+   + AV   N       PC   +  C  +C  ++G+    +  CS   H++L
Sbjct:  683 LKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLD--------GQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNV-GRANGLTIDYAKRRLYWTDLDTNL--IESSNMLGLNREVIAD-DLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQ----SGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTC-SAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVP-SQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDG----RSVGVVL-----------KGEQDRPRA-VVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSK-----PIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTG--REGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICL-VKGDG---TTRCSCPMHLVL 1236          

HSP 4 Score: 92.0485 bits (227), Expect = 1.191e-17
Identity = 121/546 (22.16%), Postives = 193/546 (35.35%), Query Frame = 3
Query: 2985 CSQFCL--PVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLV-KNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCC 4607
            CS  CL  PV    CGC + YSL+AD  TC   +  L+    +     I   +++E+      +    L              +YW+                        MI+K ++   Q   +   +  S+NL       E   Y L+ID  S  + W+   T +I   RL+        +GV++  +  + RP  + + P    + + +      +           IE + LDG  R VL       P  L +D   G+++W D+            D  +I +  + G N  V  DS +   VG     + V + +L+W D  QQ+   I +                    + + K   RI         K  +L    Q HPC++     +N  CSH+CL                  + DG  RCSCP+ + +                + C   Q  C +G             C+    RC+   +C D SDE  C    +   + C+    C+   K+CD  +DC   SDE  C
Sbjct:  900 CSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSA----INRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSR-------------------QNMIRKAQEDGSQGFTVVVSSVPSQNL-------EIQPYDLSIDIYSRYIYWTCEATNVINVTRLDG-----RSVGVVL--KGEQDRPRAVVVNPEKGYMYFTNLQERSPK-----------IERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADS------------DLRRIESSDLSGANRIVLEDSNILQPVG-----LTVFENWLYWIDKQQQMIEKIDMTG-----------------REGRTKVQARIAQLSDIHAVKELNLQEYRQ-HPCAQ-----DNGGCSHICLV-----------------KGDGTTRCSCPMHLVLLQDE------------LSCGESQFQCASG------------QCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQ-CIGKHKKCDHNVDCSDKSDELDC 1315          

HSP 5 Score: 70.4774 bits (171), Expect = 3.522e-11
Identity = 109/496 (21.98%), Postives = 185/496 (37.30%), Query Frame = 3
Query: 2985 CSQFCL--PVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRY----------SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQF-WIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMS 4427
            CS  CL  PV+   +C C +   L  +G TC D +  L+++         R ++     D  DF +                         IVL+L++     A+D    Y  ++ Y   +  E            + + F     S++           +A+D ++  L W+D  T  I   RLN    +I          E    P  I + P+   + W               W +   IE + LDG+ R VLV    G P+ L +D   G+IYW D KT+K+  ++              G   +V V+  + +  GF+     +L  Y++WTDW ++    +   S  +            + + D+L  ++ +         K++++  ++ ++PC+      EN  CSHLCL   P  L                 RC+CP            IGF + S +  C    I   A L+FS++  +  +S
Sbjct:  293 CSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLAR-------RTDLRRISLDTPDFTD-------------------------IVLQLEDIRHAIAID----YDPVEGYIYWTDDE---------VRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKIL-------ISEDLEEPRAIVLDPMVGYMYWTD-------------WGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTD------------GTGRRVLVEDKIPHIFGFT-----LLGDYVYWTDWQRRSIERVHKRSAER------------EVIIDQLPDLMGL---------KATNVHRVIGSNPCAE-----ENGGCSHLCLYR-PQGL-----------------RCACP------------IGFELISDMKTC----IVPEAFLLFSRRADIRRIS 646          

HSP 6 Score: 57.3806 bits (137), Expect = 4.014e-7
Identity = 67/306 (21.90%), Postives = 112/306 (36.60%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFW--------IEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSR 4316
             +A+D +   L W+D  T  I   +L+    ++                           L+W   D  ++   D +    +W        I+ + +DG+ R+ LV N G  + LT+D    R+YW D  TN             I + +++G N +V  D  L +  G +       + Y++WTDW ++     +  S    +   G    +L Y+ D L              F SS        + C+ +     N  CSHLCL+ +P+                G F C CP   S+   +R
Sbjct:  709 GMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQV---------------------------LVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTN------------LIESSNMLGLNREVIADD-LPHPFGLTQ-----YQDYIYWTDWSRRSIERANKTSGQNRTIIQG----HLDYVMDILV-------------FHSSRQSGW---NECASS-----NGHCSHLCLA-VPV----------------GGFVCGCPAHYSLNADNR 927          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Celegans
Match: lrp-1 (Low-density lipoprotein receptor-related protein [Source:UniProtKB/Swiss-Prot;Acc:Q04833])

HSP 1 Score: 127.872 bits (320), Expect = 6.664e-29
Identity = 169/811 (20.84%), Postives = 336/811 (41.43%), Query Frame = 3
Query:  303 ESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQ----GTWKQWSPTFLTFTEGKLVFINDEQLW----VSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLS-----ENAGIPFRFAYDSVTSSLLYVDFNS-----------SSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGT--CSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR-ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCS-YSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIY-----WINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYR 2633
            E +A+DWV  NLYW D     IEV +L          ++R +L+ +N++    + VDP +  +FW   G    +ER+ +DG+DR++I K+ ++  + +A+D     +++   D ++  +D+    G S R Q      + Q       F +  +++ +D +L        +  GT       T      +  +   H ++ P   + +PC    CS +CL    + + C C  G     +   C       L I     ++ + ++   +    +L+        G  F  AYD+++  +  ++  +           S+I+   +N     + F    P   D    +  D   RN+   N     + + R       +Y +++LS   SPT   +       P  +AVD+   Y+F      G     + R  LDG+    VI+S +      +A+D    ++YF +   G + SV Y G  +  +L+   ++   L+++ + +++ +    SI     +G  +         D   +  I   +  +  +G PC+  +  CD +C P+   Q   +C C+N  +V    + C  +    ++   K+ +I + +     K       G   + +  +  D+    IY      IN+    I          R +    + S TI +LA+D+I  N+Y     +  + I + +L     D ++  ++++TK +     +++V    ++L+W +   K       + ++ LDGS + +++  G+A+  +LVVD  +  + W  +    IYR
Sbjct: 1558 EGIALDWVGRNLYWVDSSLNTIEVANLE-------DPKQRTLLVHQNVSQPRGIAVDPRKGVMFWTDWGQNPCIERASMDGTDRQIIVKTKIYWPNTIALDYTTDRVYF--ADSKLDFIDFVNYDG-SGRTQVLASSKFVQHPHALAIFED--MMYYSDRRLQKLQVYPKYPNGTTSEYPSHTFSKALGVVAV---HPVLQPV-IKNNPCSTNPCSHLCLLNNKNTFTCKCPMGEKLDASGKKCIDDAKPFLVIIQKTNVFGIEMNSASEKETPVLAGMVPLSGLGNAFDAAYDALSEEMFILEHTNHAKTLAQITTDSAIYRSTVNGGNKTKMFSSAVP---DDAYCLGFDWNGRNLVVGNKITQTIEIIRTQG---KQYRSVILSNDQSPTAVVT-------PVAIAVDADKGYVFWLDRGGGAADAKVARAGLDGSNPL-VIASNDLAELDHIAIDTTNTRVYFSEAKAGRISSVTYDGQDRHYVLSDGGRQPNGLAFYGDRLFYADSAFDSIEVATINGDSQPPQWTHFKKDVENLANIKALQPRASSSGHPCHINNGNCDHICIPLMFAQR--TCTCAN-GYVKDGQTSCKLFDESFVIVATKTKVIGYPIDETQSKGVAMEPIG--GLSITGVDYDYESKTIYVAEASGINKG---ITAYTIGESSPRAVIRDSIGSLTIKSLAIDWINYNMYFINHDAERTNIEVSKL-----DGTYRKILLTTKTETP--SSIAVDPVSRYLYWADQGQK-----PTIQRSFLDGSRREVIVSSGIAEPTDLVVDVASKMIYWSDAKMDGIYR 2318          

HSP 2 Score: 93.9745 bits (232), Expect = 1.325e-18
Identity = 152/640 (23.75%), Postives = 273/640 (42.66%), Query Frame = 3
Query:  801 TGISIALKTNPNIAPIAIISRKHQLM-VPRGRRKSPCMNRV-CSSICLPIVDSAYRCSCSTGITEPINNAVCP---TFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMIS-VNYHG-GSKRILA-QKF-QEFISLSYFDNFIYWTE--LETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRN-ASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRC-SYSSEMIVYFNKSMLITHHLTPNTDKQYIEL-------GKGES-DVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQR-------QLKIFCLS-SDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFT-HSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRG-VADIDELVVDEQANYVCWKSSDSGKI 2627
             G S     +PN  PI       QL+   +   ++ C++   CS  C       + CSC  G    ++   C          +++ N  +IY+             + ENA      A+DS+T  + + D     I S   N+ GT    ++   +  DI   IA+D   RN+YW++   + + VA +      K  TLL+            +Q    P  +AVD     +F T      C IER  +DGT +  +I  T  +WP  +ALD    ++YF D+ K D I  VNY G G  ++LA  KF Q   +L+ F++ +Y+++  L+ L ++    +G+     + T    ++ + V+AV      +   +PC  ++N C  LC  +  N+++F+C C     +  +  +C   +   +V   K+ +    +   ++K+   L       G G + D    +L  + +   I      A  + +  +++ I R       + K+F  +  D    L  D+   NL   V +     I IIR     +  V  +N    T +   +  A++V +D  ++FW +         A++ +A LDGS P++I    +A++D + +D     V +  + +G+I
Sbjct: 1406 AGCSFKCHNSPN-GPICSCPFGEQLVNKTKCEPENECLDSSSCSQRCKD-EKHGFTCSCDEGYELDVDKRTCKVADNVKDTRIYVSNRNRIYYSDHKLDNWHTFGAIVENA---IALAWDSLTDRIYWSDIREKKILSA--NRNGTNATVFIADGL--DITEGIALDWVGRNLYWVDSSLNTIEVANLED---PKQRTLLV------------HQNVSQPRGIAVDPRKGVMFWTDWGQNPC-IERASMDGTDR-QIIVKTKIYWPNTIALDYTTDRVYFADS-KLDFIDFVNYDGSGRTQVLASSKFVQHPHALAIFEDMMYYSDRRLQKLQVYPKYPNGTTSEYPSHTF---SKALGVVAVHPVLQPVIKNNPC--STNPCSHLC--LLNNKNTFTCKCPMGEKLDASGKKCIDDAKPFLVIIQKTNVFGIEMNSASEKETPVLAGMVPLSGLGNAFDAAYDALSEEMF---ILEHTNHAKTLAQITTDSAIYRSTVNGGNKTKMFSSAVPDDAYCLGFDWNGRNLV--VGNKITQTIEIIRTQGKQYRSVILSNDQSPTAVVTPV--AIAVDADKGYVFWLDRGGGAAD--AKVARAGLDGSNPLVIASNDLAELDHIAIDTTNTRVYFSEAKAGRI 2002          

HSP 3 Score: 73.9442 bits (180), Expect = 1.621e-12
Identity = 123/546 (22.53%), Postives = 221/546 (40.48%), Query Frame = 3
Query:  303 ESVAVDWVSGNLYW--ADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFW--WGLDG-----------EIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQ------LMVPRGRRKSPCMNRVCSSICLPIVDSAY-RCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLD-GTQKFTVISSTNDFWPRGLALDEYRQQLYFVDT---VKGDMIS-----VNYHGGSKRILAQK---FQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVT---KTRNLD 1829
            +S+A+DW++ N+Y+   D +   IEV  L+           R+ILL+       S+ VDP  +YL+W   G    ++RS LDGS R VI  S + + + L +D   KM++W    +DG           E+ R D     G ++  Q  +  W+   L          N   L +S     T ++ +LK   +I  +A+ S  +Q        +    RKSP     C+ +C     +    CSC+ G+   +    C   P   +   +  KI    +D  ++P ++     A  P +  +  ++         +   F +D+N     +R Y  F + S  PV +       NI W              S N  +   L+      P  KE R+       D+ +D + + ++ T    G    +   +D   +  + I+S +  W   LA+D     L++ D+     G +        N  GGS++++  +       I++ + +  IYW ++  L+I    +DG  R ++    + ++LD
Sbjct: 2206 KSLAIDWINYNMYFINHDAERTNIEVSKLD--------GTYRKILLTTKTETPSSIAVDPVSRYLYWADQGQKPTIQRSFLDGSRREVIVSSGIAEPTDLVVDVASKMIYWSDAKMDGIYRVRSTGGTPELVRSDIASAAGVALHGQNMY--WTDNRLEKLFRATSKPNQTSLLLSP----TTVAASLK---DIGDVAVFSSNNQPRASSPCQITDNLRKSP-----CTQLCFATPGTQTPTCSCARGV---LKGRTCEE-PDTYIMFSDGDKI----IDVAIEPDVK-----ASRPLKDPFPEIS---------NLQTFDVDVNL----RRVY--FVVES--PVGV-------NISWF-------------SMNNAENPRLVFGASKQPHAKEIRHIS-----DMKLDWLTQKIYFTTGRGG----KVMAIDTAGEHLSTIASGD--WTYALAIDPCSGLLFWSDSGYKTSGGLYEPRIERSNLAGGSRKVIVSESISLPAAIAVDFRNQKIYWADVNRLNIEVADYDGQNRKVIASGYRAKSLD 2668          

HSP 4 Score: 68.5514 bits (166), Expect = 6.729e-11
Identity = 128/615 (20.81%), Postives = 247/615 (40.16%), Query Frame = 3
Query:  255 DRRKMRDVLKFPVQS---AESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHR---VDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIAL---KTNPNIAPIAIISRKHQLMVPRGRR--------KSPCMNRVCSSICLPIVDS-----AYRCSCSTGITEPINNAVCPT------FPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVS--RNASIDTGS---PCYSTSNKCDQLCF--PIRGNQHSFSCGCSNRAHVLLN 1994
            D  ++  + K  ++S      +AVDW++  LY  +  ++ I+V   + +         R +LL+  +     + +DP    +F+      + LE + +DG++RR +  +   + S + +D   K ++W  +D ++ R   +DYQG     +  QG      P  L   +  L + +  +L V   E   G    L    T  N+ P+  IS  H +  P   +        ++PC N  C  +C+   D+      Y+C+C  G  + +N   C        F +  +  G  P+I   +L   + P   +     G+ F    D   +S  Y D   ++I+ +  +  G            +D   S++ D  S+ +Y++++  + + V +I         T L+   P    +     + + P  + V      LF         +I R  +DG Q   VI +T    P  +A+D    +L + DT+   +  +++ G +   L       ++++  + +IY+      SI  V       S + +    D R++  +     +N  I   S   PC ++  +C QLCF  P   + +     C+ R   ++N
Sbjct:  455 DEGEISQIKKLSLKSLVYPRCLAVDWITNTLYIIESGSRRIDVSSYDGER--------RTVLLADGLTLPLDIALDPLRGEMFFTNQ---LKLEAAAMDGTNRRTLVNTHTHQVSGIVVDITAKRVYW--VDPKVDRLESIDYQGNDR-RIVAQGMNVVPHPFGLALFDQYLYWTDWTRLGVIQVE-KFGSDTKLLWSNTENNVFPMG-ISAYHPMAQPGPGQSECLAMKIENPCTNADCEGMCILSKDNGGFGVGYKCACPIG-QKLVNGKRCIDSIDYLLFSSNKIVRGIFPEINEKALAEAVLPISPISQRRIGMYFEVECDVHGNSFFYADIMDNTIYRIRPDGEGAAPVLV----THNDGLFSMSFDWISKQLYYVDNIRNSLEVVKIGE-------TGLV--HPDELVRRQLITELRDPVSVVVHPWKGLLFYAEAMRPA-AIYRCHIDG-QNCQVIRNTTLGRPSEMAIDFAENRLCWGDTLLKTISCMDFDGKNVVKLDIDNPIPVAITIMNEYIYYVHQRPYSIRRVHKKNGGGSKIVREFGADERSIFSLKACSHQNQPIPDDSREHPCRAS--QCTQLCFATPSESHPNELEAKCACRQGFMIN 1035          

HSP 5 Score: 67.3958 bits (163), Expect = 1.295e-10
Identity = 110/555 (19.82%), Postives = 222/555 (40.00%), Query Frame = 3
Query: 1032 LFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFA--YDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQ---EFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRN---------LDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQH---SFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASL-----------QLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNL-YASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWR-GVADIDELVVDEQANYVCW 2603
            LF+     +Y ++     + P E + + A   F +   +D     + + D  + S FS D++  G   +       S   P  +AVD  +  +Y +   +  +    +SS++  +   LL      P              D+A+D +   +F T        +E   +DGT + T+++ T+     G+ +D   +++Y+VD     + S++Y G  +RI+AQ          L+ FD ++YWT+   L +  V KF    + L + T N               P    S   ++   +PC  T+  C+ +C   + N      + C C      L+N  RC  S + +++   S  I   + P  +++ +     E+ + ++ +           + D + N  ++ +   N I +     D +    +    +D + +++ D+I   L Y     ++   + I      H D      ++ T++++ +  +V VH     LF+ E         A +++ H+DG    +I    +    E+ +D   N +CW
Sbjct:  397 LFVARREGLYRLNP----KNPDEEVKKLASGEFIYGIDFDYGDRKIFWTDRLAHSAFSADVDDEGEISQIKKLSLKSLVYPRCLAVDWITNTLYIIESGSRRI---DVSSYDGERRTVLLADGLTLPL-------------DIALDPLRGEMFFT----NQLKLEAAAMDGTNRRTLVN-THTHQVSGIVVDITAKRVYWVDPKVDRLESIDYQGNDRRIVAQGMNVVPHPFGLALFDQYLYWTDWTRLGVIQVEKFGSDTKLLWSNTENNVFPMGISAYHPMAQPGPGQSECLAMKIENPC--TNADCEGMCILSKDNGGFGVGYKCACP-IGQKLVNGKRCIDSIDYLLF--SSNKIVRGIFPEINEKAL----AEAVLPISPISQRRIGMYFEVECDVHGNSFFYADIMDNTIYRI--RPDGEGAAPVLVTHNDGLFSMSFDWISKQLYYVDNIRNSLEVVKIGETGLVHPDELVRRQLI-TELRDPV--SVVVHPWKGLLFYAEA-----MRPAAIYRCHIDGQNCQVIRNTTLGRPSEMAIDFAENRLCW 907          

HSP 6 Score: 67.0106 bits (162), Expect = 1.937e-10
Identity = 41/111 (36.94%), Postives = 58/111 (52.25%), Query Frame = 3
Query: 4422 MSCMSVQQRCDSTVDCLDGSDEVGCNT----CNISHLYSCSRSDVCLPITKRCDGVMDC----DSDEQC------CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            +SC++  QRCD+  DC DGSDE  C      C+  +++ C+    C  ++K+CDG  DC    D  + C      C   +F C    D T+C+  S  C+G  DC DGSDE
Sbjct:  107 VSCIAEYQRCDNITDCADGSDEKDCPASTVDCSSQNVFMCADGRQCFDVSKKCDGKYDCRDLSDEKDSCSRNHTACFQYQFRC---ADKTQCIQKSWVCDGSKDCADGSDE 214          

HSP 7 Score: 63.929 bits (154), Expect = 1.660e-9
Identity = 45/111 (40.54%), Postives = 61/111 (54.95%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDE----VGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC----DSD-EQC----CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C+  Q +CDS  DC DGSDE     G  TC  ++ +SC+    C+PI   CDG  DC    D D E+C    C + +F C +G+   +C+P+   C+G  DC DGSDE  C
Sbjct: 1158 CIPEQWKCDSDNDCGDGSDEKLEMCGNATC-AANQFSCANG-RCIPIYWLCDGDNDCYDGTDEDKERCPPVQCSALQFRCANGR---QCVPLRNHCDGQSDCEDGSDEDSC 1263          

HSP 8 Score: 59.3066 bits (142), Expect = 3.828e-8
Identity = 81/380 (21.32%), Postives = 148/380 (38.95%), Query Frame = 3
Query:  921 CSSICLPIVDSAYRCSCSTGITEPINNAVCPTF---PTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPV---------SIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFT----VISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR-ILAQKFQEFISLSYFDNFIYWTELETLSI-HSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRC 2006
            CS  C   + S Y+C C  G     ++  C      P     + N   I  +S+DG      EL ++          D        +D     +  +DL++        +D P+SS   V          IAVD   R +Y +N +   + V  +      ++   L+           R QQ   P  + V     YLF T  +     I R  LDG+ +       ++  +  WP  +A+D +  +L++ D    ++  +++ G  +R I AQ+     S+  FD+++YW +     +    K+ G   +++ KT  L    + ++   R  +    +PC   +  C  LC  I    + ++C C ++  +L +   C
Sbjct: 3277 CSQKCDDKIGS-YKCGCVDGYQLSSDDHSCKRTEMEPEPFFLLANKHYIRKISIDGN---KYELAAQGFDNVVSLDIDLTEKKAYLIDQGKLRLLRVDLDE--------MDSPLSSYETVLRHNVYGTEGIAVDWVGRKLYMLNRQERSIRVCELDG----RFCKTLI---------RDRIQQ---PKAIVVHPGKGYLFFTEWSLQP-YIGRIALDGSPELQDPIFKLAEHDLGWPNAIAIDYFSDRLFWGDAHLNEIGFMDFDGNGRRHIPAQRTSHVSSMVVFDDYLYWADWNLREVLRCDKWTGKNETILKKTVQL-PNDLRIVHPMRQPAYP--NPCGDNNGGCSHLCL-IGAGGNGYTCSCPDQFVLLSDQKTC 3623          

HSP 9 Score: 58.5362 bits (140), Expect = 6.333e-8
Identity = 58/212 (27.36%), Postives = 85/212 (40.09%), Query Frame = 3
Query: 4134 QNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDV-------CLPITKRCDGVMDC------------DSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            + HPC RAS      +C+ LC +T   S   E            + +C+C     +  ++ H    C K    K +  Q+       F  K G     C+  + +CD   DCLD SDE+        H   C+ + +       C+P    CDG  DC            D  +  C ++KF+C    D  RC+P   +C+   DC DGSDE
Sbjct:  997 REHPC-RAS------QCTQLCFATPSESHPNEL-----------EAKCACRQGFMINKENNHS---CQKDPAEKIE--QLCSSNSTQFQCKNGR----CIPKEWKCDGENDCLDESDEIDEKGDKCFHETECAENTIKCRNTKKCIPAQYGCDGDNDCGDYSDEDVKYCKDGQKPVCAAKKFQC----DNHRCIPEQWKCDSDNDCGDGSDE 1177          

HSP 10 Score: 57.7658 bits (138), Expect = 1.159e-7
Identity = 95/396 (23.99%), Postives = 148/396 (37.37%), Query Frame = 3
Query: 3576 IAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLV-KNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEM---ENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMS-VTHKSRHKIGFCV----KSQLVK--CDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVG--CNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ------CCGSQKFECLSGKDVTRCLPISARCNGIVDCRD 4700
            +AI P S  L W     S S    S   ++  IE S+L G  R V+V ++  +P+ + VD  + +IYW D   N+L           I      G N KV          G+   S+ +  ++L+ +D        I   S        G    N+   + ++   +R+ A         S      +N  C+  + ++   +N  C  LC       +A++     +      K +CSC  +   V    +     CV     S+  K     Y   CG G            SC+ +   CDS  DC D SDE    CNT +    Y+   +  C+   K+C+ + DC   SDE        C    F C +G     C+  +  C+G  DC D
Sbjct: 2575 LAIDPCSGLLFW-----SDSGYKTSGGLYEPRIERSNLAGGSRKVIVSESISLPAAIAVDFRNQKIYWADV--NRL----------NIEVADYDGQNRKVIAS-------GYRAKSLDIWDRWLYMSDPLSNGVFRIDKES--------GSGLENVVSDR-RIPGALRVFA---------SESDVRTRNQVCNALTSQLCKTDNGGCDQLC-----TVVADDIGLAAS------KVQCSCNDTYELVQEPGKDYPTQCVLRGSNSEPAKECLPPYNFQCGDG------------SCILLGATCDSKPDCADASDENPNYCNTRSCPEDYNLCTNRRCIDSAKKCNHIDDCGDGSDELDCPSAVACAEGTFPCSNG----HCINQTKVCDGHNDCHD 2901          

HSP 11 Score: 57.7658 bits (138), Expect = 1.198e-7
Identity = 41/124 (33.06%), Postives = 59/124 (47.58%), Query Frame = 3
Query: 4377 CGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVG--CNTCNISHL-YSCSRSDVCLPITKRCDGVMDCD--SDE-------QCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            CG     + +   +   C+ +   CD   DC DG+DE    C     S L + C+    C+P+   CDG  DC+  SDE       + C   +F+C+S      C+P S +C+G  DC DGSDE
Sbjct: 1182 CGNATCAANQFSCANGRCIPIYWLCDGDNDCYDGTDEDKERCPPVQCSALQFRCANGRQCVPLRNHCDGQSDCEDGSDEDSCAVTAESCTPDQFKCVSSG---LCIPASWKCDGQQDCDDGSDE 1302          

HSP 12 Score: 56.6102 bits (135), Expect = 2.425e-7
Identity = 58/255 (22.75%), Postives = 106/255 (41.57%), Query Frame = 3
Query:  306 SVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWG-LDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSF--ECGTGISIALKTNPNIAPI-AIISRKHQLM-VPRGRRKSPCMNRVCSSICLPIVDSAY------RCSCSTG-ITEPINNAVCPTFPTRSL 1034
            S++ DW+S  LY+ D     +EVV +  ++      E  R  L   + D  S+VV PW+  LF+ +      + R  +DG + +VI  + L + S++AID     L W   L   I  +D+ G+    + +        P  +T     + +++     +     + G G  I  +   +   I ++ +  HQ   +P   R+ PC    C+ +C      ++      +C+C  G +    NN  C   P   +
Sbjct:  801 SMSFDWISKQLYYVDNIRNSLEVVKIG-ETGLVHPDELVRRQLITELRDPVSVVVHPWKGLLFYAEAMRPAAIYRCHIDGQNCQVIRNTTLGRPSEMAIDFAENRLCWGDTLLKTISCMDFDGKNVVKLDIDNPI----PVAITIMNEYIYYVHQRPYSIRRVHKKNGGGSKIVREFGADERSIFSLKACSHQNQPIPDDSREHPCRASQCTQLCFATPSESHPNELEAKCACRQGFMINKENNHSCQKDPAEKI 1050          

HSP 13 Score: 55.0694 bits (131), Expect = 7.717e-7
Identity = 41/119 (34.45%), Postives = 60/119 (50.42%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEV-----GCNT----CNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQKFECLSGK-----DVTRCLPISARCNGIVDCRDGSDEH-GCNRNN 4733
            C+  + +CD + DC DG DE      GC +    C+    +S S    C+   +RCD + DC   SDE+ C +   +C S       D  +C  +S +C+G  DCRD SDE   C+RN+
Sbjct:   65 CIRTEWKCDGSGDCSDGEDEKDCPHPGCKSDQWQCDTYTWHSVS----CIAEYQRCDNITDCADGSDEKDCPASTVDCSSQNVFMCADGRQCFDVSKKCDGKYDCRDLSDEKDSCSRNH 179          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Celegans
Match: lrp-2 (Low-density lipoprotein RecePtor related [Source:UniProtKB/TrEMBL;Acc:O01768])

HSP 1 Score: 78.5666 bits (192), Expect = 6.524e-14
Identity = 122/540 (22.59%), Postives = 224/540 (41.48%), Query Frame = 3
Query:  498 LQIGAIMVLERS--RLD---GSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE-IHRVDYQG---QTGCSMRVQGTWKQWSPTFLTFTEGKLVF-INDEQLW-VSSFECGTGISIALKTNP-------NIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPT---FPTRSLFIG---NPPKIYHMSLDGGLQPPLELLSE--NAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPV-SIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGT-------CSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRIL---AQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFP--IRGN--QHSFSCGCSNRAHVLLN 1994
            L +  + VL++   R+D   G   R+ ++ I   S  LAID   + L++  +    I  VDY     +T  S R+    K      + + EG+L   + D +++ +++ +  + + I  +  P       NI  + ++  +      + + K+ C   +C  +C+  ++    C C  G  +  NN  C          LF+     P +I  +  D   +  +  +S+  N   P    +D     LL  D    S+    + K G+    Y    ++  +    +A D  S N+Y  + R   + V R+S+   L    +++S   S             P  +A+     YLF     +           IER  LDG+++ T++S  N  W  GL LD     LY+ D  +  +  + ++G  + ++   A K      L++FDN I++TE +  ++  V  D      V +     A    ++ V +N++ +T SPC ++SN C+  CF    +G+       CGC++   VL N
Sbjct:  404 LLVSEVDVLQQGIWRIDVASGQRYRLSYQPIT--SPALAIDPFTETLYFVDIGARSIKAVDYNANYSRTIVSGRIAKEVK-----MIDYAEGRLFLTLKDNRVFAMNALDSNSDMKIWQEVTPQRKQGNENIQILEVLHFRRNEHAWKNKGKNICKAAMCDDMCIGHINQTSSCFCRDGYIQ--NNTKCSASKDLKDEELFVLAQLRPSRIKILGFDKNYRTEIIGVSDLLNVKRPSAMTFDPKGEQLLMYDLRRHSLV---VQKIGSTN--YTVHGLTGIMNCEGMAYDFTSDNLYMTDQRRKIITVQRLSN---LSIQKVVVSGNMSN------------PRAIAIHIAKSYLFWGSWNEDNNDDEKIPAMIERSKLDGSERKTLVSK-NAMWINGLTLDLKNDYLYWCDAYRNVIERIRWNGADREVVVHGADKISHPYGLAFFDNHIFYTEFKKGAVKRVNVD--FPDDVQEVFQYSATVFELL-VFKNSNPETTSPCSTSSNICEHFCFASSCKGSVGCEPVKCGCADGMKVLKN 910          

HSP 2 Score: 77.0258 bits (188), Expect = 2.043e-13
Identity = 85/374 (22.73%), Postives = 157/374 (41.98%), Query Frame = 3
Query:  894 RKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVC---PTFPTRSLFI-GNPPKIYHMSLDGGLQPPL-ELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR-ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVI--AVSRNASIDTG-SPCYSTSNKCDQLCFP-----IRGNQHSFSCGCS 1970
            R   C    CS  C+   D  ++C C+ G     N   C    T     L + G+  K++  ++DG  +  L   L+    + +    D V  + +  D N + I S+       P  + +   + +     IAVD   RNIY+ +  +  + V  +    R ++  +LL   P              P  + +D +   +F T     +  I R  +DG+ +  ++      WP  LA+D   Q+LYF D  +  + S NY G  +R +L    +   +L+ F++++YW++    +I  V K  G+ R ++ + +        ++  ++    S+ T   PC S   +CD LC P     +  +  +F+C C+
Sbjct: 3118 RSPSCPKANCSHFCIDRRDVGHQCFCAPGYILSENQKDCRRNDTIEAEILMVYGHRLKLF--TIDGHAKATLLSNLTNGVALDYDVKSDLVYWTDVAHDGNKAGITSMS----NQPNTYRVINSLPTKGIDGIAVDWLGRNIYYTDRNHDAIAVCDM----RGRFNRILLKGTPL-----------NDPRAIVLDPLQALVFWTDWG-ASAHIGRMNMDGSNEQVILQDRTIRWPNALAVDAPAQRLYFGDAHRDYIASCNYDGSKRRMVLRGSVRHIFALAVFEDYVYWSDWHNHTIERVHKITGTNRKVLIQDKQYRPMGFKIVHPSLQSMGSLKTARHPC-SQPARCDNLCIPANTPDLTTSSDNFTCMCA 3468          

HSP 3 Score: 72.4034 bits (176), Expect = 4.557e-12
Identity = 111/493 (22.52%), Postives = 185/493 (37.53%), Query Frame = 3
Query: 3339 VQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLV-KNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSL--LSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVN--SDIKPSAAMGMHFYNLQYLKDK-------LKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFL-MTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDV------CLPITKRCDGVMDCDS---DEQC-----CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNR 4736
            ++ H +      S N   H  +   +   +A D  SD L  +D    II  +RL+     +    V+++   S  R + I IA   S L W S +    E N+        IE S LDG+ R  LV KN    + LT+D+ +  +YW D   N +    I W+          G + +V V     +S+  G     +     ++F+T++ +     ++V+   D++         + L   K+          T   I            S+G       C+     ++N +C        P +   E  F  + +++   K                   G C   +  KC   +  C               +C+ ++  CD   DC DG+DE+    C  + +  CS S        C+  +KRC+GV +CD+   +E C     C   +F C +G     C+  S  C+G + C DG DE  CN   +
Sbjct:  647 LRRHSLVVQKIGSTNYTVHGLTGIMNCEGMAYDFTSDNLYMTDQRRKIITVQRLS----NLSIQKVVVSGNMSNPRAIAIHIA--KSYLFWGSWN----EDNNDDEKIPAMIERSKLDGSERKTLVSKNAMWINGLTLDLKNDYLYWCDAYRNVIE--RIRWN----------GADREVVVHGADKISHPYG-----LAFFDNHIFYTEFKKGAVKRVNVDFPDDVQEVFQYSATVFELLVFKNSNPETTSPCSTSSNICEHFCFASSCKGSVGCEPVKCGCADGMKVLKNGKCVKDEEWVDPNACDNEIEFTCLNSKKCVPKSNLCDGDDDCGDGSDEDANGIC---KDYKCVGNKFQCDG------------TTCLPMEFICDGKSDCYDGTDELE-KICKKAPIVKCSVSQFQCSKTKCIIKSKRCNGVQECDNGADEEDCPRSKLCDPDEFRCGTG----LCIKQSQVCDGKMQCLDGLDEEHCNEEEK 1092          

HSP 4 Score: 71.2478 bits (173), Expect = 1.128e-11
Identity = 102/457 (22.32%), Postives = 171/457 (37.42%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI--PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTL-LQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDE----------VGCNTCNISHLYSCSR-----SDVCLPITKRCDGVMDCDS--DEQCCGSQKFECLSGK----DVTRCLPISARCNGIVDCRDGSDEHGC 4721
             +A+D +   + ++D     IA   +    +RI   G  +N       P  I + P+ + + W   D+  S            I   ++DG+   V++++  I  P+ L VD  + R+Y+ D           H D       ++   N   +   ++  G      ++ V + Y++W+DW       +   +       +     + QY     K V   +           S+G+L    HPCS+ +      RC +LC+   P +  +    L T+      F C C  +     + R  +  C  +  V    Y+                   C+S   RCD   DC DG DE            C    I+  + C R     +  CL  +K CDGV DC    DE+    + FEC   +    D  +C+P+++ C+   DC DGSDE  C
Sbjct: 3243 GIAVDWLGRNIYYTDRNHDAIAVCDMRGRFNRILLKGTPLN------DPRAIVLDPLQALVFW--TDWGASAH----------IGRMNMDGSNEQVILQDRTIRWPNALAVDAPAQRLYFGDA----------HRD-------YIASCNYDGSKRRMVLRGSVRHIFALAVFEDYVYWSDWHNHTIERVHKITGTNRKVLI----QDKQYRPMGFKIVHPSL----------QSMGSLKTARHPCSQPA------RCDNLCI---PANTPD----LTTSSD---NFTCMC--AQGFRSEGRSCVSECKPNDFVCTKTYK-------------------CISSWWRCDGQDDCGDGEDEGYFVEGVCPPFPC----IAGQFVCGRTAQNATAQCLYASKLCDGVKDCSGGDDEEPAFCENFECTEAQFKCGDKKKCIPLTSVCDKEKDCDDGSDELNC 3609          

HSP 5 Score: 67.0106 bits (162), Expect = 1.891e-10
Identity = 42/119 (35.29%), Postives = 59/119 (49.58%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGC--------------NTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQK-----FECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C+    +CD T DC DGSDE  C               +C+    ++C  +  C+P   +CDG  DC   SDE+ C ++K     F C S K   +C+P+  +C+G  DC DG DEH C
Sbjct: 2776 CIHPSWKCDGTNDCYDGSDEKDCFVEFDATGGSVSAPRSCDAKTQFACLATRTCMPKHWQCDGQPDCADGSDEKNCDAKKCTSFEFSCESSK---KCIPLEQKCDGRRDCPDGEDEHQC 2891          

HSP 6 Score: 66.6254 bits (161), Expect = 2.474e-10
Identity = 48/138 (34.78%), Postives = 65/138 (47.10%), Query Frame = 3
Query: 4353 KCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCN-TCNISHLYSCSRSDV---CLPITKRCDGVMDC----DSDEQC-----CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNR 4727
            +C   Q  CG      KK+      C+ +   CD   DC DGSDE+ C  T      ++C        C+P    CDG  DC    D  + C     C  ++F+C SGK    C+P   +C+G +DCRDGSDE GC +
Sbjct: 3573 ECTEAQFKCG-----DKKK------CIPLTSVCDKEKDCDDGSDELNCEITSCKPDFFACFNGTAISKCIPKEFYCDGEDDCPEGQDEPDSCFGIGECTHEQFQCTSGK----CIPKRRQCDGTLDCRDGSDEKGCKK 3695          

HSP 7 Score: 59.6918 bits (143), Expect = 2.833e-8
Identity = 52/147 (35.37%), Postives = 63/147 (42.86%), Query Frame = 3
Query: 4332 CVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNT---CNISHLYSCSRS-DVCLPITKRCDGVMDC-----DSDEQC-------CGS-QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C +S+L  CD  +  CG GL            C+   Q CD  + CLDG DE  CN    C     + C+     CL +  RCDGV DC     +SDE C       CG   +F C  GK    CL     C+G  DC  G DE  C
Sbjct: 1047 CPRSKL--CDPDEFRCGTGL------------CIKQSQVCDGKMQCLDGLDEEHCNEEEKCLQGRQFRCANGKSTCLDLIFRCDGVADCEDSSDESDEFCKGNSSSTCGKMNQFMCADGK----CLRSFQLCDGFPDCLTGEDETEC 1175          

HSP 8 Score: 58.9214 bits (141), Expect = 5.227e-8
Identity = 40/124 (32.26%), Postives = 60/124 (48.39%), Query Frame = 3
Query: 4416 SVMSCMSVQQRCDSTVDCLDGSDEVGCNT-CNI---SHLYSCSRSDVCLPITKRCDGVMDCDSDEQCCGSQKFECLSGKD-------------VTRCLPISARCNGIVDCRDGSDEHGCNRNNR 4736
            S   C+ ++Q+CD   DC DG DE  C T C+    +  + C+ +  C+P+  RCDG  DC  + +  GS + +C +G+              V  C   +  C+GI DC DG DE  C   +R
Sbjct: 2865 SSKKCIPLEQKCDGRRDCPDGEDEHQCETECDSKGGNATFRCT-NHRCIPMAWRCDGTDDCMDNAKSLGSDEVDCAAGRTSFHVPSRCADETCVVACELTAVLCDGIQDCSDGFDEKNCASLDR 2987          

HSP 9 Score: 58.9214 bits (141), Expect = 5.271e-8
Identity = 65/253 (25.69%), Postives = 121/253 (47.83%), Query Frame = 3
Query:  252 LDRRKM---RDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQ-IGAIMVLERSRLDGSDRRVIHK-SILFKS---SQLAIDRHRKMLFWWGLDGE-IHRVDYQGQTGCSMRVQGTWKQWSPTF-LTFTEGKLVFINDEQLWVSSFE--CGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCS 974
            +D+R +   R ++ + V +AE +AVDW+SGN+YW D     I+VV  +          +R  ++++NM +  SL +D  E ++FW     +   +ER+ L G++R +I K S + ++   + +A+D   K ++W     + IH + Y G+    + V    ++    F +   EG + F +     +S  +   G+ +SI  +       + I+ R  Q M    + K+ C    C+ ICL    +   C C+
Sbjct: 1412 VDQRTILYQRTIVSYGVFNAEGIAVDWISGNIYWIDSFLDTIQVVSED--------GTKRATVINQNMGNARSLAIDVEEGFMFWTDWEESNPRIERASLAGNNRAIIWKISNIAQAGWPNGIALDTIAKRVYWADAKSDSIHTITYDGRD--HVIVFRDPERLGHCFGIDVYEGHVYFSDWRTNTISKVDKWFGSNVSIIERVATQPFSLKIVHRSKQKM----QIKNSCDGFKCNGICLNNGKNKATCQCT 1650          

HSP 10 Score: 58.9214 bits (141), Expect = 5.406e-8
Identity = 42/103 (40.78%), Postives = 55/103 (53.40%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCN-TCNISHLYSCSRSDVCLPITKRCDGVMDC----DSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C+  +++CD T+DC DGSDE GC   C I    SC  +D        CDG   C    D DE+ C  ++   L  K+  +C   +  C+GIVDC DGSDE GC
Sbjct: 3671 CIPKRRQCDGTLDCRDGSDEKGCKKECAIVCDNSCVHAD------DLCDGKKKCNDGSDEDEEACVIKQ---LLEKENRKCGGFA--CDGIVDCEDGSDEKGC 3762          

HSP 11 Score: 56.225 bits (134), Expect = 3.175e-7
Identity = 39/128 (30.47%), Postives = 60/128 (46.88%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCLDGSDEVGC--------NTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ------------------CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCN 4724
            +C+  + RC+   DC D SDE+GC        N   ++ L +C+ +  C+  + +CDG  DC   SDE+                  C    +F CL+ +    C+P   +C+G  DC DGSDE  C+
Sbjct: 2728 ACIPSKARCNHMQDCNDASDEIGCPFRNCSALNEFGMTGLINCATTSQCIHPSWKCDGTNDCYDGSDEKDCFVEFDATGGSVSAPRSCDAKTQFACLATR---TCMPKHWQCDGQPDCADGSDEKNCD 2852          

HSP 12 Score: 55.0694 bits (131), Expect = 7.989e-7
Identity = 38/133 (28.57%), Postives = 67/133 (50.38%), Query Frame = 3
Query:  270 RDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFK-SSQLAIDRHRKMLFWWGLDGEIHRVDY 665
            R +   P +  + +AVDW+  N+Y+ D+ +  I V D+         R  R +L    + D  ++V+DP +  +FW   GA   + R  +DGS+ +VI +    +  + LA+D   + L++    G+ HR DY
Sbjct: 3231 RVINSLPTKGIDGIAVDWLGRNIYYTDRNHDAIAVCDMR-------GRFNRILLKGTPLNDPRAIVLDPLQALVFWTDWGASAHIGRMNMDGSNEQVILQDRTIRWPNALAVDAPAQRLYF----GDAHR-DY 3351          

HSP 13 Score: 53.5286 bits (127), Expect = 2.097e-6
Identity = 129/607 (21.25%), Postives = 237/607 (39.04%), Query Frame = 3
Query:  762 NDEQLWVSSFECGT----GISIALKTNPNIAPIAIISRKHQLMVP--RGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFI--GNPPKIYHM-SLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTP-QRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGD---LAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTN---DFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRIL---AQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSC---------GCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIEL---GKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKF----LFWFETKT 2474
            +DE LW + F C      G S   +  P + PI      H L        +K PC    CS  C P   S++ C C        + + C +   R  F+   N  +I  + S   G  P +  L     + F++ + + + S+ + D ++  I++  +++     QR  + + + +     IAVD  S NIYW++   S +   ++ S +  K AT++                NQ  G+   LA+D    ++F T   +    IER  L G  +  +   +N     WP G+ALD   +++Y+ D     + ++ Y G    I+    ++      +  ++  +Y+++  T +I  V K+ GS  S++ +          V    +   I      +    KC+ +C     N+ +  C         GC +   VLL  ++       +  F+      H     + KQY  +   G   + +QV    LD Y   I  +N     +  TA +  +     ++      +S +AVD +  + Y +++      + +I      +D     V+  +   N +     +  D+ F    LFWFE  T
Sbjct: 1259 DDEGLWCT-FNCTDADDLGCSHTCRPTP-VGPICSCPDDHYLDKNGVTCSKKDPCRFGQCSQYCSPH-GSSHFCYCEDSFKLGADRSSCISDDPRKPFLIYSNRHEIRMIQSKYPGSLPMITNLVNAIALDFKY-HQNGSVSIYWTDLSADKIYTGLVDQRTILYQRTIVSYGVFN--AEGIAVDWISGNIYWID---SFLDTIQVVSEDGTKRATVI----------------NQNMGNARSLAIDVEEGFMFWTDWEESNPRIERASLAGNNRAIIWKISNIAQAGWPNGIALDTIAKRVYWADAKSDSIHTITYDGRDHVIVFRDPERLGHCFGIDVYEGHVYFSDWRTNTISKVDKWFGSNVSIIERVATQPFSLKIVHRSKQKMQIKNSCDGF----KCNGICLNNGKNKATCQCTNLQSTTDDGCVDIQQVLLVATK-----NGVRGFSTDPPHPHAFPLVSGKQYENIRAVGSFNNRLQV----LDDYTTHIATVN-----LTGTADDGVLATGSDLY-----GVSGMAVDPVVGSTYITLSIDGVGSVEVIS-----ADGKSRRVLAESSSSNPM----KLPRDILFMNTKLFWFEDST 1808          

HSP 14 Score: 52.373 bits (124), Expect = 5.365e-6
Identity = 37/97 (38.14%), Postives = 49/97 (50.52%), Query Frame = 3
Query: 4449 CDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC----DSDEQCCGSQKFECLS---GKDVTRCLPIS-ARCNGIVDCRDGSDEH 4715
            CD T+DC  G DE  C+    S+ + CS   +     + CDG  DC    D   + C S+K  C       D  +CL +S A C+GI DC DGSDE+
Sbjct: 3777 CDGTIDCSSGKDENNCHNNGESNFFQCSMQTI--KEWQVCDGRWDCADGLDESPEMCASRKARCFRIGYCDDKKQCLDVSTALCDGIRDCFDGSDEN 3871          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Celegans
Match: nid-1 (NIDogen (Basement membrane protein) [Source:UniProtKB/TrEMBL;Acc:C7FZU3])

HSP 1 Score: 76.6406 bits (187), Expect = 1.791e-13
Identity = 87/357 (24.37%), Postives = 147/357 (41.18%), Query Frame = 3
Query:  957 YRCSCSTGITEP-INNAVCPTFP---------TRS--LFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQN-QPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSY-FDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHV 1985
            Y+C+C    TEP + N V  T P         TRS  L +     I+  S +   +   +L+     IP    +D     +++ D +  SI +  LN  GT  + Y +  +SS  P  IAVD +SRN+Y+ +  N E+ VA ++                   FK+S   +    P  + +D   R+L+ +        I R  +DG     V  + +   P GL +   R++L +VD     +  + Y+G  +R +    Q    L++  +   YWT+ +   IHSV   G        +     +   ++AV + + +   +PC   +  C  LC P    Q+   C C +   V
Sbjct:  920 YQCAC----TEPYVGNGVECTLPGSSASAESSTRSDKLLVARGMAIFERSTNPD-EYGKQLIVIPHHIPVGIDFDCKEEKIVWSDMSGHSIRTSSLN--GTEHKSYFNKELSS--PEGIAVDWSSRNVYYADSMNDEIGVASLNG-----------------KFKKSLVTEGLVNPRSVVLDLYGRHLYYSDWHRENPYIGRVDMDGKNN-RVFLNEDVHLPNGLTILPNRRELCWVDAGNHRLSCIQYNGAGRRTVFSSLQYPFGLTHDEEQKFYWTDWKDNRIHSVGVYGEGYRSFQISLGGSGKVFGILAVPK-SCVGPSTPCSEDNGGCQHLCLP---GQNGAVCECPDNVKV 1245          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Celegans
Match: lrx-1 (LRP X(Cross)-hybridizing [Source:UniProtKB/TrEMBL;Acc:Q22179])

HSP 1 Score: 73.1738 bits (178), Expect = 5.091e-13
Identity = 42/121 (34.71%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 4422 MSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMD------------CDSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRAL 4748
             SC+ V +RCD   DC DG DE  C +C     ++C +S+ C+P  KRCDGV D            C  +  C G  KF C + +    C+ +   C+G  DC +G DE  C +  R + L
Sbjct:  220 QSCIHVSKRCDGHPDCADGEDENNCPSCARDE-FACVKSEHCIPANKRCDGVADDCEDGSNLDEIGCSKNTTCIG--KFVCGTSRGGVSCVDLDMHCDGKKDCLNGEDEMNCKQEGRQKYL 337          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Celegans
Match: nid-1 (NIDogen (Basement membrane protein) [Source:UniProtKB/TrEMBL;Acc:C7FZU3])

HSP 1 Score: 75.0998 bits (183), Expect = 5.798e-13
Identity = 70/290 (24.14%), Postives = 121/290 (41.72%), Query Frame = 3
Query: 1122 IPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQN-QPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSY-FDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHV 1985
            IP    +D     +++ D +  SI +  LN  GT  + Y +  +SS  P  IAVD +SRN+Y+ +  N E+ VA ++                   FK+S   +    P  + +D   R+L+ +        I R  +DG     V  + +   P GL +   R++L +VD     +  + Y+G  +R +    Q    L++  +   YWT+ +   IHSV   G        +     +   ++AV + + +   +PC   +  C  LC P    Q+   C C +   V
Sbjct: 1261 IPVGIDFDCKEEKIVWSDMSGHSIRTSSLN--GTEHKSYFNKELSS--PEGIAVDWSSRNVYYADSMNDEIGVASLNG-----------------KFKKSLVTEGLVNPRSVVLDLYGRHLYYSDWHRENPYIGRVDMDGKNN-RVFLNEDVHLPNGLTILPNRRELCWVDAGNHRLSCIQYNGAGRRTVFSSLQYPFGLTHDEEQKFYWTDWKDNRIHSVGVYGEGYRSFQISLGGSGKVFGILAVPK-SCVGPSTPCSEDNGGCQHLCLP---GQNGAVCECPDNVKV 1524          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Fly
Match: arr (gene:FBgn0000119 transcript:FBtr0087702)

HSP 1 Score: 207.994 bits (528), Expect = 2.491e-53
Identity = 332/1564 (21.23%), Postives = 589/1564 (37.66%), Query Frame = 3
Query:  126 VDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTAN-----FSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGS--DRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDS-AYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTD-IQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKS-SDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVESRE---CGCGSVYSLSADGATCVDLSDLLM---------VMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMS--CMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC----DSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            +D+      + +A D + ++ L  +   ++G+ +++ A         L R   + V+   +   E +A+DW +  +YW D +   IEV  L+           +++L   ++    ++ V P  + L W   G    +ER+ +DG    R  + K  +F  + LA+D   ++++W   DG+ H +D     G S R      ++ P  LTF + +L + + ++  +++ +  T     L   P  AP ++ +    L   +    +PC   N  CS +CL   +S  + C+C TG+ + I+   C       +FI    +I  +SLD        L            YD V   + + D  + +I     +  G       DF ++S++  P  +A+D  +RN+YW +     + V R+    R                K   Y+  + P  +AV     ++F +   +    +ER  LDG+++  ++S  N  WP G+ALD   + +Y+ D  K D I V    GS R  +++   +    LS  D+++YWT+ +  SI    K  G+ R +V          +  + V+R   +   + C   +  C  LC         + C C+    +  +   C   +  +++  +  +    +  N      E    +      +L +     +IYW +Q + CI +   N   +QR +    +  D I   AVD++ NN+Y       WS     R+     D S   V++   ++     ++ +     +++W E+ T        + +A +DGS    I  G      L  D++   + W + S   KI   +   +K      S                  P + SLY    D +Y    +        K      ++ HS    G ++++  +  + K+            V  C  +N      CS  CL    R    C C + Y L+ DG +C+   + ++         ++ NT +   I   +  +    +D+         PI         +YW+                                  + H IK   S +        +     + LAID I   L W+        +  +N      E +GVI        +P  IA+  +   L W                HQ  I  + +DGN R  L       + L +D  S  IY+   K              +I A  + G N K  V   +S  +     ++  L  +++W D  +     I+VN + + +         LQ    +L  +  I A   P+         +L+NH C  +       +CSH+C++          S    A+  D    CSCP  + +     +   F        C      C A +      G+S ++  C+    RCD   DC D SDEVGC TC     +SC +S  C+  +  CDG  +C    D  + C    +F+C   K    C+  +  C+G  +C DG+DE
Sbjct:  111 IDVIVRDLAEAMAIDFYYAKNLVCWT--DSGREIIECAQTNSSALQPLLRAPKQTVISTGLDKPEGLAMDWYTDKIYWTDGEKNRIEVATLD--------GRYQKVLFWTDLDQPRAVAVVPARKLLIWTDWGEYPKIERASMDGDPLSRMTLVKEHVFWPNGLAVDLKNELIYW--TDGKHHFIDVMRLDGSSRRTIVNNLKY-PFSLTFYDDRLYWTDWQRGSLNALDLQTRELKELIDTPK-APNSVRAWDPSL---QPYEDNPCAHNNGNCSHLCLLATNSQGFSCACPTGV-KLISANTCANGSQEMMFIVQRTQISKISLDSPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDVETYTIKRAHADGTGV-----TDF-VTSEVRHPDGLALDWLARNLYWTDTVTDRIEVCRLDGTAR----------------KVLIYEHLEEPRAIAVAPSLGWMFWSDWNERKPKVERASLDGSERVVLVSE-NLGWPNGIALDIEAKAIYWCDG-KTDKIEVANMDGSGRRVVISDNLKHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYP----DLMGLKVTRLREVRGQNACAVRNGGCSHLCL---NRPRDYVCRCAIDYELANDKRTCVVPAAFLLFSRQEHIGRISIEYNEGNHNDERIPFKDVRDAHALDVSVAERRIYWTDQKSKCIFRAFLNGSYVQRIVDSGLIGPDGI---AVDWLANNIY-------WSDAEARRIEVARLDGSSRRVLLWKGVEEP--RSLVLEPRRGYMYWTESPTD------SIRRAAMDGSDLQTIVAGANHAAGLTFDQETRRLYWATQSRPAKIESADWDGKKRQILVGSDMDE--------------PYAVSLY---QDYVYWSDWNTGDIERVHKTTGQNRSLVHS----GMTYITSLLVFNDKR---------QTGVNPCKVNNG----GCSHLCLAQPGRRGMTCACPTHYQLAKDGVSCIPPRNYIIFSQRNCFGRLLPNTTDCPNIPLPVSGKNIRAVDY--------DPIT------HHIYWIEG--------------------------------RSHSIK--RSLANGTKVSLLANSGQPFDLAIDIIGRLLFWT-----CSQSNSINVTSFLGESVGVIDT--GDSEKPRNIAVHAMKRLLFWTDVGS-----------HQAIIR-ARVDGNERVELAYKLEGVTALALDQQSDMIYYAHGK--------------RIDAIDINGKNKKTLVSMHISQVI-----NIAALGGFVYWLD-DKTGVERITVNGERRSA--------ELQ----RLPQITDIRAVWTPDP-------KVLRNHTCMHS-----RTKCSHICIA----------SGEGIARTRD---VCSCPKHLMLLEDKENCGAF------PACGPDHFTCAAPV-----SGISDVNKDCIPASWRCDGQKDCPDKSDEVGCPTCRADQ-FSC-QSGECIDKSLVCDGTTNCANGHDEADCCKRPGEFQCPINK---LCISAALLCDGWENCADGADE 1433          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Fly
Match: Lrp4 (gene:FBgn0030706 transcript:FBtr0074125)

HSP 1 Score: 135.576 bits (340), Expect = 3.637e-31
Identity = 168/763 (22.02%), Postives = 311/763 (40.76%), Query Frame = 3
Query:  264 KMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVP----RGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPP--LELLSENAGIPFRFAYD--SVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ 2528
            ++RDV+K+ ++S   +AVDW+   L+W D   + +EV +   +         R ++ S ++    ++VV P E   FW   G    +ER+ +DG+ R+VI    +   + LAID     ++W   D + H ++     G       +     P  LT  E  + + +     VS+ +  TG       + N      I   H    P    R ++    +   CS +CLP   ++ RC C  G++   +   C +   + + +     I    L      P  ++++     +    A D  S T  + + D   S+I    LN  G+ Q+  +   + S  PV +A+D  +  +YW +   + + VA  +     K  TLL+            +++   P D+ V+ I  ++F +   D    IER  +DG ++ T I+S    +P GLA+D  + ++YFVD     + ++N+ G  ++++         L   +  ++WT+ +T S+ S        + V    + D   + V   +R    +    C   +  C  LC     N  S++C C+    +  +   CS      + F   + I   ++ + D     +          +L +D     IYW +   N IM  +S+ D     KI   S +    L VD I   +Y       W+      +     D S  +V+    +++    A+   + L  LFW      D  +  ++ ++HLDG++
Sbjct:  672 RVRDVIKWGLESPGGIAVDWIHDLLFWTDSGTRRVEVSNFQGN--------LRTVIASYDLDKPRAIVVHPGEALAFWSDWGPNPKIERAYMDGTQRKVIISKGVTWPNGLAIDFPNSKIYW--ADAKQHAIECSNLDGSDRNKILSTHLPHPFALTLFEDTMYWTDWNTKTVSAADKITGKEFR-AVHENFHFPMDIHAYHPARQPEYADRCQKDRRGLRGGCSHLCLP-NKTSRRCGCPIGLSLKEDGKTCKSTADKLVLVARRKDIRLRHLRDNQADPNDVDMIVPLDNLKHAVALDWCSDTDFIYWTDVERSTINKAHLN--GSYQQRVVHSNLVS--PVGLALDWITDKLYWTDPSTNRIEVATTNG----KMRTLLI------------WEKLYKPRDIVVNPIEGFMFWSDWGDDP-MIERANMDGHERVT-ITSKKLIYPNGLAIDYEKSKIYFVDGGTKTLENMNFDGSGRQVILNGLGHPFGLDVNEGRVFWTDWDTKSVMSANKLTGKDTNVIIANSTDLMDIRVFHRTRRRIFNA---CDKLNGGCSHLCLL---NPTSYTCACTVGVQLKEDRHTCSEGPTQYILFAHRIDI-RQISLDFDHLIDVVLPLPPISNAVALDVDRKTGYIYWSDTIENVIM--SSSPDGLHVQKIVGDSLENPDGLVVDSIGRTIY-------WADAGRHTIEVASLDGSNRHVIAYKDLESPRGLALDYEAGL--LFW-----TDWGHYRKIERSHLDGNE 1377          

HSP 2 Score: 130.568 bits (327), Expect = 1.201e-29
Identity = 183/813 (22.51%), Postives = 339/813 (41.70%), Query Frame = 3
Query:  234 TANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQ------WSPTFLTFTEGKLVFINDEQLWVSSFECGTG--ISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPC--MNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGG----LQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDG--SMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLN-ISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSS 2612
            T N + L+    + V+   + S   +A+DW++  LYW D     IEV   N         + R +L+   +     +VV+P E ++FW   G   ++ER+ +DG +R  I    L   + LAID  +  +++         VD   +T  +M   G+ +Q        P  L   EG++ + + +   V S    TG   ++ +  + ++  I +  R       R R  + C  +N  CS +CL +  ++Y C+C+ G+    +   C   PT+ +   +   I  +SLD      +  PL  +S    +      D  T  + + D   + I S       +P   ++   +   +  P  + VDS  R IYW +     + VA +   NR   A                Y+  + P  LA+D     LF T        IER  LDG ++  ++++ N  WP GL+LD   +++Y+VD     + S +Y G  ++++        +L+  D+ IYWT+ ++ ++H  +     + R ++T    L    + +I  ++N S    + C + +  C  LC     N   +SC C     +  N  ++C    E   Y   ++     +       ++++    + V  A +   HYR  + +       +++  +  ++     I      T + +AVD+I +NLY S T      I + RL     D S    +V   + +    ++ VH    +LFW      D  + A++ +++LDGS + ++I  G+     L +D     + W  +
Sbjct:  976 TINKAHLNGSYQQRVVHSNLVSPVGLALDWITDKLYWTDPSTNRIEVATTN--------GKMRTLLIWEKLYKPRDIVVNPIEGFMFWSDWGDDPMIERANMDGHERVTITSKKLIYPNGLAIDYEKSKIYF---------VDGGTKTLENMNFDGSGRQVILNGLGHPFGLDVNEGRVFWTDWDTKSVMSANKLTGKDTNVIIANSTDLMDIRVFHRT------RRRIFNACDKLNGGCSHLCL-LNPTSYTCACTVGVQLKEDRHTCSEGPTQYILFAHRIDIRQISLDFDHLIDVVLPLPPISNAVALDV----DRKTGYIYWSDTIENVIMS------SSPDGLHVQKIVGDSLENPDGLVVDSIGRTIYWADAGRHTIEVASLDGSNRHVIA----------------YKDLESPRGLALDYEAGLLFWTDWGHYR-KIERSHLDGNERSRIVTA-NLGWPNGLSLDLKSKRIYWVDARLKTIDSCDYTGNQRKLIMSSLHHPYALALSDDNIYWTDWKSKALHMTERRNISAKRDIITNIDGL--MDIKIIYQNQNQST-MKNACGNNNGNCSHLCLR---NPSGYSCQCPIGLRLRQNSTTQCQNLPED--YLLIALRSGIGMISLNSGDFMDVVLPINGVHGAVVLDYHYRKNLLFFADVNLDVIRRVNLLNLTESKVIVGTDVLTPNGIAVDWIADNLYWSDTDR--KLIEVSRL-----DGSCRKRIVEDNLGDP--RSLIVHPKKAYLFW-----SDWSSPAKIERSYLDGSNRTVIITSGIGFPTGLTIDFTNRRLLWADA 1714          

HSP 3 Score: 90.5077 bits (223), Expect = 1.628e-17
Identity = 124/583 (21.27%), Postives = 230/583 (39.45%), Query Frame = 3
Query:  246 SKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGT----------------WKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAV-CPTFPTRSLFIGNPPKIYHMSLDGG--LQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIH-SVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCF 1928
            S  D   ++ ++   +++ + + VD +   +YWAD     IEV  L+           R ++  +++     L +D     LFW   G    +ERS LDG++R  I  + L   + L++D   K ++W  +D  +  +D    TG   ++  +                W  W    L  TE +   I+ ++  +++ +    I I  + N N + +      +                  S +CL    S Y C C  G+    N+   C   P   L I     I  +SL+ G  +   L +   +  +   + Y    + L + D N   I  ++L      +       + +D+  P  IAVD  + N+YW +     + V+R+    R +     L                  P  L V     YLF +  +     IER +LDG+ +  +I+S   F P GL +D   ++L + D ++ ++  V+++G  ++ +         L+ F+N I+WT+    S++ S K   S      + R+  +  + + AVS +    + + C   +  C  LC 
Sbjct: 1284 SSPDGLHVQKIVGDSLENPDGLVVDSIGRTIYWADAGRHTIEVASLD--------GSNRHVIAYKDLESPRGLALDYEAGLLFWTDWGHYRKIERSHLDGNERSRIVTANLGWPNGLSLDLKSKRIYW--VDARLKTIDSCDYTGNQRKLIMSSLHHPYALALSDDNIYWTDWKSKALHMTERR--NISAKRDIITNIDGLMDIKIIYQ-NQNQSTMKNACGNNNGNC--------------SHLCLR-NPSGYSCQCPIGLRLRQNSTTQCQNLPEDYLLIALRSGIGMISLNSGDFMDVVLPINGVHGAVVLDYHYRK--NLLFFADVNLDVIRRVNLLNLTESKVI-----VGTDVLTPNGIAVDWIADNLYWSDTDRKLIEVSRLDGSCRKRIVEDNLG----------------DPRSLIVHPKKAYLFWSDWS-SPAKIERSYLDGSNRTVIITSGIGF-PTGLTIDFTNRRLLWADALEDNIGQVDFNGKRRQTIVPYAPHPFGLTLFENSIFWTDWYNKSVYRSQKLARSGYGNPFEVRDALSGALDIRAVSLSRQPKSVNHCAQDNGGCTHLCL 1813          

HSP 4 Score: 74.7146 bits (182), Expect = 9.332e-13
Identity = 53/165 (32.12%), Postives = 83/165 (50.30%), Query Frame = 3
Query:  183 RKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWW-GLDGEIHRVDYQGQ 674
            RK  +F    N   +++  N   L   K+  ++   V +   +AVDW++ NLYW+D   + IEV  L+           R+ ++  N+ D  SL+V P + YLFW    +   +ERS LDGS+R VI  S +   + L ID   + L W   L+  I +VD+ G+
Sbjct: 1574 RKNLLFFADVN-LDVIRRVNLLNLTESKV--IVGTDVLTPNGIAVDWIADNLYWSDTDRKLIEVSRLD--------GSCRKRIVEDNLGDPRSLIVHPKKAYLFWSDWSSPAKIERSYLDGSNRTVIITSGIGFPTGLTIDFTNRRLLWADALEDNIGQVDFNGK 1727          

HSP 5 Score: 67.3958 bits (163), Expect = 1.580e-10
Identity = 144/694 (20.75%), Postives = 259/694 (37.32%), Query Frame = 3
Query: 1893 YSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVE-SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVD--RTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDW 3959
            Y TS  C Q C    G   SF C C     +  ++  C      +     +      +T + ++ Y  + KG  +    +L   H +  ++W + + + I     N    R +  + L S     +AVD+I + L+       W+     R+  ++   +   V+ S  +      A+ VH      FW      D     ++ +A++DG+Q  ++I +GV   + L +D   + + W  +   K +  E  N   S+             +     H+ P+  +L LF  D++Y    +  + S   K    I+     A    F F     A    +          E    C          CS  CLP + SR CGC    SL  DG TC   +D L+++    +I      + + +D++ D          P +              ++++ LDN     A+D      ++     ++ ++ +  +  + SY + +     S   S   LA+D I+D L W+D  T  I     N    ++  L +     E   +P  I + PI   + W       S+  D  +     IE +++DG+ R  +     I P+ L +D    +IY++D  T  L  ++      Q+                 + NG+G     + V +  +FWTDW
Sbjct:  570 YLTSPVCSQKCHNTMG---SFKCSCETGYILRPDLRSCKALGGAMTLLVANRWDIRRVTLSNNR-YSAIVKGLHNA--IALDFHHRKGLMFWSDVSTDVIKMVYMNGTRVRDVIKWGLESP--GGIAVDWIHDLLF-------WTDSGTRRVEVSNFQGNLRTVIASYDLDKP--RAIVVHPGEALAFW-----SDWGPNPKIERAYMDGTQRKVIISKGVTWPNGLAIDFPNSKIYWADA---KQHAIECSNLDGSD------------RNKILSTHL-PHPFALTLF-EDTMYWTDWNTKTVSAADK----ITGKEFRAVHENFHFPMDIHAYHPARQP--------EYADRCQKDRRGLRGGCSHLCLPNKTSRRCGCPIGLSLKEDGKTCKSTADKLVLVARRKDI-----RLRHLRDNQAD----------PNDV-------------DMIVPLDNLKHAVALDWCSDTDFIYWTDVERSTINKAHL--NGSYQQRV---VHSNLVSPVGLALDWITDKLYWTDPSTNRIEVATTNG---KMRTLLIW----EKLYKPRDIVVNPIEGFMFW-------SDWGDDPM-----IERANMDGHERVTITSKKLIYPNGLAIDYEKSKIYFVDGGTKTLENMNFDGSGRQV-----------------ILNGLGHPF-GLDVNEGRVFWTDW 1142          

HSP 6 Score: 53.1434 bits (126), Expect = 3.229e-6
Identity = 40/114 (35.09%), Postives = 51/114 (44.74%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQKFECLSGKDVTR------------CLPISARCNGIVDCRDGSDEHGC 4721
            C+     CD   DC D SDE  CN  TC   H ++C+    C+ +  RCDG  DC  +SDE  C +    C  G+   R            C+    RC+G  DC D SDE  C
Sbjct:  279 CIPRTWVCDGENDCKDFSDETHCNRTTCTDEH-FTCNDG-YCISLAFRCDGEHDCNDNSDELKCAAVINSCPEGEFKCRGGLGGAGGPSGQCILNRFRCDGDNDCGDWSDEENC 390          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Fly
Match: Lrp4 (gene:FBgn0030706 transcript:FBtr0301666)

HSP 1 Score: 135.576 bits (340), Expect = 3.698e-31
Identity = 168/763 (22.02%), Postives = 311/763 (40.76%), Query Frame = 3
Query:  264 KMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVP----RGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPP--LELLSENAGIPFRFAYD--SVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ 2528
            ++RDV+K+ ++S   +AVDW+   L+W D   + +EV +   +         R ++ S ++    ++VV P E   FW   G    +ER+ +DG+ R+VI    +   + LAID     ++W   D + H ++     G       +     P  LT  E  + + +     VS+ +  TG       + N      I   H    P    R ++    +   CS +CLP   ++ RC C  G++   +   C +   + + +     I    L      P  ++++     +    A D  S T  + + D   S+I    LN  G+ Q+  +   + S  PV +A+D  +  +YW +   + + VA  +     K  TLL+            +++   P D+ V+ I  ++F +   D    IER  +DG ++ T I+S    +P GLA+D  + ++YFVD     + ++N+ G  ++++         L   +  ++WT+ +T S+ S        + V    + D   + V   +R    +    C   +  C  LC     N  S++C C+    +  +   CS      + F   + I   ++ + D     +          +L +D     IYW +   N IM  +S+ D     KI   S +    L VD I   +Y       W+      +     D S  +V+    +++    A+   + L  LFW      D  +  ++ ++HLDG++
Sbjct:  672 RVRDVIKWGLESPGGIAVDWIHDLLFWTDSGTRRVEVSNFQGN--------LRTVIASYDLDKPRAIVVHPGEALAFWSDWGPNPKIERAYMDGTQRKVIISKGVTWPNGLAIDFPNSKIYW--ADAKQHAIECSNLDGSDRNKILSTHLPHPFALTLFEDTMYWTDWNTKTVSAADKITGKEFR-AVHENFHFPMDIHAYHPARQPEYADRCQKDRRGLRGGCSHLCLP-NKTSRRCGCPIGLSLKEDGKTCKSTADKLVLVARRKDIRLRHLRDNQADPNDVDMIVPLDNLKHAVALDWCSDTDFIYWTDVERSTINKAHLN--GSYQQRVVHSNLVS--PVGLALDWITDKLYWTDPSTNRIEVATTNG----KMRTLLI------------WEKLYKPRDIVVNPIEGFMFWSDWGDDP-MIERANMDGHERVT-ITSKKLIYPNGLAIDYEKSKIYFVDGGTKTLENMNFDGSGRQVILNGLGHPFGLDVNEGRVFWTDWDTKSVMSANKLTGKDTNVIIANSTDLMDIRVFHRTRRRIFNA---CDKLNGGCSHLCLL---NPTSYTCACTVGVQLKEDRHTCSEGPTQYILFAHRIDI-RQISLDFDHLIDVVLPLPPISNAVALDVDRKTGYIYWSDTIENVIM--SSSPDGLHVQKIVGDSLENPDGLVVDSIGRTIY-------WADAGRHTIEVASLDGSNRHVIAYKDLESPRGLALDYEAGL--LFW-----TDWGHYRKIERSHLDGNE 1377          

HSP 2 Score: 130.568 bits (327), Expect = 1.181e-29
Identity = 183/813 (22.51%), Postives = 339/813 (41.70%), Query Frame = 3
Query:  234 TANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQ------WSPTFLTFTEGKLVFINDEQLWVSSFECGTG--ISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPC--MNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGG----LQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDG--SMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLN-ISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSS 2612
            T N + L+    + V+   + S   +A+DW++  LYW D     IEV   N         + R +L+   +     +VV+P E ++FW   G   ++ER+ +DG +R  I    L   + LAID  +  +++         VD   +T  +M   G+ +Q        P  L   EG++ + + +   V S    TG   ++ +  + ++  I +  R       R R  + C  +N  CS +CL +  ++Y C+C+ G+    +   C   PT+ +   +   I  +SLD      +  PL  +S    +      D  T  + + D   + I S       +P   ++   +   +  P  + VDS  R IYW +     + VA +   NR   A                Y+  + P  LA+D     LF T        IER  LDG ++  ++++ N  WP GL+LD   +++Y+VD     + S +Y G  ++++        +L+  D+ IYWT+ ++ ++H  +     + R ++T    L    + +I  ++N S    + C + +  C  LC     N   +SC C     +  N  ++C    E   Y   ++     +       ++++    + V  A +   HYR  + +       +++  +  ++     I      T + +AVD+I +NLY S T      I + RL     D S    +V   + +    ++ VH    +LFW      D  + A++ +++LDGS + ++I  G+     L +D     + W  +
Sbjct:  976 TINKAHLNGSYQQRVVHSNLVSPVGLALDWITDKLYWTDPSTNRIEVATTN--------GKMRTLLIWEKLYKPRDIVVNPIEGFMFWSDWGDDPMIERANMDGHERVTITSKKLIYPNGLAIDYEKSKIYF---------VDGGTKTLENMNFDGSGRQVILNGLGHPFGLDVNEGRVFWTDWDTKSVMSANKLTGKDTNVIIANSTDLMDIRVFHRT------RRRIFNACDKLNGGCSHLCL-LNPTSYTCACTVGVQLKEDRHTCSEGPTQYILFAHRIDIRQISLDFDHLIDVVLPLPPISNAVALDV----DRKTGYIYWSDTIENVIMS------SSPDGLHVQKIVGDSLENPDGLVVDSIGRTIYWADAGRHTIEVASLDGSNRHVIA----------------YKDLESPRGLALDYEAGLLFWTDWGHYR-KIERSHLDGNERSRIVTA-NLGWPNGLSLDLKSKRIYWVDARLKTIDSCDYTGNQRKLIMSSLHHPYALALSDDNIYWTDWKSKALHMTERRNISAKRDIITNIDGL--MDIKIIYQNQNQST-MKNACGNNNGNCSHLCLR---NPSGYSCQCPIGLRLRQNSTTQCQNLPED--YLLIALRSGIGMISLNSGDFMDVVLPINGVHGAVVLDYHYRKNLLFFADVNLDVIRRVNLLNLTESKVIVGTDVLTPNGIAVDWIADNLYWSDTDR--KLIEVSRL-----DGSCRKRIVEDNLGDP--RSLIVHPKKAYLFW-----SDWSSPAKIERSYLDGSNRTVIITSGIGFPTGLTIDFTNRRLLWADA 1714          

HSP 3 Score: 90.5077 bits (223), Expect = 1.627e-17
Identity = 124/583 (21.27%), Postives = 230/583 (39.45%), Query Frame = 3
Query:  246 SKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGT----------------WKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAV-CPTFPTRSLFIGNPPKIYHMSLDGG--LQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIH-SVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCF 1928
            S  D   ++ ++   +++ + + VD +   +YWAD     IEV  L+           R ++  +++     L +D     LFW   G    +ERS LDG++R  I  + L   + L++D   K ++W  +D  +  +D    TG   ++  +                W  W    L  TE +   I+ ++  +++ +    I I  + N N + +      +                  S +CL    S Y C C  G+    N+   C   P   L I     I  +SL+ G  +   L +   +  +   + Y    + L + D N   I  ++L      +       + +D+  P  IAVD  + N+YW +     + V+R+    R +     L                  P  L V     YLF +  +     IER +LDG+ +  +I+S   F P GL +D   ++L + D ++ ++  V+++G  ++ +         L+ F+N I+WT+    S++ S K   S      + R+  +  + + AVS +    + + C   +  C  LC 
Sbjct: 1284 SSPDGLHVQKIVGDSLENPDGLVVDSIGRTIYWADAGRHTIEVASLD--------GSNRHVIAYKDLESPRGLALDYEAGLLFWTDWGHYRKIERSHLDGNERSRIVTANLGWPNGLSLDLKSKRIYW--VDARLKTIDSCDYTGNQRKLIMSSLHHPYALALSDDNIYWTDWKSKALHMTERR--NISAKRDIITNIDGLMDIKIIYQ-NQNQSTMKNACGNNNGNC--------------SHLCLR-NPSGYSCQCPIGLRLRQNSTTQCQNLPEDYLLIALRSGIGMISLNSGDFMDVVLPINGVHGAVVLDYHYRK--NLLFFADVNLDVIRRVNLLNLTESKVI-----VGTDVLTPNGIAVDWIADNLYWSDTDRKLIEVSRLDGSCRKRIVEDNLG----------------DPRSLIVHPKKAYLFWSDWS-SPAKIERSYLDGSNRTVIITSGIGF-PTGLTIDFTNRRLLWADALEDNIGQVDFNGKRRQTIVPYAPHPFGLTLFENSIFWTDWYNKSVYRSQKLARSGYGNPFEVRDALSGALDIRAVSLSRQPKSVNHCAQDNGGCTHLCL 1813          

HSP 4 Score: 74.7146 bits (182), Expect = 9.253e-13
Identity = 53/165 (32.12%), Postives = 83/165 (50.30%), Query Frame = 3
Query:  183 RKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWW-GLDGEIHRVDYQGQ 674
            RK  +F    N   +++  N   L   K+  ++   V +   +AVDW++ NLYW+D   + IEV  L+           R+ ++  N+ D  SL+V P + YLFW    +   +ERS LDGS+R VI  S +   + L ID   + L W   L+  I +VD+ G+
Sbjct: 1574 RKNLLFFADVN-LDVIRRVNLLNLTESKV--IVGTDVLTPNGIAVDWIADNLYWSDTDRKLIEVSRLD--------GSCRKRIVEDNLGDPRSLIVHPKKAYLFWSDWSSPAKIERSYLDGSNRTVIITSGIGFPTGLTIDFTNRRLLWADALEDNIGQVDFNGK 1727          

HSP 5 Score: 67.3958 bits (163), Expect = 1.593e-10
Identity = 144/694 (20.75%), Postives = 259/694 (37.32%), Query Frame = 3
Query: 1893 YSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVE-SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVD--RTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDW 3959
            Y TS  C Q C    G   SF C C     +  ++  C      +     +      +T + ++ Y  + KG  +    +L   H +  ++W + + + I     N    R +  + L S     +AVD+I + L+       W+     R+  ++   +   V+ S  +      A+ VH      FW      D     ++ +A++DG+Q  ++I +GV   + L +D   + + W  +   K +  E  N   S+             +     H+ P+  +L LF  D++Y    +  + S   K    I+     A    F F     A    +          E    C          CS  CLP + SR CGC    SL  DG TC   +D L+++    +I      + + +D++ D          P +              ++++ LDN     A+D      ++     ++ ++ +  +  + SY + +     S   S   LA+D I+D L W+D  T  I     N    ++  L +     E   +P  I + PI   + W       S+  D  +     IE +++DG+ R  +     I P+ L +D    +IY++D  T  L  ++      Q+                 + NG+G     + V +  +FWTDW
Sbjct:  570 YLTSPVCSQKCHNTMG---SFKCSCETGYILRPDLRSCKALGGAMTLLVANRWDIRRVTLSNNR-YSAIVKGLHNA--IALDFHHRKGLMFWSDVSTDVIKMVYMNGTRVRDVIKWGLESP--GGIAVDWIHDLLF-------WTDSGTRRVEVSNFQGNLRTVIASYDLDKP--RAIVVHPGEALAFW-----SDWGPNPKIERAYMDGTQRKVIISKGVTWPNGLAIDFPNSKIYWADA---KQHAIECSNLDGSD------------RNKILSTHL-PHPFALTLF-EDTMYWTDWNTKTVSAADK----ITGKEFRAVHENFHFPMDIHAYHPARQP--------EYADRCQKDRRGLRGGCSHLCLPNKTSRRCGCPIGLSLKEDGKTCKSTADKLVLVARRKDI-----RLRHLRDNQAD----------PNDV-------------DMIVPLDNLKHAVALDWCSDTDFIYWTDVERSTINKAHL--NGSYQQRV---VHSNLVSPVGLALDWITDKLYWTDPSTNRIEVATTNG---KMRTLLIW----EKLYKPRDIVVNPIEGFMFW-------SDWGDDPM-----IERANMDGHERVTITSKKLIYPNGLAIDYEKSKIYFVDGGTKTLENMNFDGSGRQV-----------------ILNGLGHPF-GLDVNEGRVFWTDW 1142          

HSP 6 Score: 53.1434 bits (126), Expect = 3.175e-6
Identity = 40/114 (35.09%), Postives = 51/114 (44.74%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQKFECLSGKDVTR------------CLPISARCNGIVDCRDGSDEHGC 4721
            C+     CD   DC D SDE  CN  TC   H ++C+    C+ +  RCDG  DC  +SDE  C +    C  G+   R            C+    RC+G  DC D SDE  C
Sbjct:  279 CIPRTWVCDGENDCKDFSDETHCNRTTCTDEH-FTCNDG-YCISLAFRCDGEHDCNDNSDELKCAAVINSCPEGEFKCRGGLGGAGGPSGQCILNRFRCDGDNDCGDWSDEENC 390          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Fly
Match: Lrp4 (gene:FBgn0030706 transcript:FBtr0340309)

HSP 1 Score: 135.576 bits (340), Expect = 3.698e-31
Identity = 168/763 (22.02%), Postives = 311/763 (40.76%), Query Frame = 3
Query:  264 KMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVP----RGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPP--LELLSENAGIPFRFAYD--SVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ 2528
            ++RDV+K+ ++S   +AVDW+   L+W D   + +EV +   +         R ++ S ++    ++VV P E   FW   G    +ER+ +DG+ R+VI    +   + LAID     ++W   D + H ++     G       +     P  LT  E  + + +     VS+ +  TG       + N      I   H    P    R ++    +   CS +CLP   ++ RC C  G++   +   C +   + + +     I    L      P  ++++     +    A D  S T  + + D   S+I    LN  G+ Q+  +   + S  PV +A+D  +  +YW +   + + VA  +     K  TLL+            +++   P D+ V+ I  ++F +   D    IER  +DG ++ T I+S    +P GLA+D  + ++YFVD     + ++N+ G  ++++         L   +  ++WT+ +T S+ S        + V    + D   + V   +R    +    C   +  C  LC     N  S++C C+    +  +   CS      + F   + I   ++ + D     +          +L +D     IYW +   N IM  +S+ D     KI   S +    L VD I   +Y       W+      +     D S  +V+    +++    A+   + L  LFW      D  +  ++ ++HLDG++
Sbjct:  672 RVRDVIKWGLESPGGIAVDWIHDLLFWTDSGTRRVEVSNFQGN--------LRTVIASYDLDKPRAIVVHPGEALAFWSDWGPNPKIERAYMDGTQRKVIISKGVTWPNGLAIDFPNSKIYW--ADAKQHAIECSNLDGSDRNKILSTHLPHPFALTLFEDTMYWTDWNTKTVSAADKITGKEFR-AVHENFHFPMDIHAYHPARQPEYADRCQKDRRGLRGGCSHLCLP-NKTSRRCGCPIGLSLKEDGKTCKSTADKLVLVARRKDIRLRHLRDNQADPNDVDMIVPLDNLKHAVALDWCSDTDFIYWTDVERSTINKAHLN--GSYQQRVVHSNLVS--PVGLALDWITDKLYWTDPSTNRIEVATTNG----KMRTLLI------------WEKLYKPRDIVVNPIEGFMFWSDWGDDP-MIERANMDGHERVT-ITSKKLIYPNGLAIDYEKSKIYFVDGGTKTLENMNFDGSGRQVILNGLGHPFGLDVNEGRVFWTDWDTKSVMSANKLTGKDTNVIIANSTDLMDIRVFHRTRRRIFNA---CDKLNGGCSHLCLL---NPTSYTCACTVGVQLKEDRHTCSEGPTQYILFAHRIDI-RQISLDFDHLIDVVLPLPPISNAVALDVDRKTGYIYWSDTIENVIM--SSSPDGLHVQKIVGDSLENPDGLVVDSIGRTIY-------WADAGRHTIEVASLDGSNRHVIAYKDLESPRGLALDYEAGL--LFW-----TDWGHYRKIERSHLDGNE 1377          

HSP 2 Score: 130.568 bits (327), Expect = 1.181e-29
Identity = 183/813 (22.51%), Postives = 339/813 (41.70%), Query Frame = 3
Query:  234 TANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQ------WSPTFLTFTEGKLVFINDEQLWVSSFECGTG--ISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPC--MNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGG----LQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDG--SMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLN-ISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSS 2612
            T N + L+    + V+   + S   +A+DW++  LYW D     IEV   N         + R +L+   +     +VV+P E ++FW   G   ++ER+ +DG +R  I    L   + LAID  +  +++         VD   +T  +M   G+ +Q        P  L   EG++ + + +   V S    TG   ++ +  + ++  I +  R       R R  + C  +N  CS +CL +  ++Y C+C+ G+    +   C   PT+ +   +   I  +SLD      +  PL  +S    +      D  T  + + D   + I S       +P   ++   +   +  P  + VDS  R IYW +     + VA +   NR   A                Y+  + P  LA+D     LF T        IER  LDG ++  ++++ N  WP GL+LD   +++Y+VD     + S +Y G  ++++        +L+  D+ IYWT+ ++ ++H  +     + R ++T    L    + +I  ++N S    + C + +  C  LC     N   +SC C     +  N  ++C    E   Y   ++     +       ++++    + V  A +   HYR  + +       +++  +  ++     I      T + +AVD+I +NLY S T      I + RL     D S    +V   + +    ++ VH    +LFW      D  + A++ +++LDGS + ++I  G+     L +D     + W  +
Sbjct:  976 TINKAHLNGSYQQRVVHSNLVSPVGLALDWITDKLYWTDPSTNRIEVATTN--------GKMRTLLIWEKLYKPRDIVVNPIEGFMFWSDWGDDPMIERANMDGHERVTITSKKLIYPNGLAIDYEKSKIYF---------VDGGTKTLENMNFDGSGRQVILNGLGHPFGLDVNEGRVFWTDWDTKSVMSANKLTGKDTNVIIANSTDLMDIRVFHRT------RRRIFNACDKLNGGCSHLCL-LNPTSYTCACTVGVQLKEDRHTCSEGPTQYILFAHRIDIRQISLDFDHLIDVVLPLPPISNAVALDV----DRKTGYIYWSDTIENVIMS------SSPDGLHVQKIVGDSLENPDGLVVDSIGRTIYWADAGRHTIEVASLDGSNRHVIA----------------YKDLESPRGLALDYEAGLLFWTDWGHYR-KIERSHLDGNERSRIVTA-NLGWPNGLSLDLKSKRIYWVDARLKTIDSCDYTGNQRKLIMSSLHHPYALALSDDNIYWTDWKSKALHMTERRNISAKRDIITNIDGL--MDIKIIYQNQNQST-MKNACGNNNGNCSHLCLR---NPSGYSCQCPIGLRLRQNSTTQCQNLPED--YLLIALRSGIGMISLNSGDFMDVVLPINGVHGAVVLDYHYRKNLLFFADVNLDVIRRVNLLNLTESKVIVGTDVLTPNGIAVDWIADNLYWSDTDR--KLIEVSRL-----DGSCRKRIVEDNLGDP--RSLIVHPKKAYLFW-----SDWSSPAKIERSYLDGSNRTVIITSGIGFPTGLTIDFTNRRLLWADA 1714          

HSP 3 Score: 90.5077 bits (223), Expect = 1.627e-17
Identity = 124/583 (21.27%), Postives = 230/583 (39.45%), Query Frame = 3
Query:  246 SKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGT----------------WKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAV-CPTFPTRSLFIGNPPKIYHMSLDGG--LQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIH-SVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCF 1928
            S  D   ++ ++   +++ + + VD +   +YWAD     IEV  L+           R ++  +++     L +D     LFW   G    +ERS LDG++R  I  + L   + L++D   K ++W  +D  +  +D    TG   ++  +                W  W    L  TE +   I+ ++  +++ +    I I  + N N + +      +                  S +CL    S Y C C  G+    N+   C   P   L I     I  +SL+ G  +   L +   +  +   + Y    + L + D N   I  ++L      +       + +D+  P  IAVD  + N+YW +     + V+R+    R +     L                  P  L V     YLF +  +     IER +LDG+ +  +I+S   F P GL +D   ++L + D ++ ++  V+++G  ++ +         L+ F+N I+WT+    S++ S K   S      + R+  +  + + AVS +    + + C   +  C  LC 
Sbjct: 1284 SSPDGLHVQKIVGDSLENPDGLVVDSIGRTIYWADAGRHTIEVASLD--------GSNRHVIAYKDLESPRGLALDYEAGLLFWTDWGHYRKIERSHLDGNERSRIVTANLGWPNGLSLDLKSKRIYW--VDARLKTIDSCDYTGNQRKLIMSSLHHPYALALSDDNIYWTDWKSKALHMTERR--NISAKRDIITNIDGLMDIKIIYQ-NQNQSTMKNACGNNNGNC--------------SHLCLR-NPSGYSCQCPIGLRLRQNSTTQCQNLPEDYLLIALRSGIGMISLNSGDFMDVVLPINGVHGAVVLDYHYRK--NLLFFADVNLDVIRRVNLLNLTESKVI-----VGTDVLTPNGIAVDWIADNLYWSDTDRKLIEVSRLDGSCRKRIVEDNLG----------------DPRSLIVHPKKAYLFWSDWS-SPAKIERSYLDGSNRTVIITSGIGF-PTGLTIDFTNRRLLWADALEDNIGQVDFNGKRRQTIVPYAPHPFGLTLFENSIFWTDWYNKSVYRSQKLARSGYGNPFEVRDALSGALDIRAVSLSRQPKSVNHCAQDNGGCTHLCL 1813          

HSP 4 Score: 74.7146 bits (182), Expect = 9.253e-13
Identity = 53/165 (32.12%), Postives = 83/165 (50.30%), Query Frame = 3
Query:  183 RKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWW-GLDGEIHRVDYQGQ 674
            RK  +F    N   +++  N   L   K+  ++   V +   +AVDW++ NLYW+D   + IEV  L+           R+ ++  N+ D  SL+V P + YLFW    +   +ERS LDGS+R VI  S +   + L ID   + L W   L+  I +VD+ G+
Sbjct: 1574 RKNLLFFADVN-LDVIRRVNLLNLTESKV--IVGTDVLTPNGIAVDWIADNLYWSDTDRKLIEVSRLD--------GSCRKRIVEDNLGDPRSLIVHPKKAYLFWSDWSSPAKIERSYLDGSNRTVIITSGIGFPTGLTIDFTNRRLLWADALEDNIGQVDFNGK 1727          

HSP 5 Score: 67.3958 bits (163), Expect = 1.593e-10
Identity = 144/694 (20.75%), Postives = 259/694 (37.32%), Query Frame = 3
Query: 1893 YSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVE-SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVD--RTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDW 3959
            Y TS  C Q C    G   SF C C     +  ++  C      +     +      +T + ++ Y  + KG  +    +L   H +  ++W + + + I     N    R +  + L S     +AVD+I + L+       W+     R+  ++   +   V+ S  +      A+ VH      FW      D     ++ +A++DG+Q  ++I +GV   + L +D   + + W  +   K +  E  N   S+             +     H+ P+  +L LF  D++Y    +  + S   K    I+     A    F F     A    +          E    C          CS  CLP + SR CGC    SL  DG TC   +D L+++    +I      + + +D++ D          P +              ++++ LDN     A+D      ++     ++ ++ +  +  + SY + +     S   S   LA+D I+D L W+D  T  I     N    ++  L +     E   +P  I + PI   + W       S+  D  +     IE +++DG+ R  +     I P+ L +D    +IY++D  T  L  ++      Q+                 + NG+G     + V +  +FWTDW
Sbjct:  570 YLTSPVCSQKCHNTMG---SFKCSCETGYILRPDLRSCKALGGAMTLLVANRWDIRRVTLSNNR-YSAIVKGLHNA--IALDFHHRKGLMFWSDVSTDVIKMVYMNGTRVRDVIKWGLESP--GGIAVDWIHDLLF-------WTDSGTRRVEVSNFQGNLRTVIASYDLDKP--RAIVVHPGEALAFW-----SDWGPNPKIERAYMDGTQRKVIISKGVTWPNGLAIDFPNSKIYWADA---KQHAIECSNLDGSD------------RNKILSTHL-PHPFALTLF-EDTMYWTDWNTKTVSAADK----ITGKEFRAVHENFHFPMDIHAYHPARQP--------EYADRCQKDRRGLRGGCSHLCLPNKTSRRCGCPIGLSLKEDGKTCKSTADKLVLVARRKDI-----RLRHLRDNQAD----------PNDV-------------DMIVPLDNLKHAVALDWCSDTDFIYWTDVERSTINKAHL--NGSYQQRV---VHSNLVSPVGLALDWITDKLYWTDPSTNRIEVATTNG---KMRTLLIW----EKLYKPRDIVVNPIEGFMFW-------SDWGDDPM-----IERANMDGHERVTITSKKLIYPNGLAIDYEKSKIYFVDGGTKTLENMNFDGSGRQV-----------------ILNGLGHPF-GLDVNEGRVFWTDW 1142          

HSP 6 Score: 53.1434 bits (126), Expect = 3.175e-6
Identity = 40/114 (35.09%), Postives = 51/114 (44.74%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQKFECLSGKDVTR------------CLPISARCNGIVDCRDGSDEHGC 4721
            C+     CD   DC D SDE  CN  TC   H ++C+    C+ +  RCDG  DC  +SDE  C +    C  G+   R            C+    RC+G  DC D SDE  C
Sbjct:  279 CIPRTWVCDGENDCKDFSDETHCNRTTCTDEH-FTCNDG-YCISLAFRCDGEHDCNDNSDELKCAAVINSCPEGEFKCRGGLGGAGGPSGQCILNRFRCDGDNDCGDWSDEENC 390          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Fly
Match: mgl (gene:FBgn0261260 transcript:FBtr0343371)

HSP 1 Score: 135.191 bits (339), Expect = 5.523e-31
Identity = 326/1579 (20.65%), Postives = 585/1579 (37.05%), Query Frame = 3
Query:  222 SLLKTANFSKLDRR-KMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVD--PWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVD--YQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQL--MVPRGRRKSPCMNRVCSSICL--PIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDG-----GLQPPLELLSENAGIPFRFAYDSVTSSLLYV-----DFNSSSIFSLDLNKYGTPQRFYLDFPISSDI---PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLF--VTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFI----SLSYFDNFIYWTELETLSIHSVKFD----GSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQ-IYWINQAA---NCIMKTASN-TDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYR--YEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIA-LAKSDIGTESVILCPTHNHDNFLTCSQFC--LPVESR------------ECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGN-RRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNL-QYLKDKLKTVVRIMARIAPEDFKSSSLGTL-LQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCS---CPVSM-------SVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGC--NTCNISHLYSCSRSDVCLPITKRCDGVMDC-------DSDEQC-----CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            S +K    S+LDR  + ++++   +   E +A DW++ NLYW D K   IEV   N  +          +L+  N+     + +D  P  +++FW   G    +ER  +DG+ R+ I  + ++  + L +D   K +++   D ++  +D  Y   TG    +  +     P  L+  E  L + + +   V S     G +  + ++    P++I      L  M P     +PC    C  +CL  P     Y C C  G  + ++   C       L +    +I  + L+G     G   P+  +  + G+ F    D    +L +V     D  + +I++     YG   +  L   I + I   P +IA D   RN+Y  N   S +   R+    + KY T++L+    P    SR      P  +A+D     LF     + +    I R  ++G     V        P  LA+D  ++ +Y+  +    +  ++Y+G    ++  K    +    SL   D+ +Y+  L+ L    V+ D     + +++V    +L  R+M  +   + A +    PC + +  C  LC P  G   + +CG   R    +N   C       V     M+  + L+ +++      G G   + V  +    YR Q IYW        N I ++  N TD+Q  +K   + S+ I  L +D++  N+Y +      + + +  L         +N  V  K        ++V+   + L+W +     R     + +A LDGS+   L+  G++   +L +D Q + + W  S    I +  Y   NRK                         PN   + +++ D  +          + R  +T      HSA     +  + S+  + +K+  +A  +I  +         H     C Q C   P +              EC  G    LSAD   C  +++ L+  T T     IR   L+    E+ F     L+          +   +  + N +L            + RP+  I   K       DI               +K  +   +A D     + W+D     I A  +N D   +  +  +        RP  I + P + +L +   D+ +  T+         I  + + G+ +R+++ K+   PS L +D    R+YW D    K            I    + G N ++ V + +         ++ V + Y++WTD        + +    +     G +   + + L+D  + +     RI   D +  ++    + N  C+++ H   N +    C  +  +                 KF C    C   M            S     +C       C   +  C  G             C+    +CD   DC DGSDE+GC    C +   ++C+    C+P  + C+GV DC       ++ E+C     C +   +C   +    C+     C+G  DC D SDE
Sbjct: 1606 SDMKLKKISRLDRGMEPQEIINTGLDLVEGLAYDWIAQNLYWLDSKLNTIEVSAENGSNRL--------VLVRENITQPRGMCIDPSPGARWIFWTDWGENPRVERIGMDGTMRKTIINTKIYWPNGLTLDIATKRVYF--ADSKLDFIDFCYYNGTGRQQVLASSHYLLHPHSLSLFEDTLYWTDRQLNRVLSANKFRGKNQTVVSHLISQPLSIHVHHASLQPMTP-----NPCAGSRCQHLCLLSPSAPEGYSCKCRPGF-KLLSEGRCIEEENPFLMVVKGTQIVDLPLNGGDARAGALAPVIGIESSTGLDF----DRKGETLYWVQGREDDDENCTIYT---TPYGGGNK-TLFLGIENGIVGAPYTIAFDWLGRNLYIGNRVASNIEAVRVDG--KQKYRTIILANDGYPN-SVSR------PKQIALDPTEGKLFWIDEGVLEVPIKIGRVDMNGQNPIVVFQEFAH--PESLAVDTEKKMVYYSASNPAVIGVMDYNGDDHTLILMKDSHPMAKPRSLGILDHRLYY--LDPLYERIVRIDLPHGDNPKTIVDNESDL--RSM--MIYKKRALMQ--HPCQTNNGGCKHLCIPGPGATRTCACGIGYRKENEIN---CVAYKIFAVVSQLDMIRGYSLSDSSEAMVPISGPGHHILHVDVM----YREQWIYWAEYNRGYWNGIFRSRPNGTDLQHVVKDG-IGSNGIRGLTIDWVAGNMYFTNVYPHENYVEVCWL-------DGSNRKVLVKTTTDAPRELAVNPIKRLLYWIDYGQHPR-----IGKALLDGSKWTPLVTSGISLPRDLTIDMQTHDIYWVDSKLDTIQKISYNGANRK-------------------IIRRDLPNPMGIAVYLNDVYW----------VDRNLMTVFKASKHSA-----NETATSVRTNLEKLRDIAIYNINNQPQDDTNPCAHLGNGGCDQLCFSFPPDGGASGTSGGRNFRCECATG---KLSADERKCEVVNEYLVFATRT----EIRAVNLDPHSTEVPFTPLTNLT--------NVVGLDFDFAHNRMLYT----------QIRPWAKIAYTKANKPGHDDITV-----------VLNKGINPEGIAYDWTQQKIYWTDSSNNSIYA--MNLDGSELVMIARV-------ERPRAIVLDPCNGTLFF--TDWGRFGTSGK-------IFRTTMAGSLKRAIVDKDLSQPSGLAIDYDERRLYWTDAVREK------------IERSDLDGQNRELLVAATI------YPFAITVFRNYIYWTD--------LQLRGVYRAEKHTGANMVEMVKRLEDSPRDI-----RIYSSDRQKCNVNPCRINNGGCAQSCHPAPNGKAECKCDDSTKVVNEGRMCAPRNNTCEASKFYCKNGRCISRMWSCDGDDDCGDNSDEDPNYCAYH---SCSPNEFRCNNG------------RCIFKSWKCDHENDCKDGSDELGCVYPPC-VDGEFTCANG-RCIPQAQVCNGVNDCKDNATSDETHERCPMNTTCPANHLKC---EKTNICVEPYWLCDGDNDCGDNSDE 2982          

HSP 2 Score: 94.7449 bits (234), Expect = 1.025e-18
Identity = 151/626 (24.12%), Postives = 256/626 (40.89%), Query Frame = 3
Query:  765 DEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMN-------RVCSSICLPIVDSAYRCSCSTGITEPINNAVC--PTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDL---NKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFIS---LSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCF--PIRGNQHS--FSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESD---------VQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKN-KILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGV 2552
            DE+   S   C   +S   K  P++       +  Q + P  R    C++         C  +C   + S Y C C+ G T  IN++ C  P      L   +   I  M   G     L   +  AG+ F +A     ++L + D  +  + SL L   NK  +P  F    P  +  PV++AVD     IY  +    ++ V  +S      +A +L S   SP              DLA+D     +FV    DG   + R  +DGT   +++S    +   G+ +D   +++++ D++   + SV+Y G + R++  + Q+  S   L+ F+N IYWT+     I SV KF+G     VT           +IAV   +     +PC + +  C+ +C    ++G      F C CS    +  ++  C   SE ++Y  +  +    L P        + +G SD          +   L  D     IY+ +   + I +   N    R++ +    ++ +  LAVD+   NLY   +      ++  R   TH           T +KN K   A+ VH +  F+F+ E    DR   A + +A+ DGS  +L+++ V
Sbjct:  407 DEETNCSIASC-PALSCEFKCGPSLTGGVCYCKPGQSLAPDNRT---CVDLDECAEWGHCDQLCTNTLGS-YTCQCAQGYTL-INDSKCIAPDANNLQLIFAHDRAIMRMLPHGSEPKILANATAAAGVTFHYA----RNTLYWSDIKTRKVQSLPLDAQNKAVSP--FDQTLP-GTWAPVALAVDWVGDKIYVADLVGQKIDVFELSG---QWHAVVLGSNLTSPA-------------DLALDPTAGLMFVA---DGG-QVLRAHMDGTHARSIVSEAA-YKASGVTVDIISKRVFWCDSLLDYIESVDYEG-AHRVMVLRGQQVPSPSRLALFENRIYWTDATKQGIMSVDKFEGPTSIQVTYKAKDIREPKGIIAVHALSQPRVSNPCGNNNGGCNHMCIVTAVKGAPTGLGFRCACSTGYQLETDLKLCKPVSEFLMYSQQRFIKGKVLEP--------VIEGFSDAIMPVVSRRARFVGLDFDARDEFIYYSDVLQDVIYRVHRNG-TGREI-VLASQNEGVEGLAVDWASKNLYYIDSRKGTLNVLSTR-NVTHR---------RTLLKNLKRPRAIVVHPNRGFIFFSEW---DRP--ANITRANTDGSG-LLVFKNV 971          

HSP 3 Score: 93.5893 bits (231), Expect = 2.110e-18
Identity = 117/447 (26.17%), Postives = 172/447 (38.48%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWH-QFWIEMSDLDG-NRRSVLVKNPGI--PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGK---FRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHL----YSCSRSDVCLPITKRCDGVMDCD--SDEQ-C---CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
             +AID +   L W D  +  +    L+  K +    GV+         P  I + P    L + S             WH Q +I    +DG N   +L  N GI  P+ L++D  + RIYW D   + + Y  +     + R  H +    KV               ++ +   Y++W+DW   + A +  N            F+   Y      TV+R       +   +  L  L   +PC        N  CSHLCL    I+   E ++L     ++     F+C+CP    +    +  +  C   Q +        CG      + E      C+    +CD   DC DGSDE    TC   H     + C  ++ C P    CDGV DC   SDEQ C   C    F+C   K   RC+  S RC+G  DC+DGSDE
Sbjct: 3418 GIAIDWVGRKLYWLDRHSKNLDVSELDGSKRKTLRSGVV--------DPRAIVVHPGIGYLYFTS-------------WHLQAYIAKMGMDGSNFSRILNWNDGIAWPNALSIDYFTDRIYWADAHLDYIAYADL-----EGRHRHTVLSGSKVP-----------HVFALSLFDDYIYWSDW--NLKAIVRANK-----------FHGANY------TVLRNTTHRPYDLHINHPLRQLPYTNPCG-----TNNGGCSHLCL----IAPPPESTYLNIEGYIEEGAPIFKCACPNQFYLARDMKTCVANCTAGQHL--------CGG-----RDE-----KCIPWFWKCDGEKDCKDGSDEPA--TCAPRHCRAGTFQCKNTN-CTPSATICDGVDDCGDRSDEQNCDLPCPLSDFKC---KSSGRCILDSWRCDGDADCKDGSDE 3775          

HSP 4 Score: 89.7373 bits (221), Expect = 3.512e-17
Identity = 134/567 (23.63%), Postives = 233/567 (41.09%), Query Frame = 3
Query:  306 SVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWW-GLDGEIHRVDYQGQTGCSMRVQGTWKQW--SPTFLTFTEGKLVFINDEQ---LWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNR--VCSSICL-PIVDSA-----YRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPF-----RFA---YDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGS-KRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPI 1934
            ++AVDWV   +Y AD   Q I+V +L+         +   ++L  N+     L +DP    +F    G ++   R+ +DG+  R I     +K+S + +D   K +FW   L   I  VDY+G    + RV     Q   SP+ L   E ++ + +  +   + V  FE  T I +  K      P  II+  H L  P  R  +PC N    C+ +C+   V  A     +RC+CSTG     +  +C   P     + +  +     +   L+P +E  S+ A +P      RF    +D+    + Y D     I+ +  N  GT +   L     ++    +AVD AS+N+Y+++ R   + V  +S+ N     TLL +       K  R     P         NR        D   +I R   DG+    V  +    WP GL++D    ++Y+ D +   +   N  G   K + ++  +   S+   ++++Y T+    +I  + K  G    ++ +    +      +       I    PC+  +  C ++CF +
Sbjct:  575 ALAVDWVGDKIYVADLVGQKIDVFELS--------GQWHAVVLGSNLTSPADLALDPTAGLMFVADGGQVL---RAHMDGTHARSIVSEAAYKASGVTVDIISKRVFWCDSLLDYIESVDYEG----AHRVMVLRGQQVPSPSRLALFENRIYWTDATKQGIMSVDKFEGPTSIQVTYKAKDIREPKGIIA-VHALSQP--RVSNPCGNNNGGCNHMCIVTAVKGAPTGLGFRCACSTGYQLETDLKLCK--PVSEFLMYSQQRFIKGKV---LEPVIEGFSD-AIMPVVSRRARFVGLDFDARDEFIYYSDVLQDVIYRVHRN--GTGREIVL--ASQNEGVEGLAVDWASKNLYYIDSRKGTLNV--LSTRNVTHRRTLLKN------LKRPRAIVVHP---------NRGFIFFSEWDRPANITRANTDGS-GLLVFKNVTLGWPNGLSIDFKEDRVYWCDALLDHVQHANLDGTDIKTVNSRLVRHPFSIVIHNDWMYITDWRLDAIIRLHKLTGEQEEMMVREPQTNRLYGVKVYSHEVQRIADTQPCHRNNGGCQKICFAV 1095          

HSP 5 Score: 67.3958 bits (163), Expect = 2.061e-10
Identity = 45/116 (38.79%), Postives = 57/116 (49.14%), Query Frame = 3
Query: 4419 VMSCMSVQQRCDSTVDCLDGSDEVGC-----NTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCG-----SQKFECLSGKDVTRCLPISARCNGIVDCRDGSD---EHGC 4721
            +  C+    +CD   DC DGSDEVGC     N CN+   + C  +  C+PI   CDG  DC   SDEQ CG        F+C    + T C+  +  C+G  DC D SD   EH C
Sbjct: 1318 LRQCVEESYKCDGIPDCNDGSDEVGCPSMGPNQCNLEKHFRCKSTGFCIPIAWHCDGSNDCSDHSDEQDCGQITCAQNFFKC----NNTNCVFKAYICDGKDDCGDNSDEGAEHAC 1429          

HSP 6 Score: 58.9214 bits (141), Expect = 7.453e-8
Identity = 46/143 (32.17%), Postives = 64/143 (44.76%), Query Frame = 3
Query: 4353 KCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCN--TCNISHLYSCSRSDV----------CLPITKRCDGVMDCDS--DEQCCGS-----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCN 4724
            +C+  Q+ CG    F+K        C+    RCD   DC D SDE  C    C  + L+  + +            C+P  KRCDG +DC +  DE  C        +F C +G    +C+  + +CN   DC D SDE GCN
Sbjct:  196 ECETPQLNCGQ-YTFNK------TYCIPPHYRCDMIEDCEDKSDEAQCTYRKCQHTDLFCNTPTGAPAEGARLTGPCVPKEKRCDGYLDCRTGRDEVGCSGVACRLDQFRCANG---LKCIDAALKCNHRDDCGDNSDEQGCN 328          

HSP 7 Score: 58.5362 bits (140), Expect = 8.453e-8
Identity = 41/124 (33.06%), Postives = 63/124 (50.81%), Query Frame = 3
Query: 4377 CGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVG-CNTCNISHL-YSCSRSDVCLPITKRCDGVMDC---DSDEQC----CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            CG     + +   +   C+    +CDS  DC D SDE   C     ++  ++C R+  C+P +  CDG  DC     ++ C    C + +F+C    D+ +C+  S +C+GI DC DGSDE GC
Sbjct: 1223 CGNVTCGTSQFACANGRCIPNMWKCDSENDCGDSSDEGDFCAEKTCAYFQFTCPRTGHCIPQSWVCDGDDDCFDKQDEKDCPPISCLANQFKC---ADLRQCVEESYKCDGIPDCNDGSDEVGC 1343          

HSP 8 Score: 58.5362 bits (140), Expect = 9.667e-8
Identity = 65/300 (21.67%), Postives = 129/300 (43.00%), Query Frame = 3
Query:  153 KLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRK----MRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIE----VVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQW--------SPTFLTFTEGKLVFIN-DEQLWVSSFECGTGISIALK---TNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEP 992
            K + A  + +++  VF      K++ ++   + +D R      +D+         +VAVDW++ NLYW +      +    V+    D  +      RR +++  +    S+ V+P    ++W   G+   +E S +DGS RR +   ++   + L ID  +  + +W +D +++ ++       SMR  G+ ++          P  L   E  + ++  D    V   + G G+ + L     NP+   +    +++   +P     +PC N  CS +CL +V   +RC+C      P
Sbjct: 4238 KRIEALDYDAQQQIVFWADSYDKTIKRSYMVNAIDGRAKIGFAQDLNMKGGSKPTAVAVDWLASNLYWTEMDRTGSKPRGRVMVAKTDGRY------RRSIVNAGLEVPTSIAVNPQLGRIYWSDAGSAPKIEVSWMDGSKRRPLITEMIRHPAGLTIDYSQDHIIYW-VDTKLNAIE-------SMRADGSRRKAIVRGDQLRHPVSLDLFESNMFWMTRDTGELVRQDKFGRGVQVVLHRYIVNPSGLKV-YHDKRYNTSLP-----NPCDNSTCSHLCL-LVPGGHRCACPDASGPP 4516          

HSP 9 Score: 55.8398 bits (133), Expect = 5.536e-7
Identity = 45/170 (26.47%), Postives = 67/170 (39.41%), Query Frame = 3
Query: 4353 KCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCG-----SQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSVALSAC 4835
            KC    + C        +       C+  ++RCD  +DC  G DEVGC+   C +   + C+    C+    +C+   DC  +SDEQ C        +F C +      C+P +  C+G  DC D SDE  C               T I  P+N  +    G+     C
Sbjct:  240 KCQHTDLFCNTPTGAPAEGARLTGPCVPKEKRCDGYLDCRTGRDEVGCSGVACRLDQ-FRCANGLKCIDAALKCNHRDDCGDNSDEQGCNFPPCHHAQFRCTN----ALCIPYNFHCDGYHDCADKSDEANC---------------TAIACPDNKHLCPRGGASGTPKC 389          

HSP 10 Score: 54.299 bits (129), Expect = 1.869e-6
Identity = 46/149 (30.87%), Postives = 64/149 (42.95%), Query Frame = 3
Query: 4326 GFCVKSQLVKCDRY--------QIPC-GAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHL-YSCSRSDVCLPITKRCDGVMDC--DSDEQ-----CCGSQKFECLSG--KDVTRCLPISARCNGIVDCRDGSDEH 4715
            G CV  +  +CD Y        ++ C G      +    + + C+    +C+   DC D SDE GCN     H  + C+ + +C+P    CDG  DC   SDE       C   K  C  G      +C+  S  C+G  DC DGSDE 
Sbjct:  263 GPCVPKEK-RCDGYLDCRTGRDEVGCSGVACRLDQFRCANGLKCIDAALKCNHRDDCGDNSDEQGCNFPPCHHAQFRCTNA-LCIPYNFHCDGYHDCADKSDEANCTAIACPDNKHLCPRGGASGTPKCILKSQLCDGKRDCEDGSDEE 409          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Zebrafish
Match: lrp5 (low density lipoprotein receptor-related protein 5 [Source:ZFIN;Acc:ZDB-GENE-050518-2])

HSP 1 Score: 253.832 bits (647), Expect = 2.911e-67
Identity = 356/1574 (22.62%), Postives = 626/1574 (39.77%), Query Frame = 3
Query:  144 TDLKLLAADVFLSRKLYVF---VIQENGKSL---LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPCMNR--VCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCN----RNNRNRALSTLDPATVINL 4781
            +DL+  AA  FL  +  +F   V +E  K     L T +  +    K + V+   + S + +A DW+   LYW D +   IEV +L+  S        R++L  +++    ++ ++P  +Y++W   G    +ER+ +DGS+R++I +  ++  + L ID   + L+W   D +   IHR +  G T     V+G+     P  LT  +  L + + +   + +    +G       N   +P  I ++ ++ Q  +     ++PC  R   CS +C L  +   Y C+C TG+    +   C     + L +     +  +SLD      + L   +        YD V   + + D    +I    ++  G+  +  +   I+   P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  + +D IN Y++ T   +    IER  LDGT +  V+ +T+  WP GLA+D    +LY+ D  K D I V    G+ R  IL  K       +    +IYWT+ +  SI  V    S R ++ +        +  +  ++    +  + C   +  C  LCF         SC C     +L ++  C      +++ N++ + +  L  N++   I L   +   + ++L  D   N+IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   + R     + +AH+DGS  + +   V   + L +D     + W   D+  I   E  N +  + ++  D L      +    +IY        +   ++  +  +D  S + R  +      GH        +V   +   + +   A           C  +N      C+  CL   S  +C C S Y+L A+G  C   S  L+    +     I   +L E+  ++     V  + + I+        VYW+     +R       S  D T+   ++        Q HD                        L++DP S T+ W+   T  I   R++        +G ++  ++   +P  I +      + + +     ++           IE + LDG  R  L     I P  L +D   G+++W+D             D  +I +  + G N  V  DS +   VG     + VL  +L+W D  QQ+   +   +  K +   G     LQYL     T +  +  +  ++F +         HPCSR     +N  CSH+C++                 + DG  RCSCP+ + +              +   C   Q  C  G +           C+ +  RCD   +C D SDE+ C  C+    + C +   C+ I  RC+G  DC   SDEQ     C S +F C +    ++C+    +C+   DC D SDE  C+     N+  R  ST+ P   I L
Sbjct:   57 SDLEDAAAVDFLFSEGLIFWTDVSEEAIKQTYYNLSTNSMKEATLGKGQTVVVSGLDSPDGLACDWLGHKLYWTDSETNRIEVANLDGTS--------RKVLFWQDLDQPRAIALNPSHRYMYWTDWGEEPRIERAGMDGSNRQIIVQKQIYWPNGLTIDLDEQKLYW--ADAKLSFIHRANLDG-TSREAVVEGSLTH--PFALTLYDETLYWTDWQTRSIHACNKHSGEKHREILNGIYSPMDIQVLGQERQPNI-----QTPCSERNGGCSHLCLLSPIPPFYSCACPTGVKLKEDGKTCRPGAEQVLLLARRTDLRRISLDLPDFTDIVLQVNDIRHAIAIDYDPVEGYVYWTDDELRAIRRARID--GSDAQTLITNEINH--PDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----RVLIS------------ENLDEPRAIVLDPINGYMYWTDWGE-LPKIERANLDGTDRV-VLLNTSLGWPNGLAIDYIAGKLYWGD-AKTDKIEVINVDGTNRMTILEDKLPHIFGFTLLGEYIYWTDWQRRSIERVHIANSTREVIVE----QLPDLMGLKATKVMEAEGTNGCAENNGGCSHLCF---HRPQGLSCACPMGLELLSDLRTCVVPEAFLLFTNRADIRSISLGTNSNDVPIPLTGVK---EASALDFDVLENRIYWTDVSTKTISRAFMNGSSVEPVIEFGL--DYPEGMAVDWMGRNLYWADTGT--NRIEVARL-----DGQYRQVLVCKDLDNP--RSLALDPANGYMYWTEWGGRPR-----IARAHMDGSNIVTLVDKVGRANGLTIDYIDQRLYWTDLDTCMI---ESTNMQGLQREIVADDLPHPFGLTQYRDYIY--------WTDWNLRSIERADKRSGLNRTVVQ-----GH------LEYVMDILVFHSSRQDGAND---------CSQNNG----QCAHLCLASPSGAQCRCASHYTLEANGRNCSSPSSFLLFSQKS----SISRMVLGEQSPDMILPIHVMKNLRAISF-DPLERLVYWVDGRQNIRR------SRDDGTQASTVMTPNSDHPKQPHD------------------------LSLDPYSRTVYWTCETTNTINIHRMDG-----HIIGEVL--KDDVDKPRAIVVNAEKGYMYFTTVQERSAK-----------IEGASLDGTERESLFTTSLIRPVALALDNKLGKLFWVDA------------DLKRIESSDLSGANRIVLQDSNILQPVG-----LTVLGDHLYWIDKQQQMIERVDKLTGEKRTRIQG----RLQYL-----TGIHAVQYMETDEFAT---------HPCSR-----DNGGCSHICIA-----------------KGDGTPRCSCPMHLVLLQN------LLSCGEPPTCSSEQFTCATGEI----------DCIPMAWRCDGIAECADNSDEMNCPICSKLQ-FQCDKGQ-CVDIQVRCNGEPDCADGSDEQDCETICLSNQFRCGN----SQCILKKQQCDSFPDCTDESDERFCDFPPPPNDLPRHTSTIGPVIGIIL 1396          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Zebrafish
Match: lrp5 (low density lipoprotein receptor-related protein 5 [Source:ZFIN;Acc:ZDB-GENE-050518-2])

HSP 1 Score: 253.832 bits (647), Expect = 2.911e-67
Identity = 356/1574 (22.62%), Postives = 626/1574 (39.77%), Query Frame = 3
Query:  144 TDLKLLAADVFLSRKLYVF---VIQENGKSL---LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPCMNR--VCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCN----RNNRNRALSTLDPATVINL 4781
            +DL+  AA  FL  +  +F   V +E  K     L T +  +    K + V+   + S + +A DW+   LYW D +   IEV +L+  S        R++L  +++    ++ ++P  +Y++W   G    +ER+ +DGS+R++I +  ++  + L ID   + L+W   D +   IHR +  G T     V+G+     P  LT  +  L + + +   + +    +G       N   +P  I ++ ++ Q  +     ++PC  R   CS +C L  +   Y C+C TG+    +   C     + L +     +  +SLD      + L   +        YD V   + + D    +I    ++  G+  +  +   I+   P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  + +D IN Y++ T   +    IER  LDGT +  V+ +T+  WP GLA+D    +LY+ D  K D I V    G+ R  IL  K       +    +IYWT+ +  SI  V    S R ++ +        +  +  ++    +  + C   +  C  LCF         SC C     +L ++  C      +++ N++ + +  L  N++   I L   +   + ++L  D   N+IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   + R     + +AH+DGS  + +   V   + L +D     + W   D+  I   E  N +  + ++  D L      +    +IY        +   ++  +  +D  S + R  +      GH        +V   +   + +   A           C  +N      C+  CL   S  +C C S Y+L A+G  C   S  L+    +     I   +L E+  ++     V  + + I+        VYW+     +R       S  D T+   ++        Q HD                        L++DP S T+ W+   T  I   R++        +G ++  ++   +P  I +      + + +     ++           IE + LDG  R  L     I P  L +D   G+++W+D             D  +I +  + G N  V  DS +   VG     + VL  +L+W D  QQ+   +   +  K +   G     LQYL     T +  +  +  ++F +         HPCSR     +N  CSH+C++                 + DG  RCSCP+ + +              +   C   Q  C  G +           C+ +  RCD   +C D SDE+ C  C+    + C +   C+ I  RC+G  DC   SDEQ     C S +F C +    ++C+    +C+   DC D SDE  C+     N+  R  ST+ P   I L
Sbjct:   57 SDLEDAAAVDFLFSEGLIFWTDVSEEAIKQTYYNLSTNSMKEATLGKGQTVVVSGLDSPDGLACDWLGHKLYWTDSETNRIEVANLDGTS--------RKVLFWQDLDQPRAIALNPSHRYMYWTDWGEEPRIERAGMDGSNRQIIVQKQIYWPNGLTIDLDEQKLYW--ADAKLSFIHRANLDG-TSREAVVEGSLTH--PFALTLYDETLYWTDWQTRSIHACNKHSGEKHREILNGIYSPMDIQVLGQERQPNI-----QTPCSERNGGCSHLCLLSPIPPFYSCACPTGVKLKEDGKTCRPGAEQVLLLARRTDLRRISLDLPDFTDIVLQVNDIRHAIAIDYDPVEGYVYWTDDELRAIRRARID--GSDAQTLITNEINH--PDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----RVLIS------------ENLDEPRAIVLDPINGYMYWTDWGE-LPKIERANLDGTDRV-VLLNTSLGWPNGLAIDYIAGKLYWGD-AKTDKIEVINVDGTNRMTILEDKLPHIFGFTLLGEYIYWTDWQRRSIERVHIANSTREVIVE----QLPDLMGLKATKVMEAEGTNGCAENNGGCSHLCF---HRPQGLSCACPMGLELLSDLRTCVVPEAFLLFTNRADIRSISLGTNSNDVPIPLTGVK---EASALDFDVLENRIYWTDVSTKTISRAFMNGSSVEPVIEFGL--DYPEGMAVDWMGRNLYWADTGT--NRIEVARL-----DGQYRQVLVCKDLDNP--RSLALDPANGYMYWTEWGGRPR-----IARAHMDGSNIVTLVDKVGRANGLTIDYIDQRLYWTDLDTCMI---ESTNMQGLQREIVADDLPHPFGLTQYRDYIY--------WTDWNLRSIERADKRSGLNRTVVQ-----GH------LEYVMDILVFHSSRQDGAND---------CSQNNG----QCAHLCLASPSGAQCRCASHYTLEANGRNCSSPSSFLLFSQKS----SISRMVLGEQSPDMILPIHVMKNLRAISF-DPLERLVYWVDGRQNIRR------SRDDGTQASTVMTPNSDHPKQPHD------------------------LSLDPYSRTVYWTCETTNTINIHRMDG-----HIIGEVL--KDDVDKPRAIVVNAEKGYMYFTTVQERSAK-----------IEGASLDGTERESLFTTSLIRPVALALDNKLGKLFWVDA------------DLKRIESSDLSGANRIVLQDSNILQPVG-----LTVLGDHLYWIDKQQQMIERVDKLTGEKRTRIQG----RLQYL-----TGIHAVQYMETDEFAT---------HPCSR-----DNGGCSHICIA-----------------KGDGTPRCSCPMHLVLLQN------LLSCGEPPTCSSEQFTCATGEI----------DCIPMAWRCDGIAECADNSDEMNCPICSKLQ-FQCDKGQ-CVDIQVRCNGEPDCADGSDEQDCETICLSNQFRCGN----SQCILKKQQCDSFPDCTDESDERFCDFPPPPNDLPRHTSTIGPVIGIIL 1396          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Zebrafish
Match: lrp5 (low density lipoprotein receptor-related protein 5 [Source:ZFIN;Acc:ZDB-GENE-050518-2])

HSP 1 Score: 219.164 bits (557), Expect = 9.312e-57
Identity = 321/1437 (22.34%), Postives = 561/1437 (39.04%), Query Frame = 3
Query:  537 LDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPCMNR--VCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCN----RNNRNRALSTLDPATVINL 4781
            +DGS+R++I +  ++  + L ID   + L+W   D +   IHR +  G T     V+G+     P  LT  +  L + + +   + +    +G       N   +P  I ++ ++ Q  +     ++PC  R   CS +C L  +   Y C+C TG+    +   C     + L +     +  +SLD      + L   +        YD V   + + D    +I    ++  G+  +  +   I+   P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  + +D IN Y++ T   +    IER  LDGT +  V+ +T+  WP GLA+D    +LY+ D  K D I V    G+ R  IL  K       +    +IYWT+ +  SI  V    S R ++ +        +  +  ++    +  + C   +  C  LCF         SC C     +L ++  C      +++ N++ + +  L  N++   I L   +   + ++L  D   N+IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   + R     + +AH+DGS  + +   V   + L +D     + W   D+  I   E  N +  + ++  D L      +    +IY        +   ++  +  +D  S + R  +      GH        +V   +   + +   A           C  +N      C+  CL   S  +C C S Y+L A+G  C   S  L+    +     I   +L E+  ++     V  + + I+        VYW+     +R       S  D T+   ++        Q HD                        L++DP S T+ W+   T  I   R++        +G ++  ++   +P  I +      + + +     ++           IE + LDG  R  L     I P  L +D   G+++W+D             D  +I +  + G N  V  DS +   VG     + VL  +L+W D  QQ+   +   +  K +   G     LQYL     T +  +  +  ++F +         HPCSR     +N  CSH+C++                 + DG  RCSCP+ + +              +   C   Q  C  G +           C+ +  RCD   +C D SDE+ C  C+    + C +   C+ I  RC+G  DC   SDEQ     C S +F C +    ++C+    +C+   DC D SDE  C+     N+  R  ST+ P   I L
Sbjct:    1 MDGSNRQIIVQKQIYWPNGLTIDLDEQKLYW--ADAKLSFIHRANLDG-TSREAVVEGSLTH--PFALTLYDETLYWTDWQTRSIHACNKHSGEKHREILNGIYSPMDIQVLGQERQPNI-----QTPCSERNGGCSHLCLLSPIPPFYSCACPTGVKLKEDGKTCRPGAEQVLLLARRTDLRRISLDLPDFTDIVLQVNDIRHAIAIDYDPVEGYVYWTDDELRAIRRARID--GSDAQTLITNEINH--PDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----RVLIS------------ENLDEPRAIVLDPINGYMYWTDWGE-LPKIERANLDGTDRV-VLLNTSLGWPNGLAIDYIAGKLYWGD-AKTDKIEVINVDGTNRMTILEDKLPHIFGFTLLGEYIYWTDWQRRSIERVHIANSTREVIVE----QLPDLMGLKATKVMEAEGTNGCAENNGGCSHLCF---HRPQGLSCACPMGLELLSDLRTCVVPEAFLLFTNRADIRSISLGTNSNDVPIPLTGVK---EASALDFDVLENRIYWTDVSTKTISRAFMNGSSVEPVIEFGL--DYPEGMAVDWMGRNLYWADTGT--NRIEVARL-----DGQYRQVLVCKDLDNP--RSLALDPANGYMYWTEWGGRPR-----IARAHMDGSNIVTLVDKVGRANGLTIDYIDQRLYWTDLDTCMI---ESTNMQGLQREIVADDLPHPFGLTQYRDYIY--------WTDWNLRSIERADKRSGLNRTVVQ-----GH------LEYVMDILVFHSSRQDGAND---------CSQNNGQ----CAHLCLASPSGAQCRCASHYTLEANGRNCSSPSSFLLFSQKS----SISRMVLGEQSPDMILPIHVMKNLRAISF-DPLERLVYWVDGRQNIRR------SRDDGTQASTVMTPNSDHPKQPHD------------------------LSLDPYSRTVYWTCETTNTINIHRMDG-----HIIGEVL--KDDVDKPRAIVVNAEKGYMYFTTVQERSAK-----------IEGASLDGTERESLFTTSLIRPVALALDNKLGKLFWVDA------------DLKRIESSDLSGANRIVLQDSNILQPVG-----LTVLGDHLYWIDKQQQMIERVDKLTGEKRTRIQG----RLQYL-----TGIHAVQYMETDEFAT---------HPCSR-----DNGGCSHICIA-----------------KGDGTPRCSCPMHLVLLQN------LLSCGEPPTCSSEQFTCATGEI----------DCIPMAWRCDGIAECADNSDEMNCPICSKLQ-FQCDKGQ-CVDIQVRCNGEPDCADGSDEQDCETICLSNQFRCGN----SQCILKKQQCDSFPDCTDESDERFCDFPPPPNDLPRHTSTIGPVIGIIL 1211          

HSP 2 Score: 127.102 bits (318), Expect = 1.419e-28
Identity = 164/714 (22.97%), Postives = 292/714 (40.90%), Query Frame = 3
Query:  102 KSILHRHGVDIFFNTDLKLLAADV-------FLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGT-----WKQWSPTFLTFTE-GKLVFINDEQLWVSSFECGTGISIALKTNPNIA---PIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAAN 2186
            ++ L R  +D+   TD+ L   D+       +   + YV+   +     L+    +++D    + ++   +   + +AVDWV+ NLYW D     IEV  LN  S        RR+L+S N+ +  ++V+DP   Y++W   G +  +ER+ LDG+DR V+  + L   + LAID     L+W   D +  +++        + V GT      +   P    FT  G+ ++  D Q    S E    + IA  T   I    P  +  +  ++M   G       N  CS +C         C+C  G+ E +++      P   L   N   I  +SL      +  PL  + E + + F    D + + + + D ++ +I    +N  G+     ++F +  D P  +AVD   RN+YW +   + + VAR+      +Y  +L+             +    P  LA+D  N Y++ T    G   I R  +DG+   T++         GL +D   Q+LY+ D     + S N  G  + I+A        L+ + ++IYWT+    SI        +   V +        + V   SR    D  + C   + +C  LC     +     C C++   +  N   CS  S  +++  KS +    L   +    + +   ++   + ++  D     +YW++   N
Sbjct:  169 RTDLRRISLDLPDFTDIVLQVNDIRHAIAIDYDPVEGYVYWTDDE----LRAIRRARIDGSDAQTLITNEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS--------RRVLISENLDEPRAIVLDPINGYMYWTDWGELPKIERANLDGTDRVVLLNTSLGWPNGLAIDYIAGKLYWG--DAKTDKIEV-------INVDGTNRMTILEDKLPHIFGFTLLGEYIYWTDWQR--RSIE---RVHIANSTREVIVEQLPDLMGLKATKVMEAEGTNGCAENNGGCSHLCF-HRPQGLSCACPMGL-ELLSDLRTCVVPEAFLLFTNRADIRSISLGTNSNDVPIPLTGVKEASALDF----DVLENRIYWTDVSTKTISRAFMN--GSSVEPVIEFGL--DYPEGMAVDWMGRNLYWADTGTNRIEVARLDG----QYRQVLVC------------KDLDNPRSLALDPANGYMYWTEWG-GRPRIARAHMDGSNIVTLVDKVGRA--NGLTIDYIDQRLYWTDLDTCMIESTNMQGLQREIVADDLPHPFGLTQYRDYIYWTDWNLRSIERADKRSGLNRTVVQGHLEYVMDILVFHSSRQ---DGANDCSQNNGQCAHLCL---ASPSGAQCRCASHYTLEANGRNCSSPSSFLLFSQKSSISRMVLGEQSPDMILPIHVMKN---LRAISFDPLERLVYWVDGRQN 818          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Zebrafish
Match: lrp1ba (low density lipoprotein receptor-related protein 1Ba [Source:ZFIN;Acc:ZDB-GENE-050208-608])

HSP 1 Score: 154.836 bits (390), Expect = 8.480e-37
Identity = 333/1521 (21.89%), Postives = 579/1521 (38.07%), Query Frame = 3
Query:  276 VLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKS--SQLAIDRHRKMLFWWGLDGE-IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFIN--DEQLWVSSFECGTGISIALKTNPNIAPIAII--SRKHQLMVP---RGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGG-LQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSE--VWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRI---LAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDG-SMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHY--RNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFC--LPVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIV-LRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVG--CNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDE-----QCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNN 4733
            V++  + + E +AVDW++GNLYW D     IEV  LN +         R  L++  M    ++ VDP +  LFW    A    +E + + G  R V+ K +   +  + L +D     + W     + I+   Y G TG    ++G      P  ++   G + + +     L  ++   G  +++  KT+     + I   SR+ Q + P    G R        CS +CL   + +  CSC   +    NN+ C     R L      +I  + +D   L   + L   +        YD+V   + + D  S +I    +N  GT  +  L   +S+     +A+D  SRN+YWM+  N E  + VAR+                   + K +       P  L +      +F     DG  +I    +DG+     I   N   P GL++D    +LY++ +  G +   N  G    +   +  + ++  +L+     ++W +     + +V K DG ++  L  KT  L       I V    +    +PC   +  C Q+C P   ++ + +C C+   ++  + S C      ++Y     +    L P+ + + +    G     + ++ LD++   + +YW +  +N I +++ +   +  +    L    +  LAVD+I  N+Y       W+   +  +     +  +  VV+S ++      A++VH    FLFW E           + ++ LDGS Q +L+  G+A  + + +D Q N + W  + + KI R  +   +  E   S   +   S +              YLF +D  Y      ++ SI R       +V           +   +++S K + +   D   +    C   N      C Q C  L    + C C   Y L+ DG  C+     L+    T     +R   L++++D             PI A   + + VY+  KNI+ L  D+       +R   +     Y  + V   D       +EN+         S   LA     D L W+   T  I    ++  +        +++  E    P  + +    + + W + +    E + S       I  S L G    ++V    I P+ LT+D  + ++Y+ D         HI   ++     +VI           + +G G +   + + + ++FW+DW ++      + SD    A       N + L+  +    + M  IA  +  +S      +  PCS     + N  C  LCL T P+                G   CSC     +   +R     CV          +  CG G             C+  Q  CD    C D SDE    C   N  H +    +  C+   + C+GV DC  +SDE       C S +  C  G     C+P S+ CN I+DC D SDE  CN  +
Sbjct: 1204 VVQHGLATPEGLAVDWIAGNLYWIDSNLDQIEVSKLNGE--------LRTTLIAGGMEHPRAIAVDPGQGALFWTDWDATFPRIEGASMSGKQRHVVFKDMDTGAWPNGLTLDHMESRIIWTDARSDAIYSALYDG-TGVIEILRGHEFLSHPFAVSLFGGNVYWTDWRTNTLTKANKWTGANVTVIQKTSAQPFDLEIYHPSRQPQTVSPCAGNGGRGH------CSHLCLLNYNGSASCSCPHLMKLSANNSTCQGV-KRFLLYARRSEIRGVDIDNPYLNVIMALTVPDIDDVTSMDYDAVEERIYWADVKSRTIKRAFIN--GTQLQTVLSGDLSN--VRGLAIDWLSRNMYWMSSDNDETHINVARLDG-----------------SLKTTVVHGMDKPKSLVLHPSKGKMF---WMDGG-TINMANMDGSN--IKILHQNQKEPVGLSIDFSSNKLYWISSGNGTINRCNLDGSGLDVIDSMKSQLRKATALAVMGGKLWWADDVLAQLGTVNKRDGKNLTVLRNKTTGL-----VHIKVYDKDTQKGRNPCVLNNGGCSQICLPT--SEITRTCSCTTGYNLRQDRSTCEGLQSFLMYSVNEGIRGLSLDPSDNSEVLTPLSG----TLFAVGLDYHAKNDTLYWTDMGSNKISRSSRDQTWREDIITSGLGR--VEGLAVDWIAGNIY-------WADHGLNLIEVARLNGMYRAVVISEELDQPR--AIAVHPVKGFLFWTEWGQS-----PTISRSRLDGSEQSVLVSTGLARPNGVSIDYQENKLYWCDARNNKIERINLERGEQREIVFSSSGVDMFSIAVF----------GAYLFWSDRAY------ANGSIRRASKKDAVDV---------VTIRSGLSVSLKDVKVFNQDR-EKGTNACSKSNG----GCQQLCFYLGNNRKTCACAHGY-LAQDGLRCIRYEGYLLYSERT----VLRTIHLSDEND----------LNSPIRA---YENPVYF--KNIIALAFDHRQNAHGTNRI--FFSDVHYGNIQVINDDWTGRRIIAENV--------GSVEGLAYHRGWDVLYWTSSTTASITRHHIDQSRTNAFDRDTVVSLSE-EDHPHVLTLDECQNLMFWTNWN----EQHPS-------IMRSTLTGRNIRIIVSTDVITPNGLTIDHKAEKLYFSDGSLG-----HIERCDFDGSQRYVI-----------VKSGPG-TFFGLAIYRDFIFWSDWTRRAV----IRSDKFTGA-------NTKVLRSDIPH--QPMGIIAVSNDTNS-----CEASPCS-----VNNGGCHDLCLLT-PL----------------GVVNCSCRGERILLDDNR-----CVSPNSSCNIHSEFQCGNG------------ECIDYQLTCDGIAHCKDRSDEKMQYCENRNCRHGFKSCYNQRCVSNQRFCNGVNDCGDNSDEVYCNNSSCLSSEHRCADGS----CIPTSSWCNQIIDCADASDEKSCNNTD 2504          

HSP 2 Score: 137.887 bits (346), Expect = 9.074e-32
Identity = 219/971 (22.55%), Postives = 371/971 (38.21%), Query Frame = 3
Query: 1152 TSSLLY-VDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTN-DFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFIS----LSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNK--CDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIE--LGKGESDVQ-VASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSD--TISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVE--SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSA 4013
            + SLLY  D     I+   L++ G      +        P  +AVD  + N+YW++    ++ V++++   R    TL+      P               +AVD     LF T        IE   + G Q+  V    +   WP GL LD    ++ + D  + D I    + G+  I   +  EF+S    +S F   +YWT+  T ++    K+ G+  +++ KT +     + +   SR     T SPC     +  C  LC  +     S SC C +   +  N S C      ++Y  +S +       + D  Y+   +     D+  V S+  D    +IYW +  +  I +   N     QL+   LS D   +  LA+D++  N+Y   + +  + I + RL     D S    VV    K K L    +H     +FW +  T        +  A++DGS   ++ +   +   L +D  +N + W SS +G I R  +              L K ++ +     ++        +  D + Q+   +       K LT + N              ++  +   K+    +  G    +L       N   CSQ CLP    +R C C + Y+L  D +TC  L   LM   N     GIRG  L+  D+             P+ +G  F   + + +KN  L   + G       +R                    D ++ E++      +      LA+D I+  + W+D    +I   RLN       Y  V+I+  E   +P  IA+ P+   L W   ++ +S T          I  S LDG+ +SVLV      P+ +++D    ++YW D + NK+  +++             G   ++   S      G    S+ V   YLFW+D   + +A+ S+    K  A
Sbjct: 1173 SQSLLYWTDVVEDKIYRGKLSEGGGVSAIEVVVQHGLATPEGLAVDWIAGNLYWIDSNLDQIEVSKLNGELR---TTLIAGGMEHPRA-------------IAVDPGQGALFWTDWDATFPRIEGASMSGKQRHVVFKDMDTGAWPNGLTLDHMESRIIWTD-ARSDAIYSALYDGTGVIEILRGHEFLSHPFAVSLFGGNVYWTDWRTNTLTKANKWTGANVTVIQKT-SAQPFDLEIYHPSRQPQ--TVSPCAGNGGRGHCSHLC--LLNYNGSASCSCPHLMKLSANNSTCQGVKRFLLYARRSEI----RGVDIDNPYLNVIMALTVPDIDDVTSMDYDAVEERIYWADVKSRTIKRAFING---TQLQTV-LSGDLSNVRGLAIDWLSRNMYWMSSDNDETHINVARL-----DGSLKTTVVHGMDKPKSL---VLHPSKGKMFWMDGGT--------INMANMDGSNIKILHQNQKEPVGLSIDFSSNKLYWISSGNGTINRCNLDGSGLDVIDSMKSQLRKATALAVMGGKLW--------WADDVLAQLGTVNKRDG---KNLTVLRN--------------KTTGLVHIKVYDKDTQKGRNPCVL-------NNGGCSQICLPTSEITRTCSCTTGYNLRQDRSTCEGLQSFLMYSVNE----GIRGLSLDPSDNSEVLT--------PL-SGTLFAVGLDYHAKNDTLYWTDMGSNKISRSSR--------------------DQTWREDIITSGLGR---VEGLAVDWIAGNIYWADHGLNLIEVARLNG-----MYRAVVIS--EELDQPRAIAVHPVKGFLFW--TEWGQSPT----------ISRSRLDGSEQSVLVSTGLARPNGVSIDYQENKLYWCDARNNKIERINLE-----------RGEQREIVFSS-----SGVDMFSIAVFGAYLFWSD---RAYANGSIRRASKKDA 1991          

HSP 3 Score: 125.946 bits (315), Expect = 4.572e-28
Identity = 152/677 (22.45%), Postives = 288/677 (42.54%), Query Frame = 3
Query:  123 GVDI---FFNTDLKLLAADVFLSRKLYVFVIQEN---GKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGL-DGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFIND--EQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFA--YDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPV-SIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMR--------SLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTD 2081
            GVDI   + N  + L   D+     +    ++E         +T   + ++  +++ VL   + +   +A+DW+S N+YW    N    +    +D          +  +   M    SLV+ P +  +FW+  G I +   + +DGS+ +++H++   +   L+ID     L+W    +G I+R +  G +G  +      +    T L    GKL + +D   QL   +   G  +++       +  I +  +  Q    +GR  +PC+  N  CS ICLP  +    CSC+TG     + + C    +  ++  N   I  +SLD       E+L+  +G  F     Y +   +L + D  S+ I     ++    Q +  D   S    V  +AVD  + NIYW +H  + + VAR++      Y  +++S            ++   P  +AV  +  +LF T       +I R  LDG+++ +V+ ST    P G+++D    +LY+ D     +  +N   G +R  + +    +  S++ F  +++W++           +GS+R         +VT    L      V   +++    T + C  ++  C QLCF +  N+ + +C      ++  +  RC      ++Y  +++L T HL+   D
Sbjct: 1461 GVDIDNPYLNVIMALTVPDIDDVTSMDYDAVEERIYWADVKSRTIKRAFINGTQLQTVLSGDLSNVRGLAIDWLSRNMYWMSSDNDETHINVARLDGSL-------KTTVVHGMDKPKSLVLHPSKGKMFWMDGGTINM---ANMDGSNIKILHQN-QKEPVGLSIDFSSNKLYWISSGNGTINRCNLDG-SGLDVIDSMKSQLRKATALAVMGGKLWWADDVLAQLGTVNKRDGKNLTVLRNKTTGLVHIKVYDKDTQ----KGR--NPCVLNNGGCSQICLPTSEITRTCSCTTGYNLRQDRSTCEGLQSFLMYSVN-EGIRGLSLDPSDNS--EVLTPLSGTLFAVGLDYHAKNDTLYWTDMGSNKI-----SRSSRDQTWREDIITSGLGRVEGLAVDWIAGNIYWADHGLNLIEVARLNGM----YRAVVIS------------EELDQPRAIAVHPVKGFLFWTEWGQSP-TISRSRLDGSEQ-SVLVSTGLARPNGVSIDYQENKLYWCDARNNKIERINLERGEQREIVFSSSGVDMFSIAVFGAYLFWSD-------RAYANGSIRRASKKDAVDVVTIRSGLSVSLKDVKVFNQDREKGTNA-CSKSNGGCQQLCFYLGNNRKTCACA---HGYLAQDGLRCIRYEGYLLYSERTVLRTIHLSDEND 2082          

HSP 4 Score: 105.145 bits (261), Expect = 9.197e-22
Identity = 142/568 (25.00%), Postives = 238/568 (41.90%), Query Frame = 3
Query:  192 YVFVIQENGKSLLKTANFSKLDRRKMRDVLKFP--VQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWG--LDGEIHRVDYQGQTGCSMRVQGTWKQWSPTF-LTFTEGKLVFINDEQLWVSSFECGTGISIA-LKTNPNIAPIAIIS----RKHQLMV-PRGRRKSPCMNRVCSSICLPIVDSAYR-CSCSTGITEPINNAVCPTFPTRSLFI----GNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKY-GTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVT-----VITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEF---ISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTR 1820
            ++ V+Q+ G+  L  A  +KL     +  ++    +Q+ E +A+DW++GN Y+ D+ N  I V     D+           ++  ++ +   L +DP    LF+   G +  +ER  +DG++R  I +    + + + +D  +K+++W    LD  I  VDY G+   ++ VQG     S  F L   E  L     +   ++ F      +IA L++  N+     ++    R H     P GR+        CS ICL   +   R C C TG     +   C   P   LF+    G P  I    LD  ++   E L +  G+    A D    S  YV F  ++ F +   K  GT +   L   +  D    I+VD    N+YW N    +     ++  +R           PS T +         P  + VD +N +++ T      + D    IE+ W+DG+ +   ++S N  WP GL LD     +Y+ D    D I   Y  GS R +    +E      ++++ N+I+WT+    SI  +       SL+   R
Sbjct:  135 WLSVVQDTGQ--LWCARMTKLKGFSEKHQIRIGQNLQNVEHMAIDWLTGNFYFVDRVNDRIFVCSEQGDT--------CVTIIDLDIQNPKGLALDPIMGKLFFTDYGTVAKVERCNMDGTNRTKIVEYKTEQPTAVTLDLVKKLVYWSDAYLD-FIEVVDYNGKNRQTI-VQG--NSVSHLFGLALFEDYLFATKVDIFRINRFNSSDTNTIATLESARNVRVYHRLAQPTVRTHACSPDPHGRKGG------CSHICLLSHNYKSRVCRCRTGHVLASDGKSCKK-PKNELFLFYGKGRPGVI--RGLDMNIKSGDEHLIQIEGLVSPRALDFHAES-GYVYFADTTSFLIGRQKIDGTARETILKEEL--DNVEGISVDWIGNNLYWTNDGYRK--TINVAGLDR-----------PSHTRRTLLEGNMSHPRAIVVDPLNGWMYWTDWEEDELIDSRGRIEKAWMDGSHRQIFVTS-NMLWPNGLTLDHSSSVMYWCDAYY-DHIEKIYLNGSHRTVVYSGKELNHPFGIAHYQNYIFWTDYMNASIFRLDLLSDDVSLLRAER 661          

HSP 5 Score: 81.6481 bits (200), Expect = 1.207e-14
Identity = 108/446 (24.22%), Postives = 169/446 (37.89%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDE-VGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQKFECLSGK----DVTRCLPISARCNGIVDCRDGSDEHGCNRN 4730
            +LA+D I   L W D        ER   +  +   L   +  R   R P  +A+  ++  + W+                Q  I    +DG++  V++      PS LT+D  + RIYW D         HI + N      H      KV +  +   GV    + + + + +++W+D   +  +     S  K +  +     + Q ++D     +++   +   D         +  H C     ++ N  CSHLCL +                   G ++C+CP    + + +        K+ L  C   Q  CG               C+    +CD+  DC DGSDE   C    C     + C      LP    CDG  DC  +SDE  C S  + CLSG+       +C+PI+ RCNG  DC DG DE  C  N
Sbjct: 2966 ALAVDWIGKNLYWCD-------GERKTLEVAKANGLYPTVLLRTGLRNPTALALDTLTGYVFWIDC------------CEQPQIGRIGMDGSKPRVIIDTEIRSPSALTIDHVNKRIYWADEN-------HILFANIDGTKRH------KVPIQDI--GGV----TGLTLFEDFIYWSDQKSKTLSRSHKTSGGKQTELLS----SWQTIRD-----IQVYHPLRQPD---------VPKHQC-----QVTNGGCSHLCLLSP-----------------GGGYKCACPTHFYLANDN--------KTCLSNCTASQFRCGTD------------ECIPFWWKCDTVDDCGDGSDEPADCPEFKCQPGR-FQCGTGLCALPPFI-CDGENDCGDNSDEANCDS--YICLSGQFKCTHRQKCIPINLRCNGQDDCGDGEDETDCPEN 3309          

HSP 6 Score: 69.3218 bits (168), Expect = 5.880e-11
Identity = 46/112 (41.07%), Postives = 60/112 (53.57%), Query Frame = 3
Query: 4410 GMSVMSCMSVQQRCDSTVDCLDGSDEVGC-NTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNR 4736
            G +   C+SV+  CDS  DC DGSDEVGC + C+++  + CS S  C+P    CDG  DC   SDE    S+  +    +    C+P   RC+G  DC DGSDE  C    R
Sbjct:  859 GCTNGKCISVKWHCDSEDDCGDGSDEVGCVHACSVAQ-FQCS-SGKCIPEHWMCDGDNDCGDLSDENATCSRTGKEFHCRGDGTCIPEIWRCDGDKDCEDGSDEFACEGAKR 968          

HSP 7 Score: 64.3142 bits (155), Expect = 1.870e-9
Identity = 82/334 (24.55%), Postives = 135/334 (40.42%), Query Frame = 3
Query:   72 FLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFW--------WGLDG-EIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQ---LWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLF 1037
             + A +H + K  L      +       +++ D F SRK  ++ I +  +   +  N  +L+   ++ V +  V SA  +AVDW+  NLYW D + + +EV   N    +P    R        + +  +L +D    Y+FW+       + R  +DGS  RVI  + +   S L ID   K ++W          +DG + H+V  Q   G              T LT  E   ++ +D++   L  S    G   +  L +   I  I +     Q  VP  + +    N  CS +CL      Y+C+C T      +N  C +  T S F
Sbjct: 2892 LILADHHEIRKISLDGSNYTLLKQGLSNVISLD-FDSRKELIYWI-DTSRPSGRRINRMRLNGSDLKVVHRTSVPSA--LAVDWIGKNLYWCDGERKTLEVAKAN--GLYPTVLLRT------GLRNPTALALDTLTGYVFWIDCCEQPQIGRIGMDGSKPRVIIDTEIRSPSALTIDHVNKRIYWADENHILFANIDGTKRHKVPIQDIGG-------------VTGLTLFE-DFIYWSDQKSKTLSRSHKTSGGKQTELLSSWQTIRDIQVYHPLRQPDVP--KHQCQVTNGGCSHLCLLSPGGGYKCACPTHFYLANDNKTCLSNCTASQF 3197          

HSP 8 Score: 63.5438 bits (153), Expect = 3.786e-9
Identity = 98/479 (20.46%), Postives = 189/479 (39.46%), Query Frame = 3
Query:  918 VCSSICLPIVDSAYRCSCSTGITEPINNAVC-----PTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKY-GTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCS-IERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ--KFQEFISLSYFDNFIYWTELETLSIHSVKFDGS-MRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSY--SSEMIVYFNKSML-ITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMK-----TASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLY 2300
             CS IC+     +YRC+C+ G +   N   C     P      L   N   I  + L+G   P L+ +  N      F Y   +   L V  ++  ++   + K  G  ++  +    +      +A+D  + N Y+++  N  ++V        +    L +                Q P  LA+D I   LF T    GT + +ER  +DGT +  ++    +  P  + LD  ++ +Y+ D     +  V+Y+G +++ + Q         L+ F+++++ T+++   I+  +F+ S   ++ T     + R    +A     +       +     C  +C  +  N  S  C C    HVL +  +      +E+ +++ K    +   L  N       L + E  V   +L        +Y+ +  +  I +     TA  T ++ +L       D +  ++VD+I NNLY
Sbjct:   50 TCSQICMN-TQGSYRCACTDGFSLQANRRSCKAKTDPGDKPPVLLTTNLNFISVLYLNGSTMPNLKSMETNGTQMLDFIYREESLCWLSVVQDTGQLWCARMTKLKGFSEKHQIRIGQNLQNVEHMAIDWLTGNFYFVDRVNDRIFVCSEQGDTCVTIIDLDI----------------QNPKGLALDPIMGKLFFTDY--GTVAKVERCNMDGTNRTKIVEYKTE-QPTAVTLDLVKKLVYWSDAYLDFIEVVDYNGKNRQTIVQGNSVSHLFGLALFEDYLFATKVDIFRIN--RFNSSDTNTIATLESARNVRVYHRLAQPTVRTHACSPDPHGRKGGCSHICL-LSHNYKSRVCRCRT-GHVLASDGKSCKKPKNELFLFYGKGRPGVIRGLDMNIKSGDEHLIQIEGLVSPRALDFHAESGYVYFADTTSFLIGRQKIDGTARETILKEEL-------DNVEGISVDWIGNNLY 497          

HSP 9 Score: 63.1586 bits (152), Expect = 4.632e-9
Identity = 83/357 (23.25%), Postives = 142/357 (39.78%), Query Frame = 3
Query:  921 CSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNP-------PKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSK-RILAQKFQEFISLSYFDNFIYWTEL--ETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSC 1961
            CS  C+    S + C C+ G   P +N    T   RSL    P        +I  +SLDG       LL +         +DS    + ++D +  S   ++  +        L     + +P ++AVD   +N+YW +     + VA+ +      Y T+LL           R     P   LA+D++  Y+F     +    I R  +DG+ K  VI  T    P  L +D   +++Y+ D  +  ++  N  G  + ++  Q       L+ F++FIYW++   +TLS       G    L++  + +  R + V    R   +     C  T+  C  LC    G  +  +C
Sbjct: 2853 CSQQCVNTYGS-FHCLCADGYQRPASN----THSCRSLSAEQPFLILADHHEIRKISLDGS---NYTLLKQGLSNVISLDFDSRKELIYWIDTSRPSGRRINRMRLNGSD---LKVVHRTSVPSALAVDWIGKNLYWCDGERKTLEVAKANGL----YPTVLL-----------RTGLRNPTA-LALDTLTGYVFWIDCCEQP-QIGRIGMDGS-KPRVIIDTEIRSPSALTIDHVNKRIYWAD--ENHILFANIDGTKRHKVPIQDIGGVTGLTLFEDFIYWSDQKSKTLSRSHKTSGGKQTELLSSWQTI--RDIQVYHPLRQPDVPK-HQCQVTNGGCSHLCLLSPGGGYKCAC 3175          

HSP 10 Score: 59.6918 bits (143), Expect = 5.751e-8
Identity = 41/107 (38.32%), Postives = 51/107 (47.66%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCLDGSDEVGCN----TCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQ-----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            +C+    RCD   DC DGSDE  C      C+    ++C  S  C+     CDG +DC+  SDE+      C   KF C    D + CLP    CNG  DC D SDE
Sbjct:  940 TCIPEIWRCDGDKDCEDGSDEFACEGAKRMCDPKAKFTCKVSGKCVSKDWVCDGDIDCEDQSDEEGCEVSVCKPPKFPC--ANDTSVCLPPERICNGWKDCADHSDE 1044          

HSP 11 Score: 56.6102 bits (135), Expect = 4.278e-7
Identity = 46/181 (25.41%), Postives = 83/181 (45.86%), Query Frame = 3
Query:  123 GVDIFFNT-DLKLLAADVFLSRKLYVFVIQENGKSLLKTANF----SKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWA-DQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQ------IGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFW 629
            G+D+   + D  L+  +  +S +   F  +        T +F     K+D      +LK  + + E ++VDW+  NLYW  D   + I V  L+  S        RR LL  NM+   ++VVDP   +++W        I +   +E++ +DGS R++   S +   + L +D    +++W
Sbjct:  420 GLDMNIKSGDEHLIQIEGLVSPRALDFHAESGYVYFADTTSFLIGRQKIDGTARETILKEELDNVEGISVDWIGNNLYWTNDGYRKTINVAGLDRPS------HTRRTLLEGNMSHPRAIVVDPLNGWMYWTDWEEDELIDSRGRIEKAWMDGSHRQIFVTSNMLWPNGLTLDHSSSVMYW 594          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Zebrafish
Match: lrp2b (low density lipoprotein receptor-related protein 2b [Source:ZFIN;Acc:ZDB-GENE-111115-1])

HSP 1 Score: 140.969 bits (354), Expect = 1.360e-32
Identity = 332/1583 (20.97%), Postives = 576/1583 (36.39%), Query Frame = 3
Query:  270 RDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQ--YLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNP----NIAPIAIISRKHQLM-------VPRGRRKSPCMNRVCSSICL--PIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKF--TVISSTND----FWPRGLALDEYRQQLYFVD-------------------TVK----GDMISVNY-------------------------HGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCS-YSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKT--ASNTDIQRQLKIFC-LSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRY--EIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHN-HDNFLTCSQFCLPVESRE---CGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSR--YSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRR-SVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDV------CLPITKRCDGVMDC--DSDEQCC------GSQKFECLSGKDVTRCLPISARCNGIVDCRDG--SDEHGC 4721
            + V    +   ES+AVDWV  N+YW D   Q IEV  L  D  F      R+IL+++N+     LV+DP      +FW   G    +E++ +DG  RR I  S ++  + L +D   + +++  +D  +  +DY     C    +   + ++   +      +    D   W  S+      S  ++TN     NI    +++  +Q M       + +    +PC N  CS +CL   +    YRC C +G     +   C    T  L +     I  + L+     P +  S NA  P                              G  Q   +DF            D   + +YW+    + ++ ++    NR ++A   +   PS                LA D I R ++ T  T    +IE   +DG+Q +  T+I++T        P G+ALD  R +L++ D                    VK    G+++ V +                          G S+  +         ++ + N++Y+T+L+   I  V  +     +V ++     R++ V A  R+ S  T + C + +  C  LC P    Q +  C C+       + S C  Y S  IV  +K +   H  + +  +  + +G     + +  L +      +YW + +     +    + TD  R   +   L +  I  LAVD+I  NLY +   +  + I ++RL     + S   +++ +        AVS    L+ LFW      D     ++  A LDG+ + +L    ++    L +D   +++ W       I R   +   R+   F                    YP   S+ +F    ++             ++L  +       G      V R        +A+  S +   S  L   +  HD+   C QFC  +  ++   C C    SL ++G +C    D  ++ T    +  +R   L+ +D  + F  +  +    +     F D   + ++ + L     G+I     T P V I         + D     +Y     + +F+  ++R   S+ ID  + +L+               A  DR                P  I + P    L W   D+               IE + L GN R  V+  +   P+ L++D     +YW D+  +K            I    + G N +V    L      F+   + V ++ ++WTDW  +I    S +      + + +   +LQY  + +              F +S   +   + PC     ++ N  CSH+C+   P     E               C CP + +    +  K   C+     +C   Q  C  G             C+S   +CD   DCLDGSDE+      +   ++CS ++       C+P+   CD   DC  +SDE  C       S +F C +G    RC+  +  C+GI DCRD   +DE  C
Sbjct: 1495 KQVFSSGLMVPESIAVDWVGRNIYWTDSVMQNIEVATL--DGHF------RKILITKNVTSPRGLVLDPRNHTNLMFWSDWGQNPRIEQASMDGLGRRAIVTSKVYWPNGLTLDYTTRRVYF--VDAYLKYIDY-----CDYDGKNRHQVFASDIVLQQPHGITIFEDNIFWSDSY-----TSQIMRTNKFHGGNIT--TLLTGVYQCMGIVMDHPIKQPIAFNPCENNPCSQLCLLSTLRPRYYRCDCQSGWILASDGRTCTKDETPFLMVVRDTVIMGIPLN-----PNDT-SNNAMAPIS----------------------------GITQGRDIDF------------DDREQFVYWVQGTGA-IYRSKTDGANRTQFAPAAIIGSPS---------------GLAFDWITRIMYYTNPT--IKAIEVIRVDGSQHYRKTIITNTGKPEGAGQPIGIALDPARGKLFWTDRGSDSGVPPKISSADMDGGNVKNLYTGNLVKVEFIAADIEARKIYWGVHQTGMIECGTMDGASRVTIVSGLSHPWGITVYQNYLYYTDLDFEVIERVDKNTGADMVVMRSSMAGLRSVKVHA--RDNSAGTTNACSTNNGGCPHLCLPKPQGQKT--CACTTGFIPSQDGSHCEQYDSYAIVSSSKFIRGFHINSSDHSEAMVPVGANTYSI-IDKLDMHIASGFLYWTDNSTYSSYRGIYRTKTDGSRYSTVISQLGNGRIQGLAVDWIAGNLYFTNKFTTQTYIEVLRL-----NTSIQLILLKSSADRPQDLAVS--PKLRLLFW-----TDAGQSPKIESALLDGTNRTVLASESLSSPRGLTIDYTNDFLYWVDDTLDMISRMAPDGSQREIVRFGSR-----------------YPAPYSVAIFGEYMLW-----------VDRKLGKLFQASKVPGNTDTPEVIRDGIDDLTDVAVFDSHVQPTSANLVGFNPCHDDNGRCQQFCFALPDQQEPKCACAHG-SLLSNGVSCGFGLDEYLIFTTDYSVSSMR---LDPEDHSVPFPTF-NMGYGVLAIEFDFQDKRVFFTQYVGLGRSKIGYIITTSSTSPPVTI-------ASDLDDPEGLAYDWVHKRLYFTDYYNRSVQSMGIDGQNRSLI---------------AHGDR----------------PRAIVVDPCYGYLYW--TDWGSPAK----------IERATLGGNFRIPVINTSLSQPNALSLDYEERLLYWADSTLDK------------IERSSLTGENREVI---LTQTQYPFA---LTVFQQDIYWTDWNTRIVYRASKDD----GSGLTIMATDLQYRPNDIHV------------FSASRQESC--SSPC-----QLFNGGCSHVCV---PGPAGPE---------------CQCPSTGNWYLANEGKD--CIPDNGQRCHADQFTCLDG------------RCLSQNFKCDGYRDCLDGSDELE----RVCAFHTCSPTEFTCDNGGCVPLYYVCDYTNDCGDNSDEHGCPFPTCNPSTEFTCANG----RCISAAYVCDGINDCRDNGTTDEVNC 2810          

HSP 2 Score: 86.6557 bits (213), Expect = 4.054e-16
Identity = 187/899 (20.80%), Postives = 337/899 (37.49%), Query Frame = 3
Query: 1140 YDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDG-TCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSK-RILAQK--FQEFISLSYFDNFIYWTELETLSI-HSVKF-DGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSE--MIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILG---AVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRG-VADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVE--SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNY---GFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWID 3782
            +D+V   + + D +   I+S   N     Q F     +    P SIAVD   RNIYW +     + VA +    R    T  ++                 P  L +D  N    +     G    IE+  +DG  +  +++S   +WP GL LD   +++YFVD     +   +Y G ++ ++ A     Q+   ++ F++ I+W++  T  I  + KF  G++ +L+T       + M ++           +PC   +N C QLC         + C C +   +L +  R     E   ++    ++++   L PN D     +       Q   +  D     +YW+ Q    I ++ ++   + Q     +   + S LA D+I   +Y   T+     I +IR+  +     +   +++   K +  G    +++      LFW + +  D     ++  A +DG     ++ G +  ++ +  D +A  + W    +G I        +      +  +      S    + +Y N    YL+  D  ++V                I  V  + G       S    + + K+    +  GT +   C T+N      C   CLP     + C C + +  S DG+ C       +V ++      IRG  +N  D     V        P+ A           + +I+ +LD +   GF+   D +        Y+ +    +  KTD S    +     +       LA+D I+  L +++  T     E L     R+     +I  + S  RP  +A++P    L W  A  S              IE + LDG  R+VL       P  LT+D  +  +YW+D
Sbjct: 1467 FDNVNKRVYWGDSSDKMIYSSFQNGTDKKQVFSSGLMV----PESIAVDWVGRNIYWTDSVMQNIEVATLDGHFRKILITKNVT----------------SPRGLVLDPRNHTNLMFWSDWGQNPRIEQASMDGLGRRAIVTSKV-YWPNGLTLDYTTRRVYFVDAYLKYIDYCDYDGKNRHQVFASDIVLQQPHGITIFEDNIFWSDSYTSQIMRTNKFHGGNITTLLTGVY----QCMGIVMDHPIKQPIAFNPC--ENNPCSQLCLLSTLRPRYYRCDCQS-GWILASDGRTCTKDETPFLMVVRDTVIMGIPLNPN-DTSNNAMAPISGITQGRDIDFDDREQFVYWV-QGTGAIYRSKTDGANRTQFAPAAIIG-SPSGLAFDWITRIMY--YTNPTIKAIEVIRVDGSQ---HYRKTIITNTGKPEGAGQPIGIALDPARGKLFWTD-RGSDSGVPPKISSADMDGGNVKNLYTGNLVKVEFIAADIEARKIYWGVHQTGMI--------ECGTMDGASRVTIVSGLSHPWGITVYQN----YLYYTDLDFEV----------------IERVDKNTGADMVVMRSSMAGLRSVKVHARDNSAGTTNA--CSTNNG----GCPHLCLPKPQGQKTCACTTGFIPSQDGSHCEQYDSYAIVSSSK----FIRGFHINSSDHSEAMV--------PVGAN----------TYSIIDKLDMHIASGFLYWTDNS----TYSSYRGI----YRTKTDGSRYSTVISQLGNGRIQ--GLAVDWIAGNLYFTNKFTTQTYIEVL-----RLNTSIQLILLKSSADRPQDLAVSPKLRLLFWTDAGQSPK------------IESALLDGTNRTVLASESLSSPRGLTIDYTNDFLYWVD 2245          

HSP 3 Score: 84.3445 bits (207), Expect = 2.083e-15
Identity = 115/454 (25.33%), Postives = 170/454 (37.44%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLV-----KCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCN----TCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDE-QC-------CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCN 4724
            S+A D  S  L W+      + A ++  D  R + +  +I        P  IA+ P +  L W            S  +    I  +  DG+    L+    G P+ L VD    R+YW+D + +++   H+  D +  +A   IG   ++T              S+ +   +LF +DW          NS  +     G    N+  L+  +  ++ I A        S+ L  L ++       + + N RCSH C  T   S                   C CP  M +    R     CVK          C  Y  PC  G             C+    RCD   DC+D +DEV C     TC+  + ++C     C+P   RCDG  DC   SDE  C       C S +F C +G     C+P +  C+   DC DGSDE  CN
Sbjct:  783 SMAYDWTSKILFWTSSTYRSVCAFKV-TDGSRQDIVKNLI-------YPRGIAVHPSAGYLFW------------SDWYRPAVITRAYTDGSNAVPLINTTLGWPNGLAVDYMMDRLYWVDAQLDRIE--HVSIDGFDRQAFSSIG---QIT-----------HPFSLTIHTDHLFVSDW--------RTNSVFRMRKRDGGD--NIM-LRKGISGIMNIKAY-------SADLQDLFKSR-----CNMIPNGRCSHFCFPTPASSRV-----------------CGCPFGMKLQENQRD----CVKDDSEPPPDDNCGDYAFPCDGG------------RCVPNTYRCDGVNDCVDKTDEVNCTLPGATCS-PYAFTCGNKH-CIPARWRCDGHDDCGDGSDETNCPTRGPTTCSSSQFACTNGN----CIPKTWVCDAFNDCGDGSDERHCN 1138          

HSP 4 Score: 75.485 bits (184), Expect = 9.465e-13
Identity = 141/653 (21.59%), Postives = 256/653 (39.20%), Query Frame = 3
Query:  111 LHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIG---AIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMR--VQGTWKQWSPTFLTFTEGKLVFINDEQLWV---SSFECGTGISIALKTNPNIAPIAIISRKHQLMV--PRGRRKSPCMNRVCSSICLPIVDS-----AYRCSCSTGITEPINNAVCPTFPTRS-LFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFA---YDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLF------VTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ--KFQEFISLSYFDNFIYWTELETLSIHSV-KFDGS----MRSLVTKTRNLDARTMPV--IAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGC 1967
            +H   + +   +D K  A  V  +         +     + + NF   D+ +   VL   V +A++VAVDW++  LY  +++ + IE  D +           R  L++ N+   H L +DP   Y+F+   G     + LER+ +DGS+R  + ++ L   + + +D   K ++W   D   + V+    +G   +  + G  +   P  ++  E    F +  ++ V   + F  G+  +   ++      I +     Q  V  P GR      N  C  ICL    +      YRC C  G     +   C  F  +  L +     +  + L+   Q  + L        F  +   YD+   S+ Y D     I+  ++N  GT  +    + + +    S+A D  S+ ++W +     V   +++  +R      L+                  P  +AV     YLF        VIT       R + DG+    +I++T   WP GLA+D    +LY+VD     +  V+  G  ++  +   +     SL+   + ++ ++  T S+  + K DG     +R  ++   N+ A +  +  +  SR   I  G        +C   CFP   +  S  CGC
Sbjct:  402 IHGRFIRLLVQSDGKGYAVGVGYNWHTQRVFWTDTSSQKVFSINFDGSDKME---VLSEAVHNAQNVAVDWINFKLYLVEERVERIEACDYD--------GGNRVTLIAENLVTPHGLALDPTVGYMFFTDSGDNTDDVKLERAFMDGSNRFDLVRTRLGSPTGITLDLVTKRVYW--TDSHFNLVETVTYSGLDRKTVLNGGHQVPHPFGISVFENHAFFTDWVKMGVIRTNRFN-GSDPTFLYRSTNRPGQIVVSHPALQPFVINPCGRH-----NGGCQQICLLSHRTDNDGLGYRCMCRLGYDLQDDRHSC--FKIKDYLLVAYAQAVRGIPLNVSSQEDVTLPLSGLADTFSGSGVEYDASVESVFYNDRMRQLIYKSNIN--GTSHKVLTGYRVGA--VESMAYDWTSKILFWTSSTYRSVCAFKVTDGSRQDIVKNLIY-----------------PRGIAVHPSAGYLFWSDWYRPAVIT-------RAYTDGSNAVPLINTTLG-WPNGLAVDYMMDRLYWVDAQLDRIEHVSIDGFDRQAFSSIGQITHPFSLTIHTDHLFVSDWRTNSVFRMRKRDGGDNIMLRKGISGIMNIKAYSADLQDLFKSRCNMIPNG--------RCSHFCFPTPAS--SRVCGC 994          

HSP 5 Score: 68.9366 bits (167), Expect = 8.506e-11
Identity = 107/486 (22.02%), Postives = 172/486 (35.39%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIH--WDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVV---LKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHL--CLS-------TLPISLAEEYSFLMTAQQL--------------DGKFRCSCPVSMSVTHKSRH---KIGFCVKSQLVKCDRYQIPCGAGL--------VFSKKEGMSVMS---CMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQK--------FECLSGKDVTRCLPISARCNGIVDCRDGSDEH-GC 4721
             +A+ P +  L WSDW    +         + +  +   + +      P  +A+  +   L W+ A   +             IE   +DG  R        I    ++ +H+  ++  D +TN +  +      DN  +R G  I   M +   S     +  S  +M+       + F T    ++                GM       L++  +  V+  +   P+D    + G      PC          RC  +  C+        TLP +    Y+F    +                DG    +CP     T  S       G C+    V CD +   CG G         + + + G  +     C+     CD   DCLDGSDE  C     ++ ++C+  D C+  + RCDGV DC   SDE  C +++        F+C        C+P    C+G  DC DGSDEH GC
Sbjct:  825 GIAVHPSAGYLFWSDWYRPAVITRAYTDGSNAVPLINTTLGW------PNGLAVDYMMDRLYWVDAQLDR-------------IEHVSIDGFDRQAFSSIGQITHPFSLTIHTDHLFVSDWRTNSVFRMRKRDGGDNIMLRKG--ISGIMNIKAYSADLQDLFKSRCNMIPNGRCSHFCFPTPASSRVCG-----------CPFGMK------LQENQRDCVKDDSEPPPDD----NCGDYA--FPCDGGRCVPNTYRCDGVNDCVDKTDEVNCTLPGATCSPYAFTCGNKHCIPARWRCDGHDDCGDGSDETNCPTRGPTTCSSSQFACTNGNCIPKTWV-CDAFN-DCGDGSDERHCNSSITTCQPGFFLCPDHRCIYNSYVCDGDQDCLDGSDEKDCVYTCGTYEFACASGDQCVSQSYRCDGVYDCKDHSDESGCPTRRPGLCHDNEFQCQVDG---FCIPKEWECDGHPDCVDGSDEHNGC 1261          

HSP 6 Score: 66.6254 bits (161), Expect = 4.297e-10
Identity = 43/112 (38.39%), Postives = 59/112 (52.68%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ-----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRN 4739
            +C +  Q C+  +DC DGSDE  C     SH + C+    C+P+   CD   DC  +SDEQ      C   +F C +G    RC+P    C+GI DC D SDE+GC+   R+
Sbjct:  153 ACYNNAQHCNGILDCRDGSDESNCTRHCQSHQFECANG-FCIPMPFVCDHWDDCGDNSDEQNCEYRTCSGSEFACSNG----RCMPQQWVCDGINDCGDFSDENGCDPGIRD 259          

HSP 7 Score: 65.855 bits (159), Expect = 7.229e-10
Identity = 102/447 (22.82%), Postives = 155/447 (34.68%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNAD-KDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFK-SSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHL----YSCSRSDVCLPITKRCDGVMDC--DSDEQC-------CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEH 4715
             LA+D +   L W+D     I    L+   + ++    V  N       P  +A+ P    L W   D+ +          + +I  + +DG + S L+    + P  LT+D  + +I++ D   N L Y  +             G N    +   L +       ++ + +  ++WTDW                      H     +       VV       P D             +PC+   H +    CSHLCL     + A                RC CP      H     IGF ++  +  C   Q  CG               C+ +  +CD   DC DGSDE    TC   +     + C   +   P    CDG  DC   SDE         C   +F+C +      C+PI+  C+G+VDC DGSDE 
Sbjct: 3267 GLAVDWVGRKLYWADATMKAIHVSELDGRYRKKLLKDCVDTNSTYCFASPQAVAVNPKYGWLYW--TDWGR----------KAFIGRAGMDGTQASALITTKLVWPHALTIDYTNNKIFFADAHLNFLDYADMD------------GQNRHRAITGSLPHAY-----ALTLFEDLVYWTDW--------------------NTHTIERAHKYTGANRVVMGNNTHRPNDIHIYHPYRQPHSENPCN--DHYLT---CSHLCLIGPGGTEA----------------RCECP-----DHFIGLAIGFKIQC-VADCSSTQFRCGDN-----------EKCIPIWWKCDGQSDCGDGSDEP--QTCPPHYCKTGQFQCQDGNCTNPFF-LCDGHKDCFDGSDEDAALCSDHRCTENQFQCKN----KHCIPITWHCDGVVDCSDGSDEE 3619          

HSP 8 Score: 60.8474 bits (146), Expect = 2.200e-8
Identity = 44/114 (38.60%), Postives = 56/114 (49.12%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGC--NTCNISHLYSCSRSDVCLPITKRCDGVMDCD-----------SDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRN 4730
            C+ +   CD   DC DGSDE  C  NTC+ S  ++C ++ VC+P T  CDG +DC            + E  C    F C SG+    C+ I   CN   DC D SDE GC  N
Sbjct: 2998 CILLPFHCDRVNDCGDGSDETNCIYNTCS-SREFTC-QNGVCIPSTYVCDGYIDCQDGSDELEGLCRTPEPTCAPGDFMCNSGE----CIDIHKVCNQQRDCSDNSDEKGCGIN 3105          

HSP 9 Score: 60.8474 bits (146), Expect = 2.537e-8
Identity = 48/158 (30.38%), Postives = 64/158 (40.51%), Query Frame = 3
Query: 4386 GLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ------CCGSQKFECLSGKDVTR---------------------------------CLPISARCNGIVDCRDGSDEHGCNRN 4730
            G   S +   S   C++   +CD T DC D SDE+ C   TC+ S  + C     C+P+   CDG  DC   SDEQ       C   +F C  G+ + +                                 C   +  CNGI+DCRDGSDE  C R+
Sbjct:   23 GQCMSGEFQCSNGQCINQDWKCDGTKDCTDNSDELNCPLPTCS-SQEFKCLTGGECIPLEFVCDGEADCADGSDEQRTCSGQTCSPDQFTCREGQCIPKQYNCDHVPDCVDNSDENNCNYPACTEKTCANGACYNNAQHCNGILDCRDGSDESNCTRH 179          

HSP 10 Score: 58.5362 bits (140), Expect = 1.198e-7
Identity = 47/141 (33.33%), Postives = 62/141 (43.97%), Query Frame = 3
Query: 4338 KSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNT-----CNISHLYSCSRSDVCLPITKRCDGVMDC--DSDE------QCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            K  +  C  Y+  C +G             C+S   RCD   DC D SDE GC T     C+  + + C     C+P    CDG  DC   SDE      + C S +F+C +G     C+  +  C+G  DCRD SDE  C
Sbjct: 1176 KDCVYTCGTYEFACASG-----------DQCVSQSYRCDGVYDCKDHSDESGCPTRRPGLCH-DNEFQCQVDGFCIPKEWECDGHPDCVDGSDEHNGCPPRTCSSVQFQCANGN----CVSKNWVCDGENDCRDMSDETNC 1300          

HSP 11 Score: 57.3806 bits (137), Expect = 2.637e-7
Identity = 42/107 (39.25%), Postives = 54/107 (50.47%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCNT--CNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ-----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C+ ++ RCD + DC DGSDE  C    C+ S  Y C     C+P    CD   DC  +SDE+      C    F+C SG     C+P + +CNG  DC D SDE  C
Sbjct: 3725 CVPIRWRCDGSNDCGDGSDERNCEPRPCSESE-YRCDNQQ-CIPGAWVCDHDNDCGDNSDERDCELRTCRPGTFQCTSG----HCIPEALKCNGYADCLDFSDESTC 3825          

HSP 12 Score: 56.9954 bits (136), Expect = 3.944e-7
Identity = 45/125 (36.00%), Postives = 58/125 (46.40%), Query Frame = 3
Query: 4377 CGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDE-----VGCN-TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQKFECLSG--KDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C  G    KK G     C+     CD+  DC D SDE     +G +  C+    + C  +  C+P+   CDG  DC  +SDE  C     + L     D  RC+PI  RC+G  DC DGSDE  C
Sbjct: 3628 CKPGQFQCKKGG-----CIPQSYVCDAQNDCGDNSDEPYEVCMGPDYKCDPDTEFPCKGNYRCIPLWAVCDGTNDCLDNSDENTCHELTCDPLGDFRCDNHRCVPIRWRCDGSNDCGDGSDERNC 3747          

HSP 13 Score: 54.6842 bits (130), Expect = 1.742e-6
Identity = 65/303 (21.45%), Postives = 117/303 (38.61%), Query Frame = 3
Query:  918 VCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDT-----VKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLV 1808
            VCS +C   V S Y C C+ G     +   C      + ++    + Y  +L   +   + ++ +         +D+    L +VD  +  I  ++L+  G       D   +      +AVD   R +YW +     + V+ +    R K     +    +  F          P  +AV+    +L+ T        I R  +DGTQ   +I+ T   WP  L +D    +++F D         DM   N H    R +        +L+ F++ +YWT+  T +I    K+ G+ R ++
Sbjct: 3155 VCSQVCENAVGSFY-CKCAPGYLREPDGRTCRQNSGIAPYLLYSNRYYIRNLTA-VGSSMSVVLQGLTNVVALDFDTTEKRLYWVDVGTLRIERINLDGTGREVIMQNDLGGAE----GLAVDWVGRKLYWADATMKAIHVSELDGRYRKKLLKDCVDTNSTYCFAS--------PQAVAVNPKYGWLYWTDWGRKA-FIGRAGMDGTQASALIT-TKLVWPHALTIDYTNNKIFFADAHLNFLDYADMDGQNRH----RAITGSLPHAYALTLFEDLVYWTDWNTHTIERAHKYTGANRVVM 3437          

HSP 14 Score: 54.6842 bits (130), Expect = 1.959e-6
Identity = 59/230 (25.65%), Postives = 102/230 (44.35%), Query Frame = 3
Query:  306 SVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWV---SSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGIT 986
             +AVDWV  NLYWAD + + +EV  L+           R+ L+  ++   +S+ ++P    L+W+  G    +E S LDG +R+V+  + L   + L+ID       +W  D +  R++     G + +        +P  +   E  + +   E+  V     F  GT   + L T P +  I I  ++    +     K+PC    CS +CL +    Y C+C  G +
Sbjct: 4137 GIAVDWVGRNLYWADAQLKRLEVAMLD--------GRYRKHLIKTDLEAPNSVALNPRLGMLYWIDNGNTPRIECSWLDGQERKVLVNNGLGWPTGLSIDFTNGDRIYWS-DAKESRIESILPDGQNRKTSVFIDVRNPFSVNVFEDHVYWSTQEKGEVFRQDKFGKGTKTRL-LVTGPWLTQINIYQQQKYNSI---ALKNPCKG-TCSHLCL-LRPGGYTCACPEGTS 4351          

HSP 15 Score: 52.373 bits (124), Expect = 7.952e-6
Identity = 46/139 (33.09%), Postives = 62/139 (44.60%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEV--GC--NTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDE--QCCGSQKFEC-----LSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAI 4805
            C+ +   CD  VDC DGSDE    C   TC     + C +   C+P +  CD   DC  +SDE  + C    ++C        K   RC+P+ A C+G  DC D SDE+ C+         T DP       N+  V I
Sbjct: 3599 CIPITWHCDGVVDCSDGSDEETDSCIDKTCKPGQ-FQCKKGG-CIPQSYVCDAQNDCGDNSDEPYEVCMGPDYKCDPDTEFPCKGNYRCIPLWAVCDGTNDCLDNSDENTCHE-------LTCDPLGDFRCDNHRCVPI 3728          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Xenopus
Match: gpa33 (glycoprotein A33 (transmembrane) [Source:Xenbase;Acc:XB-GENE-1014159])

HSP 1 Score: 188.734 bits (478), Expect = 3.835e-47
Identity = 312/1444 (21.61%), Postives = 535/1444 (37.05%), Query Frame = 3
Query:   69 VFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIH---RVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFR-------FAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRIL-AQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVA---------SLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDV-SWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPM-LIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDS--------SSSITRKQLTFISNV----GHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLP-VESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFW-IEMSDLDG-NRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHV----IGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLS-------TLPISLAEEYSFLMTAQQ 4256
            V L+A+   + + + HR    +  N     +A D     +L VF        +++    + L+   + +V+   ++S   +A+DW+   L+W D     IEV +L+           R++LL  N+    ++ + P E  ++W   G +  +E S +DGS+RRVI  + LF  + L ID     ++W  +D + H   R D  G    ++  QG      P  +T  E  L + +     ++S    TG +  +  +    P+ I +  H    P G  +    N  CS +CLP     + C+C TG  +   N  C     + L       I  +S D       + LS++  IP           +D+    + + D  + SI     +  G+ Q   +D  + S  P  +A+D  +  +YW     ++    RI   N       +L W           +    P D+ VD I  +++ T        IER  +D + +  +ISS N  WP GLA+D   ++LY+ D     + S   +G  + +L          L+ + + IYWT+ ++ SI +         L  +T   +   +  I V         S C   +  C  +C  +       SC C    ++L +   CS   +  + F +   I    + + D  Y       +DV V          ++ +D  +  IYW +     I + A   D      I      T   LAVD I   LY + T +  +RI +  L  T   V  W N+            A++++ ++ +++W      D    A+L +A +DGS+ M LI   +   + L VD+  + + W  + + +I   +++ R                            +R + +      Y +TL D+        + SI R       N+     +  G+     V R+ A+   K                     D    CS  CLP   S  C C +   L  DG TC    D  ++ ++ G I  I    L+ +D    +V   EL                      V+ LD       +  T  ++ + +   L+        +T   E L         +   LA+D ++  L W+D     I   RL+       +  V++N   S   P  IA+ P    L W               W Q   IE + LDG +RR+++  + G P+ LT+D  S RIYW+D   +++    +   N ++R  HV    + H   +T +                  ++++WTDW  +    +   S       +G    N++ L D +         I                +PC      + N  CSHLC +         P     E  FL+   Q
Sbjct:  375 VLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHEHEL-VFWSDVTLDRIMR----ANLNGSNVEEVVSTGLESPGGLAIDWIHDKLFWTDSGTSRIEVSNLD--------GSHRKVLLWNNLEKPRAIALHPMEGTIYWTDWGNVPRIEYSSMDGSNRRVIADTHLFWPNGLTIDYAGHRIYW--VDAKHHVIERADLDGSNRKAVISQGLPH---PFAITVFEDSLYWTDWHTKSINSANKFTGKNQEVIRSKLHFPMDIHTL-HPQRQPTGANRCGVDNGGCSHLCLP-GGQTFSCACPTGFRKTGLN-TCAKSLDKFLLFARRTDIRRISFD------TDDLSDDV-IPLSDVRSAVALDWDATEDLMYWTDITTDSINRAKWD--GSEQEVIIDTSLES--PAGLAIDWVTHKLYW-----TDAGTDRIEVSNTDGSLRSVLIW-----------ENLDRPRDIVVDPIGGFMYWTDWG-ANPKIERAGMDASSRLVIISS-NLTWPNGLAIDYESERLYWADAGMKTIESAKLNGADRMVLIGTDLPHPFGLTLYGDQIYWTDWQSKSIETAD---RKTGLGRRTVQANLENLMDIHVFHRHRTQVPSACSIDNGGCSHICL-LAPKPKGHSCACPTGVNLLSDGRTCSSGMDRFLIFARRTDIR---SVSLDIPYF------ADVVVPINATMKNTIAVGVDPLKGLIYWADSTLRKISRAA--LDGSNHQDIITTGLVTTDGLAVDAIGRKLYWTDTGT--NRIEVANLDGTMRKVLVWQNLGSPR--------AIALYHEMGYMYW-----SDWGENAKLERAGMDGSERMVLISLNLGWPNGLAVDKAGSQLLWADAHTERIEASDLMGR----------------------------NRRILVSPVQHPYGLTLLDAHIYWTDWQTRSIQRADKDTGGNIIVVRDNLPGLMDIQAVDRTHALGYNKCG-------------------DKNGGCSHLCLPNSTSFSCACPTGIQLKDDGKTCNPSPDTYLLFSSRGSIRRIS---LDTEDHTDVYVPIPELHN--------------------VISLDYDSVEGKIYYTDVFLDVIRRSDLT----GTGMETVIGEGLK--------TTDGLAVDWVARNLYWTDTGRNTIEVSRLDG-----RHRKVLVN--NSLDEPRAIAVFPRKGFLFWTD-------------WGQVAKIERAHLDGSDRRTIINTDLGWPNGLTLDYDSRRIYWVDAHLDRIENADL---NGKMR--HVLISQVSHPFALTQEG-----------------RWIYWTDWQTKSIQRVDKFSGRNKETVLG----NVEGLMDIIVVSPHRQTGI----------------NPCG-----INNGGCSHLCFARSIDYVCACPDEPDSEPCFLLPGYQ 1589          

HSP 2 Score: 60.8474 bits (146), Expect = 3.222e-8
Identity = 49/130 (37.69%), Postives = 64/130 (49.23%), Query Frame = 3
Query: 4356 CDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNT-CNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCC--------GSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            C  +Q PC +G  F    G+    C++   RCD   DC D SDE  C T    S  + CS S  C+ ++ RCDG  DC  +SDE+ C           +F C +G    RC+     CNG+ DC DGSDE
Sbjct:  159 CSSHQ-PCRSG-EFMCNSGL----CINSGWRCDGDSDCDDQSDEKNCTTSVCTSDQFRCS-SGRCVRLSWRCDGEDDCSDNSDERGCEKTGSPQCAQDQFLCSNG----RCIGQRKLCNGVNDCGDGSDE 277          

HSP 3 Score: 59.3066 bits (142), Expect = 9.951e-8
Identity = 56/192 (29.17%), Postives = 74/192 (38.54%), Query Frame = 3
Query: 4326 GFCVKSQLVKCD-------RYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNT------CNISHLY--------------------------SCS------------RSDVCLPITKRCDGVMDCD--SDEQ-----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNR 4727
            G+C++S L  CD            C       K+ G +  SC++    CD   DC DGSDE  C +      C++                               CS             S +C+    RCDG  DCD  SDE+      C S +F C SG    RC+ +S RC+G  DC D SDE GC +
Sbjct:   54 GYCIRS-LWHCDGDNDCGDNSDEQCDMRKCSEKEFGCADGSCIAEHWFCDGDTDCKDGSDEESCPSDVPAPSCSVEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCNSGLCINSGWRCDGDSDCDDQSDEKNCTTSVCTSDQFRCSSG----RCVRLSWRCDGEDDCSDNSDERGCEK 240          

HSP 4 Score: 55.0694 bits (131), Expect = 2.006e-6
Identity = 39/106 (36.79%), Postives = 50/106 (47.17%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGC--NTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQC----CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C+     CD   DC D SDE  C    C     +SC ++  C+     CDG  DC  +SDEQC    C  ++F C  G     C+     C+G  DC+DGSDE  C
Sbjct:   17 CIRRSWVCDGDNDCEDDSDEQDCPPRECEEDE-FSC-QNGYCIRSLWHCDGDNDCGDNSDEQCDMRKCSEKEFGCADGS----CIAEHWFCDGDTDCKDGSDEESC 116          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Xenopus
Match: polk (polymerase (DNA directed) kappa [Source:Xenbase;Acc:XB-GENE-985768])

HSP 1 Score: 169.859 bits (429), Expect = 2.097e-41
Identity = 188/796 (23.62%), Postives = 337/796 (42.34%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQ---LWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPC--MNRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            S + +A DW+   LYW D +   IEV +LN           R++L  +++    ++ +DP   Y++W   G    +ER+ +DGS R+VI  + ++  + L ID   + L+W   D +   IHR +  G    S R +      +  F     G  ++  D Q   +   +   G      L +  +   I + S++ Q   P     +PC   N  CS +C L   +  Y C+C TG+    +   C T     L +     +  +SLD      + L  ++        YD V   + + D    +I           +R YLD       +++++  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  + +  +  Y++ T   +    IE  +LDG+++  +++S+   WP GLALD    +LY+ D  K D I V    GS R  +L  K       +   ++IYWT+ +  SI  V K   S   ++ +  +L    M + A S + +  T +PC   +  C  LCF    +     C C     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N++YW +     I +   N      +  F L  D    +AVD++  NLY S T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   K R     + +A++DG+  +++   V   ++L +D     + W   D+  I
Sbjct:  110 SPDGLACDWIGKKLYWTDSETNRIEVGNLN--------GTYRKVLFWQDLDQPRAIALDPAHGYMYWTDWGDTPRIERAGMDGSMRKVIVDTDIYWPNGLTIDLDEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTHPFALTLAGDTLYWTDWQTRSIHACNKRTGEKRREILSSLYSPMDIQVFSKERQPYFP-----TPCDESNGGCSHLCLLSPREPFYSCTCPTGVQLTQDGKTCKTGADDVLLLARRTDLRRISLDMPDFTDIVLQIDDIRHAIAIDYDPVEGYIYWTDDEVKAI-----------RRAYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILIS------------ENLDEPRAIVLHPLTGYMYWTDWGENP-KIESAYLDGSERMVLVNSSLG-WPNGLALDLQDGKLYWGD-AKTDKIEVINVDGSNRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKVRASREIIIDQLPDL----MGLKAASVSNTFGT-NPCADNNGGCSHLCF---FSPRGVRCSCPIGLELLSDMRTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVK---EASALDFDVSDNRLYWTDITLKTISRAFMNGSSVEHVIEFGL--DYPEGMAVDWMGKNLYWSDTGT--NRIEVSRL-----DGLYRQVLVWKDLDNP--RSLALDPAKGYMYWTEWGGKPR-----IVRAYMDGTNSIILVDKVGRANDLTIDYADQRLYWTDLDTNMI 829          

HSP 2 Score: 140.198 bits (352), Expect = 2.140e-32
Identity = 188/832 (22.60%), Postives = 337/832 (40.50%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFINDEQLWVSSFE----CGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKS----MLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTIS-----NLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILG-----------AVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            +K    + LD    + ++   VQ  + +AVDWV+ NLYW D     IEV  LN  S        R+IL+S N+ +  ++V+ P   Y++W   G    +E + LDGS+R V+  S L   + LA+D     L+W   D +  +++     G + +     +   P    FT  G  ++  D Q    S E          I +   P++  +   S  +          +PC   N  CS +C        RCSC  G+ E +++      P   L   +   I+ +SL+     +  PL  + E + + F    D   + L + D    +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + V+R+    R      +L W+               P  LA+D    Y++ T    G   I R ++DGT    ++          L +D   Q+LY+ D     + S N  G  + I+A        L+ + ++IYWT+    SI    K +G+ R+L+    +     +  I V  ++  D  + C   +  C QLC  +      + C CS+   +  N   CS  S  +++  K+    ML+    +P+       L        V ++  D     IYW++   N I+K A +   Q  + +   +          +L++D   + LY       W+                TN + + K+  + +G           A++V+++  +L++    T  ++   ++ +A  DG++  +L   G+     LVVD +   + W  +D  +I
Sbjct:  395 VKAIRRAYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS--------RKILISENLDEPRAIVLHPLTGYMYWTDWGENPKIESAYLDGSERMVLVNSSLGWPNGLALDLQDGKLYWG--DAKTDKIEVINVDGSNRKT--LLEDKLPHIFGFTLLGDYIYWTDWQR--RSIERVHKVRASREIIIDQLPDLMGLKAASVSNTFGT------NPCADNNGGCSHLCF-FSPRGVRCSCPIGL-ELLSDMRTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDF----DVSDNRLYWTDITLKTISRAFMN--GSSVEHVIEFGL--DYPEGMAVDWMGKNLYWSDTGTNRIEVSRLDGLYRQ-----VLVWK-----------DLDNPRSLALDPAKGYMYWTEWG-GKPRIVRAYMDGTNSIILVDKVGR--ANDLTIDYADQRLYWTDLDTNMIESSNMLGAERVIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKLNGNNRTLIQDHLDF----VMDILVFHSSRQDGLNDCMQNNGHCSQLCLAV---PKGYKCSCSSHYTLDSNNRNCSPPSNFLLFSQKTAINRMLLDEQQSPDITLPIHGL------RNVKAVSYDPLDKLIYWVDGRQN-IIKRAKDDGTQPFVVVSTPNQSQTPEKQPHDLSIDIYSHTLY-------WT-------------CEGTNTINANKLNGESIGVVLRGDHDKPRAIAVNAERGYLYF----TNMQERSPKIERAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFWVDADLKRI 1139          

HSP 3 Score: 125.561 bits (314), Expect = 6.052e-28
Identity = 140/591 (23.69%), Postives = 226/591 (38.24%), Query Frame = 3
Query: 2985 CSQFCLPV-ESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLS--KNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNR 4727
            CSQ CL V +  +C C S Y+L ++   C   S+ L+    T     I   +L+E+      +    L      +       +YW+   +NI+ R  +       D T+P+V++    Q    E                        + L+ID  S TL W+   T  I A +LN      E +GV++  R    +P  IA+      L + +      +           IE +  DG  R VL     I P  L VD   G+++W+D             D  +I +  + G N     DS +   +G     + +L  +L+W D  QQ+   +   + I+ +   G   +          T +  +  +   +F +         HPCSR      N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+ +  RCD   +C D SDE  C  C+ S+ + C +   C+   ++C+G +DC   SDE  C S     +F C +G+    C+ +S +C+   DC D SDE  C +
Sbjct:  914 CSQLCLAVPKGYKCSCSSHYTLDSNNRNCSPPSNFLLFSQKTA----INRMLLDEQQSPDITLPIHGLRNVKAVSYDPLDKLIYWVDGRQNIIKRAKD-------DGTQPFVVVSTPNQSQTPEK---------------------QPHDLSIDIYSHTLYWTCEGTNTINANKLNG-----ESIGVVL--RGDHDKPRAIAVNAERGYLYFTNMQERSPK-----------IERAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFWVDA------------DLKRIESSDLSGANRVTLEDSNILQPMG-----LTILGDHLYWIDKQQQMIERVEKTNGIRRTKIQGRIAH---------PTGIHAVESVDMNEFSA---------HPCSR-----NNGGCSHICIT-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPEQFTCATGDI----------DCIPMAWRCDGFSECDDNSDEENCPVCS-SNQFQCEKGQ-CIDARQKCNGEIDCQDKSDELDCDSICLPDQFRCANGQ----CIMMSQQCDTFPDCSDSSDELICGK 1375          

HSP 4 Score: 75.485 bits (184), Expect = 1.215e-12
Identity = 100/460 (21.74%), Postives = 176/460 (38.26%), Query Frame = 3
Query: 2955 PTHNHDNFLTCSQFCLPVESRE----CGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRY-SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSR 4316
            PT   ++   CS  CL +  RE    C C +   L+ DG TC   +D ++++         R ++     D  DF +                         IVL++D+     A+D    Y  ++ Y   +  E           +  +   + E      +A+D ++  L W+D  T  I   RLN    +I          E+   P  I + P++  + W   D+ ++            IE + LDG+ R VLV +  G P+ L +D+  G++YW D KT+K+  +++             G N K  ++  L +  GF+     +L  Y++WTDW ++   SI     ++ S  +         + D+L  ++ +         K++S+      +PC+       N  CSHLC  +                      RCSCP+ + +    R
Sbjct:  297 PTPCDESNGGCSHLCL-LSPREPFYSCTCPTGVQLTQDGKTCKTGADDVLLLAR-------RTDLRRISLDMPDFTD-------------------------IVLQIDDIRHAIAID----YDPVEGYIYWTDDEVKAIRRAYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKIL-------ISENLDEPRAIVLHPLTGYMYW--TDWGENPK----------IESAYLDGSERMVLVNSSLGWPNGLALDLQDGKLYWGDAKTDKIEVINVD------------GSNRKTLLEDKLPHIFGFT-----LLGDYIYWTDWQRR---SIERVHKVRASREI---------IIDQLPDLMGL---------KAASVSNTFGTNPCAD-----NNGGCSHLCFFS------------------PRGVRCSCPIGLELLSDMR 639          

HSP 5 Score: 53.9138 bits (128), Expect = 3.769e-6
Identity = 58/248 (23.39%), Postives = 96/248 (38.71%), Query Frame = 3
Query:  288 PVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIA-PIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPT 1025
            P +    +++D  S  LYW  +    I    LN +S          ++L  +     ++ V+    YL++  +      +ER+  DG++R V+  + L +   L +D     LFW  +D ++ R++    +G +           P  LT     L +I+ +Q  +   E   GI    K    IA P  I + +   M           N  CS IC+   D   RCSC   +    N   C   PT
Sbjct: 1025 PEKQPHDLSIDIYSHTLYWTCEGTNTINANKLNGES--------IGVVLRGDHDKPRAIAVNAERGYLYFTNMQERSPKIERAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFW--VDADLKRIESSDLSGANRVTLEDSNILQPMGLTILGDHLYWIDKQQQMIERVEKTNGIR-RTKIQGRIAHPTGIHAVESVDMNEFSAHPCSRNNGGCSHICITKGDGTPRCSCPVHLVLLQNLLTCGEPPT 1261          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Xenopus
Match: polk (polymerase (DNA directed) kappa [Source:Xenbase;Acc:XB-GENE-985768])

HSP 1 Score: 169.474 bits (428), Expect = 2.297e-41
Identity = 188/796 (23.62%), Postives = 337/796 (42.34%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQ---LWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPC--MNRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            S + +A DW+   LYW D +   IEV +LN           R++L  +++    ++ +DP   Y++W   G    +ER+ +DGS R+VI  + ++  + L ID   + L+W   D +   IHR +  G    S R +      +  F     G  ++  D Q   +   +   G      L +  +   I + S++ Q   P     +PC   N  CS +C L   +  Y C+C TG+    +   C T     L +     +  +SLD      + L  ++        YD V   + + D    +I           +R YLD       +++++  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  + +  +  Y++ T   +    IE  +LDG+++  +++S+   WP GLALD    +LY+ D  K D I V    GS R  +L  K       +   ++IYWT+ +  SI  V K   S   ++ +  +L    M + A S + +  T +PC   +  C  LCF    +     C C     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N++YW +     I +   N      +  F L  D    +AVD++  NLY S T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   K R     + +A++DG+  +++   V   ++L +D     + W   D+  I
Sbjct:   86 SPDGLACDWIGKKLYWTDSETNRIEVGNLN--------GTYRKVLFWQDLDQPRAIALDPAHGYMYWTDWGDTPRIERAGMDGSMRKVIVDTDIYWPNGLTIDLDEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTHPFALTLAGDTLYWTDWQTRSIHACNKRTGEKRREILSSLYSPMDIQVFSKERQPYFP-----TPCDESNGGCSHLCLLSPREPFYSCTCPTGVQLTQDGKTCKTGADDVLLLARRTDLRRISLDMPDFTDIVLQIDDIRHAIAIDYDPVEGYIYWTDDEVKAI-----------RRAYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILIS------------ENLDEPRAIVLHPLTGYMYWTDWGENP-KIESAYLDGSERMVLVNSSLG-WPNGLALDLQDGKLYWGD-AKTDKIEVINVDGSNRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKVRASREIIIDQLPDL----MGLKAASVSNTFGT-NPCADNNGGCSHLCF---FSPRGVRCSCPIGLELLSDMRTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVK---EASALDFDVSDNRLYWTDITLKTISRAFMNGSSVEHVIEFGL--DYPEGMAVDWMGKNLYWSDTGT--NRIEVSRL-----DGLYRQVLVWKDLDNP--RSLALDPAKGYMYWTEWGGKPR-----IVRAYMDGTNSIILVDKVGRANDLTIDYADQRLYWTDLDTNMI 805          

HSP 2 Score: 140.198 bits (352), Expect = 2.383e-32
Identity = 188/832 (22.60%), Postives = 337/832 (40.50%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFINDEQLWVSSFE----CGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKS----MLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTIS-----NLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILG-----------AVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            +K    + LD    + ++   VQ  + +AVDWV+ NLYW D     IEV  LN  S        R+IL+S N+ +  ++V+ P   Y++W   G    +E + LDGS+R V+  S L   + LA+D     L+W   D +  +++     G + +     +   P    FT  G  ++  D Q    S E          I +   P++  +   S  +          +PC   N  CS +C        RCSC  G+ E +++      P   L   +   I+ +SL+     +  PL  + E + + F    D   + L + D    +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + V+R+    R      +L W+               P  LA+D    Y++ T    G   I R ++DGT    ++          L +D   Q+LY+ D     + S N  G  + I+A        L+ + ++IYWT+    SI    K +G+ R+L+    +     +  I V  ++  D  + C   +  C QLC  +      + C CS+   +  N   CS  S  +++  K+    ML+    +P+       L        V ++  D     IYW++   N I+K A +   Q  + +   +          +L++D   + LY       W+                TN + + K+  + +G           A++V+++  +L++    T  ++   ++ +A  DG++  +L   G+     LVVD +   + W  +D  +I
Sbjct:  371 VKAIRRAYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS--------RKILISENLDEPRAIVLHPLTGYMYWTDWGENPKIESAYLDGSERMVLVNSSLGWPNGLALDLQDGKLYWG--DAKTDKIEVINVDGSNRKT--LLEDKLPHIFGFTLLGDYIYWTDWQR--RSIERVHKVRASREIIIDQLPDLMGLKAASVSNTFGT------NPCADNNGGCSHLCF-FSPRGVRCSCPIGL-ELLSDMRTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDF----DVSDNRLYWTDITLKTISRAFMN--GSSVEHVIEFGL--DYPEGMAVDWMGKNLYWSDTGTNRIEVSRLDGLYRQ-----VLVWK-----------DLDNPRSLALDPAKGYMYWTEWG-GKPRIVRAYMDGTNSIILVDKVGR--ANDLTIDYADQRLYWTDLDTNMIESSNMLGAERVIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKLNGNNRTLIQDHLDF----VMDILVFHSSRQDGLNDCMQNNGHCSQLCLAV---PKGYKCSCSSHYTLDSNNRNCSPPSNFLLFSQKTAINRMLLDEQQSPDITLPIHGL------RNVKAVSYDPLDKLIYWVDGRQN-IIKRAKDDGTQPFVVVSTPNQSQTPEKQPHDLSIDIYSHTLY-------WT-------------CEGTNTINANKLNGESIGVVLRGDHDKPRAIAVNAERGYLYF----TNMQERSPKIERAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFWVDADLKRI 1115          

HSP 3 Score: 110.923 bits (276), Expect = 2.020e-23
Identity = 132/585 (22.56%), Postives = 217/585 (37.09%), Query Frame = 3
Query: 2985 CSQFCLPV-ESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLS--KNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCDSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNR 4727
            CSQ CL V +  +C C S Y+L ++   C   S+ L+    T     I   +L+E+      +    L      +       +YW+   +NI+ R  +       D T+P+V++    Q    E                        + L+ID  S TL W+   T  I A +LN      E +GV++  R    +P  IA+      L + +      +           IE +  DG  R VL     I P  L VD   G+++W+D             D  +I +  + G N     DS +   +G     + +L  +L+W D  QQ+   +   + I+ +   G   +          T +  +  +   +F +         HPCSR      N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+ +  RCD   +C D SDE  C  C+ S+ + C +   C+   ++             C   +F C +G+    C+ +S +C+   DC D SDE  C++
Sbjct:  890 CSQLCLAVPKGYKCSCSSHYTLDSNNRNCSPPSNFLLFSQKTA----INRMLLDEQQSPDITLPIHGLRNVKAVSYDPLDKLIYWVDGRQNIIKRAKD-------DGTQPFVVVSTPNQSQTPEK---------------------QPHDLSIDIYSHTLYWTCEGTNTINANKLNG-----ESIGVVL--RGDHDKPRAIAVNAERGYLYFTNMQERSPK-----------IERAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFWVDA------------DLKRIESSDLSGANRVTLEDSNILQPMG-----LTILGDHLYWIDKQQQMIERVEKTNGIRRTKIQGRIAH---------PTGIHAVESVDMNEFSA---------HPCSR-----NNGGCSHICIT-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPEQFTCATGDI----------DCIPMAWRCDGFSECDDNSDEENCPVCS-SNQFQCEKGQ-CIDARQK-----------SICLPDQFRCANGQ----CIMMSQQCDTFPDCSDSSDELICDK 1334          

HSP 4 Score: 75.0998 bits (183), Expect = 1.268e-12
Identity = 101/460 (21.96%), Postives = 178/460 (38.70%), Query Frame = 3
Query: 2955 PTHNHDNFLTCSQFCLPVESRE----CGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRY-SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSR 4316
            PT   ++   CS  CL +  RE    C C +   L+ DG TC   +D ++++         R ++     D  DF +                         IVL++D+     A+D    Y  ++ Y   +  E           +  +   + E      +A+D ++  L W+D  T  I   RLN    +I          E+   P  I + P++  + W   D+ ++            IE + LDG+ R VLV +  G P+ L +D+  G++YW D KT+K+  +++             G N K  ++  L +  GF+     +L  Y++WTDW ++   SI     ++ S  +         + D+L  ++ +         K++S+      +PC+       N  CSHLC  + P  +                 RCSCP+ + +    R
Sbjct:  273 PTPCDESNGGCSHLCL-LSPREPFYSCTCPTGVQLTQDGKTCKTGADDVLLLAR-------RTDLRRISLDMPDFTD-------------------------IVLQIDDIRHAIAID----YDPVEGYIYWTDDEVKAIRRAYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKIL-------ISENLDEPRAIVLHPLTGYMYW--TDWGENPK----------IESAYLDGSERMVLVNSSLGWPNGLALDLQDGKLYWGDAKTDKIEVINVD------------GSNRKTLLEDKLPHIFGFT-----LLGDYIYWTDWQRR---SIERVHKVRASREI---------IIDQLPDLMGL---------KAASVSNTFGTNPCAD-----NNGGCSHLCFFS-PRGV-----------------RCSCPIGLELLSDMR 615          

HSP 5 Score: 53.9138 bits (128), Expect = 4.293e-6
Identity = 58/248 (23.39%), Postives = 96/248 (38.71%), Query Frame = 3
Query:  288 PVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIA-PIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPT 1025
            P +    +++D  S  LYW  +    I    LN +S          ++L  +     ++ V+    YL++  +      +ER+  DG++R V+  + L +   L +D     LFW  +D ++ R++    +G +           P  LT     L +I+ +Q  +   E   GI    K    IA P  I + +   M           N  CS IC+   D   RCSC   +    N   C   PT
Sbjct: 1001 PEKQPHDLSIDIYSHTLYWTCEGTNTINANKLNGES--------IGVVLRGDHDKPRAIAVNAERGYLYFTNMQERSPKIERAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFW--VDADLKRIESSDLSGANRVTLEDSNILQPMGLTILGDHLYWIDKQQQMIERVEKTNGIR-RTKIQGRIAHPTGIHAVESVDMNEFSAHPCSRNNGGCSHICITKGDGTPRCSCPVHLVLLQNLLTCGEPPT 1237          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Xenopus
Match: polk (polymerase (DNA directed) kappa [Source:Xenbase;Acc:XB-GENE-985768])

HSP 1 Score: 169.474 bits (428), Expect = 2.354e-41
Identity = 188/796 (23.62%), Postives = 337/796 (42.34%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQ---LWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPC--MNRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            S + +A DW+   LYW D +   IEV +LN           R++L  +++    ++ +DP   Y++W   G    +ER+ +DGS R+VI  + ++  + L ID   + L+W   D +   IHR +  G    S R +      +  F     G  ++  D Q   +   +   G      L +  +   I + S++ Q   P     +PC   N  CS +C L   +  Y C+C TG+    +   C T     L +     +  +SLD      + L  ++        YD V   + + D    +I           +R YLD       +++++  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  + +  +  Y++ T   +    IE  +LDG+++  +++S+   WP GLALD    +LY+ D  K D I V    GS R  +L  K       +   ++IYWT+ +  SI  V K   S   ++ +  +L    M + A S + +  T +PC   +  C  LCF    +     C C     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N++YW +     I +   N      +  F L  D    +AVD++  NLY S T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   K R     + +A++DG+  +++   V   ++L +D     + W   D+  I
Sbjct:   68 SPDGLACDWIGKKLYWTDSETNRIEVGNLN--------GTYRKVLFWQDLDQPRAIALDPAHGYMYWTDWGDTPRIERAGMDGSMRKVIVDTDIYWPNGLTIDLDEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTHPFALTLAGDTLYWTDWQTRSIHACNKRTGEKRREILSSLYSPMDIQVFSKERQPYFP-----TPCDESNGGCSHLCLLSPREPFYSCTCPTGVQLTQDGKTCKTGADDVLLLARRTDLRRISLDMPDFTDIVLQIDDIRHAIAIDYDPVEGYIYWTDDEVKAI-----------RRAYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILIS------------ENLDEPRAIVLHPLTGYMYWTDWGENP-KIESAYLDGSERMVLVNSSLG-WPNGLALDLQDGKLYWGD-AKTDKIEVINVDGSNRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKVRASREIIIDQLPDL----MGLKAASVSNTFGT-NPCADNNGGCSHLCF---FSPRGVRCSCPIGLELLSDMRTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVK---EASALDFDVSDNRLYWTDITLKTISRAFMNGSSVEHVIEFGL--DYPEGMAVDWMGKNLYWSDTGT--NRIEVSRL-----DGLYRQVLVWKDLDNP--RSLALDPAKGYMYWTEWGGKPR-----IVRAYMDGTNSIILVDKVGRANDLTIDYADQRLYWTDLDTNMI 787          

HSP 2 Score: 139.813 bits (351), Expect = 2.549e-32
Identity = 196/881 (22.25%), Postives = 358/881 (40.64%), Query Frame = 3
Query:  102 KSILHRHGVDIFFNTDLKLLAADV-------FLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFINDEQLWVSSFE----CGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKS----MLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTIS-----NLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILG-----------AVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            ++ L R  +D+   TD+ L   D+       +   + Y++   +  K++ +    + LD    + ++   VQ  + +AVDWV+ NLYW D     IEV  LN  S        R+IL+S N+ +  ++V+ P   Y++W   G    +E + LDGS+R V+  S L   + LA+D     L+W   D +  +++     G + +     +   P    FT  G  ++  D Q    S E          I +   P++  +   S  +          +PC   N  CS +C        RCSC  G+ E +++      P   L   +   I+ +SL+     +  PL  + E + + F    D   + L + D    +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + V+R+    R      +L W+               P  LA+D    Y++ T    G   I R ++DGT    ++          L +D   Q+LY+ D     + S N  G  + I+A        L+ + ++IYWT+    SI    K +G+ R+L+    +     +  I V  ++  D  + C   +  C QLC  +      + C CS+   +  N   CS  S  +++  K+    ML+    +P+       L        V ++  D     IYW++   N I+K A +   Q  + +   +          +L++D   + LY       W+                TN + + K+  + +G           A++V+++  +L++    T  ++   ++ +A  DG++  +L   G+     LVVD +   + W  +D  +I
Sbjct:  308 RTDLRRISLDMPDFTDIVLQIDDIRHAIAIDYDPVEGYIYWTDDEVKAIRR----AYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS--------RKILISENLDEPRAIVLHPLTGYMYWTDWGENPKIESAYLDGSERMVLVNSSLGWPNGLALDLQDGKLYWG--DAKTDKIEVINVDGSNRKT--LLEDKLPHIFGFTLLGDYIYWTDWQR--RSIERVHKVRASREIIIDQLPDLMGLKAASVSNTFGT------NPCADNNGGCSHLCF-FSPRGVRCSCPIGL-ELLSDMRTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDF----DVSDNRLYWTDITLKTISRAFMN--GSSVEHVIEFGL--DYPEGMAVDWMGKNLYWSDTGTNRIEVSRLDGLYRQ-----VLVWK-----------DLDNPRSLALDPAKGYMYWTEWG-GKPRIVRAYMDGTNSIILVDKVGR--ANDLTIDYADQRLYWTDLDTNMIESSNMLGAERVIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKLNGNNRTLIQDHLDF----VMDILVFHSSRQDGLNDCMQNNGHCSQLCLAV---PKGYKCSCSSHYTLDSNNRNCSPPSNFLLFSQKTAINRMLLDEQQSPDITLPIHGL------RNVKAVSYDPLDKLIYWVDGRQN-IIKRAKDDGTQPFVVVSTPNQSQTPEKQPHDLSIDIYSHTLY-------WT-------------CEGTNTINANKLNGESIGVVLRGDHDKPRAIAVNAERGYLYF----TNMQERSPKIERAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFWVDADLKRI 1097          

HSP 3 Score: 125.561 bits (314), Expect = 7.050e-28
Identity = 140/591 (23.69%), Postives = 227/591 (38.41%), Query Frame = 3
Query: 2985 CSQFCLPV-ESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLS--KNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNR 4727
            CSQ CL V +  +C C S Y+L ++   C   S+ L+    T     I   +L+E+      +    L      +       +YW+   +NI+ R  +       D T+P+V++    Q    E                        + L+ID  S TL W+   T  I A +LN      E +GV++  R    +P  IA+      L + +      +           IE +  DG  R VL     I P  L VD   G+++W+D             D  +I +  + G N     DS +   +G     + +L  +L+W D  QQ+   +   + I+ +   G   +          T +  +  +   +F +         HPCSR      N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+ +  RCD   +C D SDE  C  C+ S+ + C +   C+   ++C+G +DC   SDE  C S     +F C +G+    C+ +S +C+   DC D SDE  C++
Sbjct:  872 CSQLCLAVPKGYKCSCSSHYTLDSNNRNCSPPSNFLLFSQKTA----INRMLLDEQQSPDITLPIHGLRNVKAVSYDPLDKLIYWVDGRQNIIKRAKD-------DGTQPFVVVSTPNQSQTPEK---------------------QPHDLSIDIYSHTLYWTCEGTNTINANKLNG-----ESIGVVL--RGDHDKPRAIAVNAERGYLYFTNMQERSPK-----------IERAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFWVDA------------DLKRIESSDLSGANRVTLEDSNILQPMG-----LTILGDHLYWIDKQQQMIERVEKTNGIRRTKIQGRIAH---------PTGIHAVESVDMNEFSA---------HPCSR-----NNGGCSHICIT-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPEQFTCATGDI----------DCIPMAWRCDGFSECDDNSDEENCPVCS-SNQFQCEKGQ-CIDARQKCNGEIDCQDKSDELDCDSICLPDQFRCANGQ----CIMMSQQCDTFPDCSDSSDELICDK 1333          

HSP 4 Score: 75.0998 bits (183), Expect = 1.464e-12
Identity = 101/460 (21.96%), Postives = 178/460 (38.70%), Query Frame = 3
Query: 2955 PTHNHDNFLTCSQFCLPVESRE----CGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRY-SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSR 4316
            PT   ++   CS  CL +  RE    C C +   L+ DG TC   +D ++++         R ++     D  DF +                         IVL++D+     A+D    Y  ++ Y   +  E           +  +   + E      +A+D ++  L W+D  T  I   RLN    +I          E+   P  I + P++  + W   D+ ++            IE + LDG+ R VLV +  G P+ L +D+  G++YW D KT+K+  +++             G N K  ++  L +  GF+     +L  Y++WTDW ++   SI     ++ S  +         + D+L  ++ +         K++S+      +PC+       N  CSHLC  + P  +                 RCSCP+ + +    R
Sbjct:  255 PTPCDESNGGCSHLCL-LSPREPFYSCTCPTGVQLTQDGKTCKTGADDVLLLAR-------RTDLRRISLDMPDFTD-------------------------IVLQIDDIRHAIAID----YDPVEGYIYWTDDEVKAIRRAYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKIL-------ISENLDEPRAIVLHPLTGYMYW--TDWGENPK----------IESAYLDGSERMVLVNSSLGWPNGLALDLQDGKLYWGDAKTDKIEVINVD------------GSNRKTLLEDKLPHIFGFT-----LLGDYIYWTDWQRR---SIERVHKVRASREI---------IIDQLPDLMGL---------KAASVSNTFGTNPCAD-----NNGGCSHLCFFS-PRGV-----------------RCSCPIGLELLSDMR 597          

HSP 5 Score: 53.5286 bits (127), Expect = 4.477e-6
Identity = 58/248 (23.39%), Postives = 96/248 (38.71%), Query Frame = 3
Query:  288 PVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIA-PIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPT 1025
            P +    +++D  S  LYW  +    I    LN +S          ++L  +     ++ V+    YL++  +      +ER+  DG++R V+  + L +   L +D     LFW  +D ++ R++    +G +           P  LT     L +I+ +Q  +   E   GI    K    IA P  I + +   M           N  CS IC+   D   RCSC   +    N   C   PT
Sbjct:  983 PEKQPHDLSIDIYSHTLYWTCEGTNTINANKLNGES--------IGVVLRGDHDKPRAIAVNAERGYLYFTNMQERSPKIERAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFW--VDADLKRIESSDLSGANRVTLEDSNILQPMGLTILGDHLYWIDKQQQMIERVEKTNGIR-RTKIQGRIAHPTGIHAVESVDMNEFSAHPCSRNNGGCSHICITKGDGTPRCSCPVHLVLLQNLLTCGEPPT 1219          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Xenopus
Match: polk (polymerase (DNA directed) kappa [Source:Xenbase;Acc:XB-GENE-985768])

HSP 1 Score: 169.474 bits (428), Expect = 2.589e-41
Identity = 188/796 (23.62%), Postives = 337/796 (42.34%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQ---LWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPC--MNRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            S + +A DW+   LYW D +   IEV +LN           R++L  +++    ++ +DP   Y++W   G    +ER+ +DGS R+VI  + ++  + L ID   + L+W   D +   IHR +  G    S R +      +  F     G  ++  D Q   +   +   G      L +  +   I + S++ Q   P     +PC   N  CS +C L   +  Y C+C TG+    +   C T     L +     +  +SLD      + L  ++        YD V   + + D    +I           +R YLD       +++++  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  + +  +  Y++ T   +    IE  +LDG+++  +++S+   WP GLALD    +LY+ D  K D I V    GS R  +L  K       +   ++IYWT+ +  SI  V K   S   ++ +  +L    M + A S + +  T +PC   +  C  LCF    +     C C     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N++YW +     I +   N      +  F L  D    +AVD++  NLY S T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   K R     + +A++DG+  +++   V   ++L +D     + W   D+  I
Sbjct:   71 SPDGLACDWIGKKLYWTDSETNRIEVGNLN--------GTYRKVLFWQDLDQPRAIALDPAHGYMYWTDWGDTPRIERAGMDGSMRKVIVDTDIYWPNGLTIDLDEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTHPFALTLAGDTLYWTDWQTRSIHACNKRTGEKRREILSSLYSPMDIQVFSKERQPYFP-----TPCDESNGGCSHLCLLSPREPFYSCTCPTGVQLTQDGKTCKTGADDVLLLARRTDLRRISLDMPDFTDIVLQIDDIRHAIAIDYDPVEGYIYWTDDEVKAI-----------RRAYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILIS------------ENLDEPRAIVLHPLTGYMYWTDWGENP-KIESAYLDGSERMVLVNSSLG-WPNGLALDLQDGKLYWGD-AKTDKIEVINVDGSNRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKVRASREIIIDQLPDL----MGLKAASVSNTFGT-NPCADNNGGCSHLCF---FSPRGVRCSCPIGLELLSDMRTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVK---EASALDFDVSDNRLYWTDITLKTISRAFMNGSSVEHVIEFGL--DYPEGMAVDWMGKNLYWSDTGT--NRIEVSRL-----DGLYRQVLVWKDLDNP--RSLALDPAKGYMYWTEWGGKPR-----IVRAYMDGTNSIILVDKVGRANDLTIDYADQRLYWTDLDTNMI 790          

HSP 2 Score: 139.813 bits (351), Expect = 2.801e-32
Identity = 196/881 (22.25%), Postives = 358/881 (40.64%), Query Frame = 3
Query:  102 KSILHRHGVDIFFNTDLKLLAADV-------FLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFINDEQLWVSSFE----CGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKS----MLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTIS-----NLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILG-----------AVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            ++ L R  +D+   TD+ L   D+       +   + Y++   +  K++ +    + LD    + ++   VQ  + +AVDWV+ NLYW D     IEV  LN  S        R+IL+S N+ +  ++V+ P   Y++W   G    +E + LDGS+R V+  S L   + LA+D     L+W   D +  +++     G + +     +   P    FT  G  ++  D Q    S E          I +   P++  +   S  +          +PC   N  CS +C        RCSC  G+ E +++      P   L   +   I+ +SL+     +  PL  + E + + F    D   + L + D    +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + V+R+    R      +L W+               P  LA+D    Y++ T    G   I R ++DGT    ++          L +D   Q+LY+ D     + S N  G  + I+A        L+ + ++IYWT+    SI    K +G+ R+L+    +     +  I V  ++  D  + C   +  C QLC  +      + C CS+   +  N   CS  S  +++  K+    ML+    +P+       L        V ++  D     IYW++   N I+K A +   Q  + +   +          +L++D   + LY       W+                TN + + K+  + +G           A++V+++  +L++    T  ++   ++ +A  DG++  +L   G+     LVVD +   + W  +D  +I
Sbjct:  311 RTDLRRISLDMPDFTDIVLQIDDIRHAIAIDYDPVEGYIYWTDDEVKAIRR----AYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS--------RKILISENLDEPRAIVLHPLTGYMYWTDWGENPKIESAYLDGSERMVLVNSSLGWPNGLALDLQDGKLYWG--DAKTDKIEVINVDGSNRKT--LLEDKLPHIFGFTLLGDYIYWTDWQR--RSIERVHKVRASREIIIDQLPDLMGLKAASVSNTFGT------NPCADNNGGCSHLCF-FSPRGVRCSCPIGL-ELLSDMRTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDF----DVSDNRLYWTDITLKTISRAFMN--GSSVEHVIEFGL--DYPEGMAVDWMGKNLYWSDTGTNRIEVSRLDGLYRQ-----VLVWK-----------DLDNPRSLALDPAKGYMYWTEWG-GKPRIVRAYMDGTNSIILVDKVGR--ANDLTIDYADQRLYWTDLDTNMIESSNMLGAERVIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKLNGNNRTLIQDHLDF----VMDILVFHSSRQDGLNDCMQNNGHCSQLCLAV---PKGYKCSCSSHYTLDSNNRNCSPPSNFLLFSQKTAINRMLLDEQQSPDITLPIHGL------RNVKAVSYDPLDKLIYWVDGRQN-IIKRAKDDGTQPFVVVSTPNQSQTPEKQPHDLSIDIYSHTLY-------WT-------------CEGTNTINANKLNGESIGVVLRGDHDKPRAIAVNAERGYLYF----TNMQERSPKIERAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFWVDADLKRI 1100          

HSP 3 Score: 125.176 bits (313), Expect = 7.424e-28
Identity = 140/591 (23.69%), Postives = 227/591 (38.41%), Query Frame = 3
Query: 2985 CSQFCLPV-ESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLS--KNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNR 4727
            CSQ CL V +  +C C S Y+L ++   C   S+ L+    T     I   +L+E+      +    L      +       +YW+   +NI+ R  +       D T+P+V++    Q    E                        + L+ID  S TL W+   T  I A +LN      E +GV++  R    +P  IA+      L + +      +           IE +  DG  R VL     I P  L VD   G+++W+D             D  +I +  + G N     DS +   +G     + +L  +L+W D  QQ+   +   + I+ +   G   +          T +  +  +   +F +         HPCSR      N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+ +  RCD   +C D SDE  C  C+ S+ + C +   C+   ++C+G +DC   SDE  C S     +F C +G+    C+ +S +C+   DC D SDE  C++
Sbjct:  875 CSQLCLAVPKGYKCSCSSHYTLDSNNRNCSPPSNFLLFSQKTA----INRMLLDEQQSPDITLPIHGLRNVKAVSYDPLDKLIYWVDGRQNIIKRAKD-------DGTQPFVVVSTPNQSQTPEK---------------------QPHDLSIDIYSHTLYWTCEGTNTINANKLNG-----ESIGVVL--RGDHDKPRAIAVNAERGYLYFTNMQERSPK-----------IERAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFWVDA------------DLKRIESSDLSGANRVTLEDSNILQPMG-----LTILGDHLYWIDKQQQMIERVEKTNGIRRTKIQGRIAH---------PTGIHAVESVDMNEFSA---------HPCSR-----NNGGCSHICIT-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPEQFTCATGDI----------DCIPMAWRCDGFSECDDNSDEENCPVCS-SNQFQCEKGQ-CIDARQKCNGEIDCQDKSDELDCDSICLPDQFRCANGQ----CIMMSQQCDTFPDCSDSSDELICDK 1336          

HSP 4 Score: 75.0998 bits (183), Expect = 1.580e-12
Identity = 101/460 (21.96%), Postives = 178/460 (38.70%), Query Frame = 3
Query: 2955 PTHNHDNFLTCSQFCLPVESRE----CGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRY-SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSR 4316
            PT   ++   CS  CL +  RE    C C +   L+ DG TC   +D ++++         R ++     D  DF +                         IVL++D+     A+D    Y  ++ Y   +  E           +  +   + E      +A+D ++  L W+D  T  I   RLN    +I          E+   P  I + P++  + W   D+ ++            IE + LDG+ R VLV +  G P+ L +D+  G++YW D KT+K+  +++             G N K  ++  L +  GF+     +L  Y++WTDW ++   SI     ++ S  +         + D+L  ++ +         K++S+      +PC+       N  CSHLC  + P  +                 RCSCP+ + +    R
Sbjct:  258 PTPCDESNGGCSHLCL-LSPREPFYSCTCPTGVQLTQDGKTCKTGADDVLLLAR-------RTDLRRISLDMPDFTD-------------------------IVLQIDDIRHAIAID----YDPVEGYIYWTDDEVKAIRRAYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKIL-------ISENLDEPRAIVLHPLTGYMYW--TDWGENPK----------IESAYLDGSERMVLVNSSLGWPNGLALDLQDGKLYWGDAKTDKIEVINVD------------GSNRKTLLEDKLPHIFGFT-----LLGDYIYWTDWQRR---SIERVHKVRASREI---------IIDQLPDLMGL---------KAASVSNTFGTNPCAD-----NNGGCSHLCFFS-PRGV-----------------RCSCPIGLELLSDMR 600          

HSP 5 Score: 53.5286 bits (127), Expect = 4.478e-6
Identity = 58/248 (23.39%), Postives = 96/248 (38.71%), Query Frame = 3
Query:  288 PVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIA-PIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPT 1025
            P +    +++D  S  LYW  +    I    LN +S          ++L  +     ++ V+    YL++  +      +ER+  DG++R V+  + L +   L +D     LFW  +D ++ R++    +G +           P  LT     L +I+ +Q  +   E   GI    K    IA P  I + +   M           N  CS IC+   D   RCSC   +    N   C   PT
Sbjct:  986 PEKQPHDLSIDIYSHTLYWTCEGTNTINANKLNGES--------IGVVLRGDHDKPRAIAVNAERGYLYFTNMQERSPKIERAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFW--VDADLKRIESSDLSGANRVTLEDSNILQPMGLTILGDHLYWIDKQQQMIERVEKTNGIR-RTKIQGRIAHPTGIHAVESVDMNEFSAHPCSRNNGGCSHICITKGDGTPRCSCPVHLVLLQNLLTCGEPPT 1222          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Mouse
Match: Lrp5 (low density lipoprotein receptor-related protein 5 [Source:MGI Symbol;Acc:MGI:1278315])

HSP 1 Score: 269.626 bits (688), Expect = 3.811e-72
Identity = 368/1513 (24.32%), Postives = 599/1513 (39.59%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMR---VQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICL-PIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYP---NSRSLYLFMAD-SIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYG----FISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRN 4730
            S + +A DWV   LYW D +   IEV +LN  S        R++L  +++    ++ +DP   Y++W   G    +ER+ +DGS R++I  S ++  + L ID   + L+W   D +   IHR +  G    S R   V+G+     P  LT +   L + + +   + +    TG       +   +P+ I     +   P     +PC   N  CS +CL    +  Y C+C TG+    N   C T     L +     +  +SLD      + L   +        YD +   + + D    +I           +R YLD       ++++I  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  + +  +   ++ T   +    IE   LDG  +  V+ +T+  WP GLALD    +LY+ D  K D I V    G+KR  +L  K       +   +FIYWT+ +  SI  V K   S   ++ +  +L    M + AV+    + T +PC   +  C  LCF       +  CGC     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   K R     + +A +DG+  M +   V   ++L +D     + W   D+  I    ++ ++                        YP      S Y++  D +++ +  +D +S   R   T I   GH        FV   +   +     ++ D   + V       H N   C Q CL +     CGC S Y+L      C   S  L+                        F +   +S   I   Q   D V  L     ++  NY     FI  VD  +    IK+ K    Q   +   TS S++L     S +   + L+ID  S TL W+   T  I   RL+ D      +GV++  R  R +P  IA+      +      F+  +       H   IE + LDG  R VL     I P  L VD   G+++W+D             D  +I +  + G N     D+ +   VG     + VL ++L+W D  QQ+   +   +  K +   G     + +L     T +  +  ++ E+F +         HPC+R     +N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+    RCD   +C D SDE GC  C+ S  + C+R   C+ +  RCDG  DC   SDE  C +     +F C SG+    C+ I  +C+   DC DGSDE  C  N
Sbjct:  108 SPDGLACDWVGKKLYWTDSETNRIEVANLNGTS--------RKVLFWQDLDQPRAIALDPAHGYMYWTDWGEAPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTH--PFALTLSGDTLYWTDWQTRSIHACNKWTGEQRKEILSALYSPMDIQVLSQERQPPF---HTPCEEDNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKTCKTGAEEVLLLARRTDLRRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAI-----------RRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILVS------------EDLDEPRAIVLHPVMGLMYWTDWGENP-KIECANLDGRDRH-VLVNTSLGWPNGLALDLQEGKLYWGD-AKTDKIEVINIDGTKRKTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDL----MGLKAVNVAKVVGT-NPCADGNGGCSHLCF---FTPRATKCGCPIGLELLSDMKTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVK---EASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGL--DYPEGMAVDWMGKNLYWADTGT--NRIEVARL-----DGQFRQVLVWRDLDNP--RSLALDPTKGYIYWTEWGGKPR-----IVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQE---------------RMVIADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNR---TLIQ--GH------LDFVMDILVFHS-----SRQDGLNDCV-------HSNG-QCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSTFLL------------------------FSQKFAISRM-IPDDQLSPDLVLPLHGLRNVKAINYDPLDKFIYWVDGRQ---NIKRAKDDGTQPSML---TSPSQSL-----SPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDGDA-----MGVVL--RGDRDKPRAIAVNAERGYMY-----FTNMQD------HAAKIERASLDGTEREVLFTTGLIRPVALVVDNALGKLFWVDA------------DLKRIESCDLSGANRLTLEDANIVQPVG-----LTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQG----RVTHL-----TGIHAVEEVSLEEFSA---------HPCAR-----DNGGCSHICIA-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPDQFACTTGEI----------DCIPGAWRCDGFPECADQSDEEGCPVCSASQ-FPCARGQ-CVDLRLRCDGEADCQDRSDEANCDAVCLPNQFRCTSGQ----CVLIKQQCDSFPDCADGSDELMCEIN 1372          

HSP 2 Score: 129.028 bits (323), Expect = 3.953e-29
Identity = 202/874 (23.11%), Postives = 358/874 (40.96%), Query Frame = 3
Query:  102 KSILHRHGVDIFFNTDLKLLAADV-------FLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFT-EGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLM------VPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISS---TNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNK----SMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIF---CLSSD-TISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            ++ L R  +D    TD+ L   D+       +   + YV+   +  +++ +    + LD    + ++   +   + +AVDWV+ NLYW D     IEV  LN  S        R+IL+S ++ +  ++V+ P    ++W   G    +E + LDG DR V+  + L   + LA+D     L+W   D +  +++     G   +     +   P    FT  G  ++  D Q            SI        +   II +   LM      V +    +PC   N  CS +C      A +C C  G+    +   C   P   L   +   I+ +SL+     +  PL  + E + + F    D   + + + D +  +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + VAR+    R      +L W         R   N  P  LA+D    Y++ T    G   I R ++DGT   T++      ND     L +D   Q+LY+ D     + S N  G  + ++A        L+ + ++IYWT+    SI    K  G  R+L+    +     +  I V  ++  D  + C  ++ +C QLC  I G      CGC++   +  +   CS  S  +++  K     M+    L+P+       L        V ++  D     IYW++   N  +K A +   Q  +       LS D    +L++D     L+   T  A + I + RL      V    V+   + K +   A++V+++  ++++    T  + + A++ +A LDG++  +L   G+     LVVD     + W  +D  +I
Sbjct:  348 RTDLRRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRR----AYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS--------RKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLYWG--DAKTDKIEVINIDGTKRKT--LLEDKLPHIFGFTLLGDFIYWTDWQR----------RSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADGNGGCSHLCF-FTPRATKCGCPIGLELLSDMKTC-IIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDF----DVSNNHIYWTDVSLKTISRAFMN--GSSVEHVIEFGL--DYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFR-----QVLVW---------RDLDN--PRSLALDPTKGYIYWTEWG-GKPRIVRAFMDGTNCMTLVDKVGRAND-----LTIDYADQRLYWTDLDTNMIESSNMLGQERMVIADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDF----VMDILVFHSSRQDGLNDCVHSNGQCGQLCLAIPGGHR---CGCASHYTLDPSSRNCSPPSTFLLFSQKFAISRMIPDDQLSPDLVLPLHGL------RNVKAINYDPLDKFIYWVDGRQN--IKRAKDDGTQPSMLTSPSQSLSPDRQPHDLSIDIYSRTLF--WTCEATNTINVHRLDGDAMGV----VLRGDRDKPR---AIAVNAERGYMYF----TNMQDHAAKIERASLDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRI 1135          

HSP 3 Score: 119.013 bits (297), Expect = 4.358e-26
Identity = 201/965 (20.83%), Postives = 354/965 (36.68%), Query Frame = 3
Query: 1104 LSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTP-QRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGG-SKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDG-SQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFC-LPVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSD--------LDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDW 3959
            L + A + F+F+  +V     + D +  +I    LN+ G   Q   +   +S D    +A D   + +YW +   + + VA ++  +R      +L WQ            +QP   +A+D  + Y++ T   +    IER  +DG+ +  ++ S + +WP GL +D   Q+LY+ D     +   N  G   ++++        +L+   + +YWT+ +T SIH+  K+ G  R  +          M +  +S+       +PC   +  C  LC  +   +  +SC C     +  N   C   +E ++   +   +        D   I L  G+    +A +  D     +YW +     I +  +  D      +     +    +AVD++  NLY + T +   RI + RL  T        ++VS  +      A+ +H  +  ++W      D     ++  A+LDG  + +L+   +   + L +D Q   + W  + + KI   E++N   ++ +         +    +  HI+      +  + D IY           T  Q   I  V      R          +  K + +AK  +GT           D    CS  C     + +CGC     L +D  TC+ + +  +V T+   I  I     N  D  I      E S    +     I   YW   ++ L+  +  F++                 S  EH I+    Y E               +A+D +   L W+D  T  I   RL+              FR+                L+W   D  +S   D +  + +W E           +DG     LV   G  + LT+D    R+YW D  TN             I + +++G    V  D  L    G +  S      Y++WTDW
Sbjct:   61 LEDAAAVDFQFSKGAV----YWTDVSEEAIKQTYLNQTGAAAQNIVISGLVSPD---GLACDWVGKKLYWTDSETNRIEVANLNGTSRK-----VLFWQ----------DLDQPRA-IALDPAHGYMYWTDWGEAP-RIERAGMDGSTRKIIVDS-DIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKWTGEQRKEILSAL---YSPMDIQVLSQERQPPFHTPCEEDNGGCSHLCL-LSPREPFYSCACPTGVQLQDNGKTCKTGAEEVLLLARRTDLRRISLDTPDFTDIVLQVGDIRHAIA-IDYDPLEGYVYWTDDEVRAIRR--AYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGT--DRIEVTRLNGTSR-----KILVSEDLDEP--RAIVLHPVMGLMYW-----TDWGENPKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKI---EVINIDGTKRK---------TLLEDKLPHIFG-----FTLLGDFIYW----------TDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKV-VGTNPCA-------DGNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCI-IPEAFLVFTSRATIHRISLET-NNNDVAIPLTGVKEASALDFDVSNNHI---YW--TDVSLKTISRAFMNG----------------SSVEHVIEFGLDYPEG--------------MAVDWMGKNLYWADTGTNRIEVARLDG------------QFRQ---------------VLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTN------------MIESSNMLGQERMVIADD-LPYPFGLTQYS-----DYIYWTDW 862          

HSP 4 Score: 84.3445 bits (207), Expect = 1.847e-15
Identity = 139/626 (22.20%), Postives = 242/626 (38.66%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLD-------------------------GEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGIT-EPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP---ISSD-IPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCS 2009
            LKT + + ++   +  V++F +   E +AVDW+  NLYWAD     IEV  L  D  F      R++L+ R++ +  SL +DP + Y++W + G    + R+ +DG++   +   +  +++ L ID   + L+W  LD                         G     DY   T  ++       + S    T  +G L F+ D  ++ SS +   G++  + +N     +        L +P G                      +RC C++  T +P +    P  P+  L       I  M  D  L P L L            YD +   + +VD       ++   K    Q   L  P   +S D  P  +++D  SR ++W     + + V R+          ++L           R  +++P   +AV++   Y++ T + D    IER  LDGT++  V+ +T    P  L +D    +L++VD     + S +  G ++  L      + + L+     +YW + +   I  V K  G  R+ V            V  VS      +  PC   +  C  +C  I     +  C C     +L N+  C 
Sbjct:  695 LKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARL--DGQF------RQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKV-GRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERMVIADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQ--DGLNDCVHSNGQCGQLC-------LAIPGG----------------------HRCGCASHYTLDPSSRNCSP--PSTFLLFSQKFAISRMIPDDQLSPDLVLPLHGLRNVKAINYDPLDKFIYWVDGRQ----NIKRAKDDGTQPSMLTSPSQSLSPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDG----DAMGVVL-----------RGDRDKPRA-IAVNAERGYMYFTNMQDHAAKIERASLDGTER-EVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGIHAVEEVSLEEF--SAHPCARDNGGCSHIC--IAKGDGTPRCSCPVHLVLLQNLLTCG 1253          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Mouse
Match: Lrp4 (low density lipoprotein receptor-related protein 4 [Source:MGI Symbol;Acc:MGI:2442252])

HSP 1 Score: 198.364 bits (503), Expect = 3.841e-50
Identity = 299/1325 (22.57%), Postives = 516/1325 (38.94%), Query Frame = 3
Query:   69 VFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPF-------RFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHG--GSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVA---------SLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADS-IYQVTLSDSSSSITRKQLTFISNV----GHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVESR-ECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDW 3959
            V L+A+   + + + HR    +  N     +A D F  R+  VF        +L+    + L+   + +V+   ++S   +AVDWV   LYW D     IEV +L+           R++LL +++    ++ + P E  ++W   G    +E S +DGS RR+I  + LF  + L ID   + ++W  +D + H ++     G   +   +     P  +T  E  L + +     ++S    TG +  +  N    P+ I +  H    P G+ +    N  C+ +CLP     Y C+C TG  + IN+  C     + L       I  +S D       E LS++  IP           +DS    + + D ++ +I     +  GT Q   +D  + S  P  +A+D  +  +YW +     + VA      R    T+L+            ++    P D+ V+ +  Y++ T     +  IER  +D + +  +ISS N  WP GLA+D   Q+LY+ D     M ++ + G  GSKR  ++  +      L+ +   IYWT+ +T SI S      +  L  +T   +   +  I V         + C   +  C  LC     N   FSC C    ++L +   CS      + F + + +      + D  Y       +DV V          ++ +D    ++YW +   + I +  ++ D  +   I      T   LAVD I   +Y       W+     R+   + D S   V+V   + +    A+ ++ ++ F++W      D    A+L ++ +DGS + +LI   +   + L VD+ ++ + W  + + +I   E+ +   +                     + P      L + DS IY       + SI R   +  SNV     +  G+     V R+  +   K               C + N      CS  CLP  S   C C +   L  D  TC    +  ++ ++ G I      I  + DD  D          P+               N V+ LD       V  T  ++ + +   L         + S  E +  H      +   LA+D ++  L W+D     I A RL+    +     V+IN   S   P  IA+ P    L W   D+           H   IE ++LDG+ R VL+    G P+ LT+D  + RIYW+D   +++    ++    Q+   HV  H   +T                    ++++WTDW
Sbjct:  441 VLLFANRIDIRQVLPHRSEYTLLLNNLENAIALD-FHHRRELVFWSDVTLDRILR----ANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLD--------GAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYW--VDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHT-LHPQRQPAGKNRCGDNNGGCTHLCLP-SGQNYTCACPTGFRK-INSHACAQSLDKFLLFARRMDIRRISFD------TEDLSDDV-IPLADVRSAVALDWDSRDDHVYWTDVSTDTISRAKWD--GTGQEVVVDTSLES--PAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMR----TVLI------------WENLDRPRDIVVEPMGGYMYWTDWG-ASPKIERAGMDASSRQVIISS-NLTWPNGLAIDYGSQRLYWADA---GMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGQRIYWTDWQTKSIQSAD---RLTGLDRETLQENLENLMDIHVFHRQRPPVTTLCAVENGGCSHLCL-RSPNPSGFSCTCPTGINLLRDGKTCSPGMNSFLIFARRIDVR---MVSLDIPYF------ADVVVPINMTMKNTIAIGVDPLEGKVYWSDSTLHRISR--ASLDGSQHEDIITTGLQTTDGLAVDAIGRKVY-------WTDTGTNRIEVGNLDGSMRKVLVWQNLDSPR--AIVLYHEMGFMYW-----TDWGENAKLERSGMDGSDRTVLINNNLGWPNGLTVDKTSSQLLWADAHTERI---EVADLNGANRHTL----------------VSPVQHPYGLTLLDSYIYWTDW--QTRSIHRADKSTGSNVILVRSNLPGLMDIQAVDRAQPLGFNK---------------CGSRNG----GCSHLCLPRPSGFSCACPTGIQLKGDRKTCDPSPETYLLFSSRGSIR----RISLDTDDHTDV-------HVPVPG------------LNNVISLDYDSVHGKVYYTDVFLDVIRRADL---------NGSNMETVIGHGLK---TTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRK-----VLIN--NSLDEPRAIAVFPRKGYLFW--TDWG----------HIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHV-SHPFALTQQD-----------------RWIYWTDW 1574          

HSP 2 Score: 141.354 bits (355), Expect = 7.508e-33
Identity = 160/658 (24.32%), Postives = 274/658 (41.64%), Query Frame = 3
Query:  222 SLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIAL-KTN-PNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAH---------VLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQ 2159
            S L   + + LD  +  D++   +Q+ + +AVD +   +YW D     IEV +L+           R++L+ +N+    ++V+     +++W   G    LERS +DGSDR V+  + L   + L +D+    L W   D    R++     G +     +  Q  P  LT  +  + + + +   +   +  TG ++ L ++N P +  I  + R      P G  K    N  CS +CLP   S + C+C TGI    +   C   P   L   +   I  +SLD      + +            YDSV   + Y D     I   DLN  G+     +   + +     +AVD  +RN+YW +   + +  +R+    R     +L++     +  E R         +AV     YLF T        IER  LDG+++  +I+ T+  WP GL LD   +++Y+VD     + S + +G  +++L        +L+  D +IYWT+ +T SI  V K+ G  R+  T   N++   M +I VS      T + C   +  C  LCF        F C C +            ++    R +  +E       ++  T H +    +  +E   G    + A L L  + N+
Sbjct: 1100 STLHRISRASLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLD--------GSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSDRTVLINNNLGWPNGLTVDKTSSQLLW--ADAHTERIEVADLNGANRHTLVSPVQ-HPYGLTLLDSYIYWTDWQTRSIHRADKSTGSNVILVRSNLPGLMDIQAVDRAQ----PLGFNKCGSRNGGCSHLCLP-RPSGFSCACPTGIQLKGDRKTCDPSPETYLLFSSRGSIRRISLDTDDHTDVHVPVPGLNNVISLDYDSVHGKVYYTDVFLDVIRRADLN--GSNMETVIGHGLKT--TDGLAVDWVARNLYWTDTGRNTIEASRLDGSCR----KVLIN----NSLDEPRA--------IAVFPRKGYLFWTDWGH-IAKIERANLDGSERKVLIN-TDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSG--RNKETVLANVEG-LMDIIVVSPQRQTGTNA-CGVNNGGCTHLCF---ARASDFVCACPDEPDGHPCSLVPGLVPPAPRATSMNEKSPVLPNTLPTTLHSSTTKTRTSLEGAGGRCSERDAQLGLCAHSNE 1712          

HSP 3 Score: 62.003 bits (149), Expect = 1.161e-8
Identity = 49/129 (37.98%), Postives = 63/129 (48.84%), Query Frame = 3
Query: 4356 CDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ-C-------CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            C  +Q PC +G  F    G+    C++   RCD   DC D SDE  C T   +      RS  C+ ++ RCDG  DC  +SDE+ C       C S +F C +G    RC+     CNGI DC D SDE
Sbjct:  225 CSSHQ-PCRSG-EFMCDSGL----CINSGWRCDGDADCDDQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQFLCWNG----RCIGQRKLCNGINDCGDSSDE 343          

HSP 4 Score: 55.4546 bits (132), Expect = 1.029e-6
Identity = 59/262 (22.52%), Postives = 104/262 (39.69%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLST 4205
             LA+D + D L W+D  T  I    L+    ++          +S  +P  IA+ P+  ++ W   D+  +            IE S +DG+ R ++       P+ LT+D    R+YW+D K            ++ I   ++ G + K  +   L +       ++ V +  L+WTDW  +     S+NS  K +        N + +++KL   + I   + P            Q  P  +      N  C+HLCL +
Sbjct:  515 GLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVL-------LWQSLEKPRAIALHPMEGTIYW--TDWGNTPR----------IEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAK------------HHVIERANLDGSHRKAVISQGLPHPF-----AITVFEDSLYWTDWHTK-----SINSANKFTGK------NQEIIRNKLHFPMDIHT-LHP------------QRQPAGKNRCGDNNGGCTHLCLPS 716          

HSP 5 Score: 54.6842 bits (130), Expect = 1.593e-6
Identity = 55/190 (28.95%), Postives = 72/190 (37.89%), Query Frame = 3
Query: 4326 GFCVKSQLVKCD-------RYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNT------CNISHLY--------------------------SCSR------------SDVCLPITKRCDGVMDCD--SDEQ-----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            G+C++S L  CD            C       K+   S  SC++    CD   DC DGSDE  C +      CN+                               CS             S +C+    RCDG  DCD  SDE+      C +++F C SG    RC+ +S RC+G  DC D SDE  C
Sbjct:  120 GYCIRS-LWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEESCPSAVPSPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINSGWRCDGDADCDDQSDERNCTTSMCTAEQFRCRSG----RCVRLSWRCDGEDDCADNSDEENC 304          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Mouse
Match: Lrp6 (low density lipoprotein receptor-related protein 6 [Source:MGI Symbol;Acc:MGI:1298218])

HSP 1 Score: 164.081 bits (414), Expect = 8.143e-40
Identity = 184/812 (22.66%), Postives = 335/812 (41.26%), Query Frame = 3
Query:  219 KSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFI--NDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICL-PIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            +  +K   F+K +   +++V+   + S + +A DW+   LYW D +   IEV +L+           R++L  + +    ++ +DP   +++W   G +  +ER+ +DGS R VI  + ++  + L +D   + L+W   D +   IH+ +  G T     V+G+     P  LT  E  L +   N   +   +   G G+    + + NI     I    Q   P         N  CS +CL   V   Y+C+C TG+    N   C    T  L +     +  +SLD      + L  E+        YD V   + + D    +I    ++  G+       F +++ I  P  IAVD  +RN+YW +     + V R++   R     +L+S            +  + P  + +D +  Y++ T   +    IER  LDG+ +  V+ +T+  WP GLALD     +Y+ D     +  +N  G  +R+L + K       +   +++YWT+ +  SI  V    + R ++      D   +   +V R   I   +PC   +  C  LC           C C     ++ ++  C      +++  ++ +    L  N +   I L   +   + ++L  D   N+IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + +L   H  V     + S +       A+++     F++W E   K +     + +A +DGS+   +   V   + L +D     + W   D+  I
Sbjct:   72 EEAIKRTEFNKTE--SVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLD--------GSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFVIINTEIYWPNGLTLDYQERKLYW--ADAKLNFIHKSNLDG-TNRQAVVKGSLPH--PFALTLFEDTLYWTDWNTHSILACNKYTGEGLR---EIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGS------QFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMR----KILIS------------EDLEEPRAIVLDPMVGYMYWTDWGE-IPKIERAALDGSDR-VVLVNTSLGWPNGLALDYDEGTIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLP-DLMGLKATSVHR---IIGSNPCAEDNGGCSHLCL---YRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVK---EASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGL--DYPEGMAVDWLGKNLYWADTGT--NRIEVSKLDGQHRQVLVWKDLDSPR-------ALALDPAEGFMYWTEWGGKPK-----IDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLI 815          

HSP 2 Score: 150.599 bits (379), Expect = 1.129e-35
Identity = 191/818 (23.35%), Postives = 349/818 (42.67%), Query Frame = 3
Query:  276 VLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFIND------EQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLD-ARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCF--PIRGNQHSFSCGCSNRAHVLLNISR--CSYSSEMIVYFNKS----MLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILG-----------AVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            V+   +   + +AVDWV+ NLYW D     IEV  LN           R+IL+S ++ +  ++V+DP   Y++W   G I  +ER+ LDGSDR V+  + L   + LA+D     ++W   D +  +++     G   RV    K   P    FT  G  V+  D      E++   S E      + +   P++  +   S      V R    +PC   N  CS +CL       RC+C  G  E I++      P   L       I  +SL+     +  PL  + E + + F    D   + + + D +  +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + V+++   +R      +L W+               P  LA+D    +++ T    G   I+R  +DG+++ T++ +       GL +D  +++LY+ D     + S +  G ++ ++A        L+ + ++IYWT+    SI    K  G  R+++    +LD    + V   SR A  +    C S++  C  LC   P+ G    F CGC   AH  LN     CS  +  +++  KS    M+I    +P+       +    S   V ++  D    Q+YWI+   N I K   +       + F + +++++N  ++    +L   + S            + +     TNV+  T++  + +G           A+ V+ +  ++++    T  ++   ++ +A LDG++  +L + G++    L +D +   + W  SD  +I
Sbjct:  397 VVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLN--------GTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGTIYWG--DAKTDKIEVMNTDGTGRRVLVEDK--IPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAE----REVIIDQLPDLMGLKATS------VHRIIGSNPCAEDNGGCSHLCL-YRPQGLRCACPIGF-ELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDF----DVTDNRIYWTDISLKTISRAFMN--GSALEHVVEFGL--DYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQ-----VLVWK-----------DLDSPRALALDPAEGFMYWTEWG-GKPKIDRAAMDGSERTTLVPNVGR--ANGLTIDYAKRRLYWTDLDTNLIESSDMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG--HLDYVMDILVFHSSRQAGWNE---CASSNGHCSHLCLAVPVGG----FVCGCP--AHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDI------ILPIHSLRNVRAIDYDPLDKQLYWIDSRQNSIRKAHEDGG-----QGFNVVANSVANQNLEIQPYDLSIDIYSR-----------YIYWTCEATNVIDVTRLDGRSVGVVLKGEQDRPRAIVVNPEKGYMYF----TNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSKLGKLFWADSDLRRI 1126          

HSP 3 Score: 116.316 bits (290), Expect = 3.472e-25
Identity = 216/1090 (19.82%), Postives = 408/1090 (37.43%), Query Frame = 3
Query: 1104 LSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR-ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDG-SMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCF--PIRGNQHSFSCGCSNRAHVLLNISRCS-YSSEMIVYFNKSMLITHHL-TPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTI--SNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCL-PVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFW--------IEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSR 4316
            L + A + F F +      + + D +  +I   + NK  + Q   +   +S D    +A D     +YW +   + + V+ +    R      +L WQ          + +QP   +A+D  + +++ T   +    IER  +DG+ +F +I+ T  +WP GL LD   ++LY+ D     +   N  G +++ ++        +L+ F++ +YWT+  T SI +  K+ G  +R + +   +     M + A S+    +  +PC   +  C  LC   P++     + C C     +L N   C   ++E+++   ++ L    L TP+     ++L   E      ++  D     IYW +     I ++     I      F +++       +AVD++  NLY + T +   RI + RL  T        +++S  ++     A+ +   + +++W      D   + ++ +A LDGS + +L+   +   + L +D     + W  + + KI   E++N   +  ++ ++             HI+      +  + D +Y       S     K+                    R + I      +         +I       DN   CS  CL   +   C C   + L +D  TC+ + +  ++ +   +I  I     N  +  I      E S    +      + +YW   +I L+  +  F++                 S  EH ++    Y E +              A+D +   L W+D  T  I   +L+    ++                           L+W   D  ++   D +    +W        I+ + +DG+ R+ LV N G  + LT+D    R+YW D  TN             I +  ++G N +V  D  L +  G +       + Y++WTDW ++     +  S    +   G    +L Y+ D L              F SS        + C+ +     N  CSHLCL+ +P+                G F C CP   S+   +R
Sbjct:   50 LEDAAAVDFVFGH----GLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPD---GLACDWLGEKLYWTDSETNRIEVSNLDGSLRK-----VLFWQ----------ELDQPRA-IALDPSSGFMYWTDWGE-VPKIERAGMDGSSRFVIIN-TEIYWPNGLTLDYQERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFS----PMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVK---PFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQL---EDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSF----IDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGT--DRIEVTRLNGTMR-----KILISEDLEEP--RAIVLDPMVGYMYW-----TDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGTIYWGDAKTDKI---EVMNTDGTGRRVLVEDKIP---------HIFG-----FTLLGDYVYWTDWQRRSIERVHKR-----------------SAEREVIIDQLPDLMGLKATSVHRIIGSNPCAEDNG-GCSHLCLYRPQGLRCACPIGFELISDMKTCI-VPEAFLLFSRRADIRRISLET-NNNNVAIPLTGVKEASALDFDVTD---NRIYW--TDISLKTISRAFMNG----------------SALEHVVEFGLDYPEGM--------------AVDWLGKNLYWADTGTNRIEVSKLDGQHRQV---------------------------LVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTN------------LIESSDMLGLNREVIADD-LPHPFGLTQ-----YQDYIYWTDWSRRSIERANKTSGQNRTIIQG----HLDYVMDILV-------------FHSSRQAGW---NECASS-----NGHCSHLCLA-VPV----------------GGFVCGCPAHYSLNADNR 927          

HSP 4 Score: 108.997 bits (271), Expect = 4.869e-23
Identity = 149/634 (23.50%), Postives = 235/634 (37.07%), Query Frame = 3
Query: 2985 CSQFCL--PVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLV-KNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSVALSACSFAIIYIC 4859
            CS  CL  PV    CGC + YSL+AD  TC   +  L+    +     I   +++E+      +    L              +YW+      R ++               I+K  +   Q  ++  ++  ++NL       E   Y L+ID  S  + W+   T +I   RL+        +GV++  +  + RP  I + P    + + +      +           IE + LDG  R VL       P  L +D   G+++W D+            D  +I +  + G N  V  DS +   VG     + V + +L+W D  QQ+   I +                    + + K   RI         K  +L    Q HPC++     +N  CSH+CL                  + DG  RCSCP+ + +          C   +   C   Q  C  G +           C+ V  RCD   +C D SDE+ C  C+ S  + C+ S  C+    RC+G  +C   SDE+ C       +F C +G+    C+    +C+  VDC D SDE  C          T +PA         TV  + G +     S  I +IC
Sbjct:  900 CSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSA----INRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDS----RQNS---------------IRKAHEDGGQGFNVVANSVANQNL-------EIQPYDLSIDIYSRYIYWTCEATNVIDVTRLDG-----RSVGVVL--KGEQDRPRAIVVNPEKGYMYFTNLQERSPK-----------IERAALDGTEREVLFFSGLSKPIALALDSKLGKLFWADS------------DLRRIESSDLSGANRIVLEDSNILQPVG-----LTVFENWLYWIDKQQQMIEKIDMTG-----------------REGRTKVQARIAQLSDIHAVKELNLQEYRQ-HPCAQ-----DNGGCSHICLV-----------------KGDGTTRCSCPMHLVLLQDELS----C--GEPPTCSPQQFTCFTGDI----------DCIPVAWRCDGFTECEDHSDELNCPVCSESQ-FQCA-SGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQ----CVGKHKKCDHSVDCSDRSDELDC--------YPTEEPAPQA----TNTVGSVIGVIVTIFVSGTIYFIC 1394          

HSP 5 Score: 107.842 bits (268), Expect = 1.306e-22
Identity = 134/606 (22.11%), Postives = 256/606 (42.24%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFIN--DEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSI----------FSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQK----FTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSR-NASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLL 1991
            LKT + + ++   +  V++F +   E +AVDW+  NLYWAD     IEV  L+         + R++L+ +++    +L +DP E +++W + G    ++R+ +DGS+R  +  ++  +++ L ID  ++ L+W  LD  +  ++     G +  V        P  LT  +  + + +     +  ++   G   +I       +  I +     Q     G  +    N  CS +CL +    + C C    +   +N  C + PT  L       I  M +D    P + L   +        YD +   L ++D   +SI          F++  N     Q   +        P  +++D  SR IYW     + + V R+      +   ++L           + +Q++P   + V+    Y++ T + + +  IER  LDGT++    F+ +S      P  LALD    +L++ D+    + S +  G ++ +L      + + L+ F+N++YW + +   I   K D + R   TK +   A+   + AV   N       PC   +  C  +C  ++G+    +  CS   H++L
Sbjct:  683 LKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLD--------GQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNV-GRANGLTIDYAKRRLYWTDLDTNL--IESSDMLGLNREVIAD-DLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQA----GWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTC-SAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNSIRKAHEDGGQGFNVVANSVAN-QNLEIQ-------PYDLSIDIYSRYIYWTCEATNVIDVTRLDG----RSVGVVL-----------KGEQDRPRA-IVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSK-----PIALALDSKLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIE--KIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICL-VKGDG---TTRCSCPMHLVL 1236          

HSP 6 Score: 72.4034 bits (176), Expect = 6.708e-12
Identity = 167/803 (20.80%), Postives = 292/803 (36.36%), Query Frame = 3
Query: 1983 VLLNISRCSY-----SSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNT--DIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRG-VADIDELVVDEQANYVCWKSSDSGKIYRYEI--VNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSS----SSITRKQLTFI-SNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCL--PVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRY----------SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQF-WIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSV 4301
            VL ++  CS+     ++ +++Y N+  L     T   +   I +G G  D         H    IYW + +   I +T  N    +Q  +    LS D    LA D++   LY       W+     R+  ++ D S   V+   ++      A+++     F++W      D   V ++ +A +DGS   +I    +   + L +D Q   + W  +    I++  +   NR+                  +      P+  +L LF  D++Y    +  S    +  T + L  I SN+     I  FS   +  A +   I                    DN   CS  CL  PV+   +C C +   L  +G TC D +  L+++         R ++     D  DF +                         IVL+L++     A+D    Y  ++ Y   +  E            + + F     S++           +A+D ++  L W+D  T  I   RLN    +I          E    P  I + P+   + W               W +   IE + LDG+ R VLV    G P+ L +D   G IYW D KT+K+  ++              G   +V V+  + +  GF+     +L  Y++WTDW ++    +   S  +            + + D+L  ++ +         K++S+  ++ ++PC+      +N  CSHLCL   P  L                 RC+CP+   +
Sbjct:    4 VLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVG-GLEDAAAVDFVFGH--GLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPD---GLACDWLGEKLY-------WTDSETNRIEVSNLDGSLRKVLFWQELDQP--RAIALDPSSGFMYW-----TDWGEVPKIERAGMDGSSRFVIINTEIYWPNGLTLDYQERKLYWADAKLNFIHKSNLDGTNRQ------------------AVVKGSLPHPFALTLF-EDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGI--------------------DNG-GCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLAR-------RTDLRRISLDTPDFTD-------------------------IVLQLEDIRHAIAID----YDPVEGYIYWTDDE---------VRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKIL-------ISEDLEEPRAIVLDPMVGYMYWTD-------------WGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGTIYWGDAKTDKIEVMNTD------------GTGRRVLVEDKIPHIFGFT-----LLGDYVYWTDWQRRSIERVHKRSAER------------EVIIDQLPDLMGL---------KATSVHRIIGSNPCAE-----DNGGCSHLCLYR-PQGL-----------------RCACPIGFEL 620          

HSP 7 Score: 64.6994 bits (156), Expect = 1.496e-9
Identity = 64/242 (26.45%), Postives = 106/242 (43.80%), Query Frame = 3
Query:  309 VAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPT 1025
            +++D  S  +YW  +    I+V  L+  S          ++L        ++VV+P + Y+++  +      +ER+ LDG++R V+  S L K   LA+D     LFW   D ++ R++    +G +  V        P  LT  E  L +I+ +Q  +   +  TG     K    IA ++ I    +L + +  R+ PC   N  CS ICL   D   RCSC   +    +   C   PT
Sbjct: 1019 LSIDIYSRYIYWTCEATNVIDVTRLDGRS--------VGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSKLGKLFW--ADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDM-TGREGRTKVQARIAQLSDIHAVKELNL-QEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPT 1248          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Mouse
Match: Lrp1 (low density lipoprotein receptor-related protein 1 [Source:MGI Symbol;Acc:MGI:96828])

HSP 1 Score: 162.925 bits (411), Expect = 3.331e-39
Identity = 347/1644 (21.11%), Postives = 620/1644 (37.71%), Query Frame = 3
Query:   72 FLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRK-LYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKS--SQLAIDRHRKMLFWWGLDGE-IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFIND---EQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNR----VCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLS----ENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVS--IAVDSASRNIYWMNH--RNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRI---LAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQP-MLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLF----MADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVESRECGCGSVYS-LSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELS-EQPINAG-QKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFW--IEMSDLDG-NRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIF--ASISVNSDIK------PSAAMGM--------------------HFYNLQYLKDKLKTVVRIM-ARIAPEDFKSSSLGTLLQNHPCSRASHEME--NKRCSHLCLSTLPIS----LAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKS-RHKIGFCVK-SQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLY----------SCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQK--------FECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNR 4727
             ++++ H + +  LH+    +        +A D  LS+  LY   + E+     K  +   L   ++  V+++ + + E +AVDW++GN+YW +     IEV  L+           R  LL+ ++    ++ +DP +  LFW    A +  +E + + G+ RR IH+        + L +D   K + W     + I+   Y G     M V    +  S  F     G  V+  D     L  ++   G  +++  +TN     + +     Q M P     +PC        CS +CL   +    C+C   +    +N  C  F  + L      +I  + LD      +   +    +N  +     YD+    + + D  + +I    +N  G      ++  +S+D+P +  +AVD  SRN++W ++     ++ VAR+                   +FK +  Q  + P  L V  +   L+    TDG  +I    +DG+    + S      P GLA+D    +LY++ +    +   N  G    +   +  +  +  +L+   + ++W +  +  + +  K DGS  S+V +        M V   S     +  +PC   +  C QLC P   ++ + SC C+    +      C      ++Y     +    L PN     +    G S      +      + IYW++   + I +   +   +  +    +    +  +AVD+I  N+Y   T   +  I + RL     + S+  VV+S  +      A++VH +  +LFW E     R     + ++ LDG++  +L+   ++  + + VD Q   + W  +   KI R ++   +  E                    +  +S ++ +F      D IY    + ++ SI R       N   S  +R        I +  K I +   D   +   +C   N      C Q CL     +  C   +  L+ DGA+C + +  L+    T                    ++ + LS E+ +NA  Q F D  + +   I L  D     S     R +     +  +     D    T+  EN+         S   LA     DTL W+ + T  I    ++  +        +I        P    +    + + W +             W++    I  + L G N  +++ K+   P+ L +D  + ++Y+ D   +K+                  G +  V + S   +  G     + V  +++FWTDW ++    A+  V SD+K      P   MG+                       +L  L  +          RI  EDF   ++     N  C RA  E E  N  C    L+   +S     ++E      +++    FR  C     V++    + +  C   S  + C++    CG G  F  ++G    SC+    RC+  VDC D SDE+ C+T + S  +           C R+ +C   +  CDG  DC   SDE+ C   K        F C SG    RC+P+S  C+   DC +G DE  CN+
Sbjct: 1272 IIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKIYRGKLLDNGALTSFEV--VIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLD--------GTLRTTLLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTIHRETGSGGWPNGLTVDYLEKRILWIDARSDAIYSARYDGSG--HMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAP-----NPCEANGGRGPCSHLCLINYNRTVSCACPHLMKLHKDNTTCYEF-KKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTV---LDYDAREQRVYWSDVRTQAIKRAFINGTG------VETVVSADLPNAHGLAVDWVSRNLFWTSYDTNKKQINVARLDG-----------------SFKNAVVQGLEQPHGLVVHPLRGKLY---WTDGD-NISMANMDGSNHTLLFSGQKG--PVGLAIDFPESKLYWISSGNHTINRCNLDGSELEVIDTMRSQLGKATALAIMGDKLWWADQVSEKMGTCNKADGSG-SVVLRNSTTLVMHMKVYDESIQLEHEGTNPCSVNNGDCSQLCLPT--SETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGTS--LAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGR--VEGIAVDWIAGNIY--WTDQGFDVIEVARL-----NGSFRYVVISQGLDKPR--AITVHPEKGYLFWTEWGHYPR-----IERSRLDGTERVVLVNVSISWPNGISVDYQGGKLYWCDARMDKIERIDLETGENRE--------------------VVLSSNNMDMFSVSVFEDFIYWSDRTHANGSIKRG---CKDNATDSVPLR------TGIGVQLKDIKVFNRDR-QKGTNVCAVANG----GCQQLCLYRGGGQRACACAHGMLAEDGASCREYAGYLLYSERT-------------------ILKSIHLSDERNLNAPVQPFEDPEH-MKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSGRTTIVENV--------GSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITM-SGDDHPRAFVLDECQNLMFWTN-------------WNELHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKIERCEYD------------GSHRYVILKSEPVHPFG-----LAVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVDIPQQPMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQEDFTCRAV-----NSSC-RAQDEFECANGECISFSLTCDGVSHCKDKSDEKPSYCNSRRCKKTFR-QCNNGRCVSNMLWCNGVDDCGDGSDEIPCNK--TACGVG-EFRCRDG----SCIGNSSRCNQFVDCEDASDEMNCSTTDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYFACPSG----RCIPMSWTCDKEDDCENGEDETHCNK 2733          

HSP 2 Score: 98.5969 bits (244), Expect = 1.039e-19
Identity = 131/560 (23.39%), Postives = 230/560 (41.07%), Query Frame = 3
Query:  192 YVFVIQENGKSLLKTANFSKL----DRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDR-RVIHKSILFKSSQLAIDRHRKMLFWWG--LDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDE----QLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRV------CSSICLPIVDS--AYRCSCSTGITEPINNAVCPTFPTRSLFI----GNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGT-----CSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ--KFQEFISLSYFDNFIYWTELETLSIHSVK 1781
            +V V     ++ LK A    L    D   +   +   +   E +A+DW++GN Y+ D  +  I V + N D+           LL   + +   + +DP    +F+   G I  +ER  +DG +R +++   I+F    + +D   ++++W    LD  I  VDY+G+ G    +QG   +     LT  E  L   N +    Q   S        S   +    +     +   HQ   PR R  + C N        CS ICL + +S  A  C C +G +   +   C   P   LF+    G P  I  M +   +     +  EN   P    + + T  + + D  S  I    ++  GT +   L   I +     +AVD    N+YW     ++    +  S  RL+ A      Q   T  E +      P  + VD +N +++ T   +         +ER W+DG+ +   ++S    WP GL+LD    +LY+VD     + ++  +G  ++I+ +  +      L +  N+++WTE  + S++ ++
Sbjct:  245 WVHVGDSAAQTQLKCARMPGLKGFVDEHTIN--ISLSLHHVEQMAIDWLTGNFYFVDDIDDRIFVCNRNGDT--------CVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTKLVDSKIVFPHG-ITLDLVSRLVYWADAYLD-YIEVVDYEGK-GRQTIIQGILIE-HLYGLTVFENYLYATNSDNANTQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHA-CENDQYGKPGGCSDICL-LANSHKARTCRCRSGFSLGSDGKSCKK-PEHELFLVYGKGRPGIIRGMDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKID--GTERETILKDGIHN--VEGVAVDWMGDNLYW-----TDDGPKKTISVARLEKAA-----QTRKTLIEGKMTH---PRAIVVDPLNGWMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLE 770          

HSP 3 Score: 82.8037 bits (203), Expect = 5.514e-15
Identity = 115/502 (22.91%), Postives = 174/502 (34.66%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLV-----------KCDRYQIPCGA-------GLVFSKKEGM---SVMSCMSVQQRCDSTVDCLDGSDEVGCN--TCNISHLYSCSRSDVCLPITKRCDG----------------------------------VMDCDSDEQC--------------CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
             LA+D +   L W D     I   +LN       Y  V+++     R P  + +   +  L W       ++  D S+     I    +DG+ RS++V      P+ LTVD  + RIYW D + + + +  +   N  +     I H   +T+                  + Y++WTDW      + S+N   K + A      +  +    L     +     P             NHPC     ++ N  CS+LCL +                   G  +C+CP +  +    R  +  C  SQ V           KCD  +  CG           F  + G    S   C +    CD   DC D SDE  C+   C +   + C+ ++ C+P   RC+G                                  V  CD D  C              CG  +F C   KD  RC+P   +C+G  DC DGSDE
Sbjct: 3107 GLAVDWVGGNLYWCDKGRDTIEVSKLNG-----AYRTVLVS--SGLREPRALVVDVQNGYLYW-------TDWGDHSL-----IGRIGMDGSGRSIIVDTKITWPNGLTVDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTL-----------------FEDYVYWTDW-----ETKSINRAHKTTGANKTLLISTLHRPMDLHVFHALRQPDVP-------------NHPC-----KVNNGGCSNLCLLSP-----------------GGGHKCACPTNFYLGGDGRTCVSNCTASQFVCKNDKCIPFWWKCDT-EDDCGDHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVC-LPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRC---KDSGRCIPARWKCDGEDDCGDGSDE 3527          

HSP 4 Score: 80.4925 bits (197), Expect = 2.562e-14
Identity = 67/237 (28.27%), Postives = 110/237 (46.41%), Query Frame = 3
Query: 1266 PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKT--RNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSC 1961
            P  +AVD    N+YW +     + V++++      Y T+L+S       +E R         L VD  N YL+ T   D +  I R  +DG+ + ++I  T   WP GL +D   +++Y+ D  + D I      GS R  +L+Q      +L+ F++++YWT+ ET SI+   K  G+ ++L+  T  R +D   + V    R   +    PC   +  C  LC    G  H  +C
Sbjct: 3105 PDGLAVDWVGGNLYWCDKGRDTIEVSKLNG----AYRTVLVS----SGLREPRA--------LVVDVQNGYLYWTDWGDHS-LIGRIGMDGSGR-SIIVDTKITWPNGLTVDYVTERIYWAD-AREDYIEFASLDGSNRHVVLSQDIPHIFALTLFEDYVYWTDWETKSINRAHKTTGANKTLLISTLHRPMD---LHVFHALRQPDV-PNHPCKVNNGGCSNLCLLSPGGGHKCAC 3318          

HSP 5 Score: 68.1662 bits (165), Expect = 1.556e-10
Identity = 129/602 (21.43%), Postives = 214/602 (35.55%), Query Frame = 3
Query: 2985 CSQFCLPVES---RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIV--LRLDNY---GFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSD-WVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI--PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSC------SRSDVCLPITKRCDGVMDCDSDE---------QCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            CS  CL   S   R C C S +SL +DG +C      L ++   G    IRG                      ++ G K  D      +N++    LD +   GFI   D T  Y++ ++           K D +  E + K       +   +A+D + D L W+D      I+  RL       + L            P  I + P++  + W   +    ++          +E + +DG+ R + V +  +  P+ L++D+ +GR+YW+D   +++  + ++  + +I           V     L++  G           YLFWT+     + S SV              Y L+         V ++    P  F+        Q    ++    + N  CS LCL+T                   G  +C+C     +       +         +C   +  C                C+  + +CD   DCLD SDE       + H ++C        ++ C+P    CDG  DC + E         + C   +F C SG    RC+PIS  C+   DC D SDE
Sbjct:  490 CSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRG----------------------MDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTS-YLIGRQ-----------KIDGTERETILKDGI---HNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTL-----IEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSRRGR------LERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETILLNGTDRKI-----------VYEGPELNHAFGLCHHG-----NYLFWTE-----YRSGSV--------------YRLERGVAGAPPTVTLLRSERPPIFEIRMYDAQQQQVGTNKC--RVNNGGCSSLCLAT------------------PGSRQCACAEDQVLDTDGVTCLANPSYVPPPQCQPGEFACANN------------RCIQERWKCDGDNDCLDNSDEAP----ALCHQHTCPSDRFKCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASG----RCIPISWTCDLDDDCGDRSDE 968          

HSP 6 Score: 64.3142 bits (155), Expect = 2.503e-9
Identity = 65/257 (25.29%), Postives = 109/257 (42.41%), Query Frame = 3
Query:  291 VQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKS-----PCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFI 1040
            + + + +AVDWV GNLYW D+    IEV  LN           R +L+S  + +  +LVVD    YL+W   G   ++ R  +DGS R +I  + +   + L +D   + ++W   D     +++    G +  V  +        LT  E  + + + E   ++     TG +  L        I+ + R   L V    R+      PC   N  CS++CL      ++C+C T      +   C +  T S F+
Sbjct: 3102 LSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLN--------GAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSGRSIIVDTKITWPNGLTVDYVTERIYW--ADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLFEDYVYWTDWETKSINRAHKTTGANKTLL-------ISTLHRPMDLHVFHALRQPDVPNHPCKVNNGGCSNLCLLSPGGGHKCACPTNFYLGGDGRTCVSNCTASQFV 3341          

HSP 7 Score: 62.003 bits (149), Expect = 1.307e-8
Identity = 35/117 (29.91%), Postives = 61/117 (52.14%), Query Frame = 3
Query:  279 LKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFW 629
            LK P      +A+DWV+GN+YW D     IEV  +  ++        R+ L+S  + + H++VVDP    ++W   G    +E + +DG+ R  + +  +   + LA+D H + L+W
Sbjct: 3958 LKMP----RGIAIDWVAGNVYWTDSGRDVIEVAQMKGEN--------RKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYW 4062          

HSP 8 Score: 61.6178 bits (148), Expect = 1.572e-8
Identity = 45/137 (32.85%), Postives = 68/137 (49.64%), Query Frame = 3
Query: 4353 KCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCN----TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ--------CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            +CD  Q  C +G             C+ ++ RCD+  DC+DGSDE  C     TC +   + C+ + +C P+  +CDG  DC  +SDE         C  ++ F C   K+   CL I  +C+G+ +C DG+DE  C
Sbjct: 3613 RCDMDQFQCKSG------------HCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDE-FQCNNT-LCKPLAWKCDGEDDCGDNSDENPEECARFICPPNRPFRC---KNDRVCLWIGRQCDGVDNCGDGTDEEDC 3732          

HSP 9 Score: 58.151 bits (139), Expect = 1.733e-7
Identity = 44/114 (38.60%), Postives = 57/114 (50.00%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDE---QC----------CGSQKFEC-LSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C+++  RCD+  DC D SDE GC+    S  + C+ S  C+P    CDG  DC   SDE    C          C S +F+C L G     C+P+  RC+G  DC D SDE  C
Sbjct:  990 CININWRCDNDNDCGDNSDEAGCSHSCSSTQFKCN-SGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHSDEFQCRLDG----LCIPLRWRCDGDTDCMDSSDEKSC 1098          

HSP 10 Score: 55.4546 bits (132), Expect = 1.174e-6
Identity = 37/106 (34.91%), Postives = 52/106 (49.06%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGC----NTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQKFECL-----SGKDVTRCLPISARCNGIVDCRDGSDE 4712
            C+ ++ RCD   DC+D SDE  C    + C+ +  + C  S  C+     CDG  DC+  SDE+ C  +   C         + + CLP    C+G  DC DGSDE
Sbjct: 1076 CIPLRWRCDGDTDCMDSSDEKSCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENC--EALACRPPSHPCANNTSVCLPPDKLCDGKDDCGDGSDE 1179          

HSP 11 Score: 54.6842 bits (130), Expect = 2.043e-6
Identity = 42/115 (36.52%), Postives = 57/115 (49.57%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCNT--CNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQ----KFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRAL 4748
            C+  + +CD   DC D SDE  C    C+ S  +SC+    C+    +CDG  DC   SDE+ C  +    +F+C SG     C+P+  RC+   DC DGSDE  C    R   L
Sbjct: 3549 CVPGRWQCDYDNDCGDNSDEESCTPRPCSESE-FSCANG-RCIAGRWKCDGDHDCADGSDEKDCTPRCDMDQFQCKSG----HCIPLRWRCDADADCMDGSDEEACGTGVRTCPL 3657          

HSP 12 Score: 53.5286 bits (127), Expect = 4.031e-6
Identity = 68/275 (24.73%), Postives = 114/275 (41.45%), Query Frame = 3
Query:  249 KLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQ-KNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWL------QIGAIMVLERSRLDGSDRR--VIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKT-------NPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPT 1025
            K+D  +   +LK  + + E VAVDW+  NLYW D    + I V  L        + + R+ L+   M    ++VVDP   +++W       +      LER+ +DGS R   V  K++L+ +  L++D     L+W  +D    R++     G   ++     + +  F     G  +F   E    S +    G++ A  T        P I  I +   + Q +   G  K    N  CSS+CL    S  +C+C+       +   C   P+
Sbjct:  588 KIDGTERETILKDGIHNVEGVAVDWMGDNLYWTDDGPKKTISVARLE------KAAQTRKTLIEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNG-LSLDIPAGRLYW--VDAFYDRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWT-EYRSGSVYRLERGVAGAPPTVTLLRSERPPIFEIRMYDAQQQQV---GTNKCRVNNGGCSSLCLATPGS-RQCACAEDQVLDTDGVTCLANPS 848          

HSP 13 Score: 53.1434 bits (126), Expect = 5.544e-6
Identity = 39/114 (34.21%), Postives = 48/114 (42.11%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCNTCNI---------SHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQKFEC-----LSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C+     CD   DC D SDE   N  N          S  + C    +C+P+  RCDG  DC   SDE+ C      C        KD  RC+  +  C+G  DC D SDE  C
Sbjct: 1028 CIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHSDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENC 1141          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Mouse
Match: Lrp2 (low density lipoprotein receptor-related protein 2 [Source:MGI Symbol;Acc:MGI:95794])

HSP 1 Score: 136.732 bits (343), Expect = 2.806e-31
Identity = 350/1566 (22.35%), Postives = 589/1566 (37.61%), Query Frame = 3
Query:  303 ESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDP--WEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWG--LDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFIN--DEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSA--YRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIP---FRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIP--------VSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCS-----IERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSML-----ITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWIN-----QAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKI-ALAKSDIGTESVILCPTHNHDNFLTCSQFC--LP-VESRECGCGSVYSLSADGATCV-DLSDLLMVMTNTG---------------EIIGIRGNIL----NEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSR-YSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETN-----DSSVWHQFWIEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGM--HFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQ------NHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCG-----AGLVFSKKEGMSVMS-----CMSVQQRCDSTVDCLDG--SDEVGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDE-------QCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            E +AVDW+  N+YW D   + IEV  ++           R +L+S+N+     L +DP   +  +FW   G    +ER+ +DG+ R VI +  ++    L+ID   +++++    LD  I   DY GQ      +        P  LT  E  + + +    Q+  ++   G   S+ + + P    I  I    Q   P     +PC +  CS +CL        Y C+C +G     ++  C       L       I+ +SLD       E+ S +A +P    +  YD        V+F+ S  F   +   G   R   D    +           + +A+D  SRNIY+    +  + V  +    R  Y   L++   +P            P  +AVD     L+ +    GT S     I    +DGT    ++ + N      + LD   Q+LY+  T +G +   N  G  + IL         L    +F+Y+++ +   I  V        +V +      R + V    RNA+ D+ + C +  N C Q+C P+ G    FSC C++   +  +   CS  +  IV    SML      +  L+ +++      G+G +   V    +D     IYW +     +++N I +   N      +  + + ++ I  +AVD++  NLY +      + I +IR+  T+  V    + VS  +   I+    V    ++LFW +   K +     + ++ LD + + +L+  G+     L VD    Y+ W       I R   ++R   E Q+                  YP    + +F  +SI  V  +        KQ     N      IR    + R + I  + +  L+ +++     +        +   CS FC  LP + + +CGC +  +L  DG  C     D L+   N                 + I + G  +    + +++ I F + +     PI     +++ +Y  + +  + L N G    +     +  I   +++   +   +T  S +E+          S+  ++ +DP    + W+DW T        NA   +IE   +  NFR          +  +++SL+W +      ET+     D+S+     IE S L G+ R V++        LT  V+   IYW D  T K+            RA    G ++      L +   G ST   VV  +    ++   Q     S      P+ A     H  +     D    VV   AR     F   +   + Q      ++ C   S E+      H C ST                     F C+               G CV     +CD Y   CG     AG +F      +  +     C+ +   C+   +C D   SDE  C   TC       C  +++C+P    CDG  DC   SDE         C S +F+C+S     RC+P    C+G  DC D SDE
Sbjct: 1513 EMIAVDWIGRNIYWTDYTLETIEVSKID--------GSHRTVLISKNVTKPRGLALDPRMGDNVMFWSDWGHHPRIERASMDGTMRTVIVQEKIYWPCGLSIDYPNRLIYFMDAYLD-YIEFCDYDGQNR-RQVIASDLVLHHPHALTLFEDSVFWTDRGTHQVMQANKWHGRNQSVVMYSVPQPLGIIAIHPSRQPSSP-----NPCASATCSHLCLLSAQEPRHYSCACPSGWNLSDDSVNCVRGDQPFLISVRENVIFGISLD------PEVKSNDAMVPISGIQHGYD--------VEFDDSEQFIYWVENPGEIHRVKTDGSNRTAFAPLSLLGSSLGLALDWVSRNIYYTTPASRSIEVLTLRGDTR--YGKTLITNDGTPLGVGF-------PVGIAVDPARGKLYWS--DHGTDSGVPAKIASANMDGT-SLKILFTGNMEHLEVVTLDIQEQKLYWAVTSRGVIERGNVDGTERMILVHHLAHPWGLVVHGSFLYYSDEQYEVIERVDKSSGSNKVVFRDNIPYLRGLRVYH-HRNAA-DSSNGCSNNPNACQQICLPVPGGM--FSCACASGFKLSPDGRSCSPYNSFIVV---SMLPAVRGFSLELSDHSEAMVPVAGQGRN---VLHADVDVANGFIYWCDFSSSVRSSNGIRRIKPNGSNFTNIVTYGIGANGIRGVAVDWVAGNLYFTNAFVYETLIEVIRINTTYRRVL---LKVSVDMPRHIV----VDPKHRYLFWADYGQKPK-----IERSFLDCTNRTVLVSEGIVTPRGLAVDHDTGYIYWVDDSLDIIAR---IHRDGGESQVVRYGSR------------YPTPYGITVF-GESIIWVDRNLRKVFQASKQP---GNTDPPTVIRDSINLLRDVTIFDEHVQPLSPAELNNNPCL-------QSNGGCSHFCFALPELPTPKCGC-AFGTLEDDGKNCATSREDFLIYSLNNSLRSLHFDPQDHNLPFQAISVEGMAIALDYDRRNNRIFFTQKL----NPIRGQISYVN-LYSGASSPTILLSNIGVTDGI----AFDWIN--RRIYYSDFSNQTINSMAEDGSNRAVIARVSKPRAIVLDPCRGYMYWTDWGT--------NA---KIERATLGGNFR----------VPIVNTSLVWPNGLTLDLETDLLYWADASLQK---IERSTLTGSNREVVISTAFHSFGLT--VYGQYIYWTDFYTKKIY-----------RANKYDGSDLIAMTTRLPTQPSGIST---VVKTQQQQCSNPCDQFNGGCSHICAPGPNGAECQCPHEGSWYLANDNKYCVVDTGARCNQFQFTCLNGRCISQDWKCDNDNDCGDGSDELPTVCAFHTCRST--------------------AFTCA--------------NGRCVPYHY-RCDFYN-DCGDNSDEAGCLFRSCNSTTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNCPPITCQ-PDFAKCQTTNICVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQCVSPH---RCIPSYWFCDGEADCVDSSDE 2897          

HSP 2 Score: 84.3445 bits (207), Expect = 1.809e-15
Identity = 131/597 (21.94%), Postives = 244/597 (40.87%), Query Frame = 3
Query:  270 RDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLF---WLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDS-----AYRCSCSTGITEPINNAVCPT------FPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFA---YDSVTSSLLYVDFNSSSIFSLDLNKYG----TPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ--KFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSP-CYSTSN---KCDQLCFPIRGNQHSFSCGC 1967
            +++L   + + E++AVDW++  LY  + +   I+VV+L  +         R  L++ N+     + +DP   YLF   W  +     +ER+ +DGS+R+ +  + L   + + +D   K ++W  +D     I  V Y G    ++   G+     P  ++  E  + F +  ++ V      T  +  +    ++ P   ++  H L  P         N  C+ IC+    +      YRC C  G     +   C        F +++   G P   + +S    +  P+       G P  F    +D+  S++ Y D + + I+   ++  G    T  R         ++   ++ D  SRN+YW +  +  V V +++  +R +  + L +                 P  + V     Y+F++        I R W DG+    ++ +T+  WP GLA+D    +LY+VD     +   N  G  ++ L    +      L+ F + ++ T+    +I  V K DG   ++V   R   +  M V A   +A + TG+  C  T++    C   CFP+   Q    CGC
Sbjct:  458 QEILNVSIDAPENLAVDWINNKLYLVETRVNRIDVVNLEGNQ--------RVTLITENLGHPRGIALDPTVGYLFFSDWGSLSGQPKVERAFMDGSNRKDLVTTKLGWPAGITLDLVSKRVYW--VDSRYDYIETVTYDGIQRKTVARGGSLVP-HPFGISLFEEHVFFTDWTKMAVMKANKFTDTNPQVYHQSSLTPFG-VTVYHALRQPNATNPCGNNNGGCAQICVLSHRTDNGGLGYRCKCEFGFELDADEHHCVAVKNFLLFSSQTAVRGIP---FTLSTQEDVMVPV------TGSPSFFVGIDFDAQHSTIFYSDLSKNIIYQQKIDGTGKEVITANRL-------QNVEC-LSFDWISRNLYWTDGGSKSVTVMKLADKSRRQIISNLNN-----------------PRSIVVHPAAGYMFLSDWFRPA-KIMRAWSDGSHLMPIV-NTSLGWPNGLAIDWSTSRLYWVDAFFDKIEHSNLDGLDRKRLGHVDQMTHPFGLTVFKDNVFLTDWRLGAIIRVRKSDGGDMTVV---RRGISSIMHVKAY--DADLQTGTNYCSQTTHPNGDCSHFCFPVPNFQR--VCGC 999          

HSP 3 Score: 72.7886 bits (177), Expect = 5.907e-12
Identity = 116/479 (24.22%), Postives = 194/479 (40.50%), Query Frame = 3
Query: 3426 LAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQ----LDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRY--------QIPCGAGLVFSKKEGMSVM---SCMSVQQRCDSTVDCLDGSDEVGCNTCNISHL-----YSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQ------KFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVIN 4778
            L+ D IS  L W+D  +  +   +L ADK R + +  + N       P  I + P ++  ++LS  F  ++        + W + S L      ++  + G P+ L +D  + R+YW+D   +K+ + ++   + + R GHV            +++  G     + V K  +F TDW  ++ A I V    K          ++  ++  + +++ + A  A  D ++ +       + CS+ +H   N  CSH C             + M  Q+     +G      P     +       G CV S + +CD          +  CGA          + +    C+  Q RCD   DCLDGSDE  C T + S       ++C  + +C+P    CD   DC   SDE+ C +       +F C       RC+     C+G  DC DGSDE GC  N  +      D ++ IN
Sbjct:  788 LSFDWISRNLYWTDGGSKSVTVMKL-ADKSRRQIISNLNN-------PRSIVVHP-AAGYMFLSDWFRPAKI------MRAWSDGSHL----MPIVNTSLGWPNGLAIDWSTSRLYWVDAFFDKIEHSNLDGLDRK-RLGHV----------DQMTHPFG-----LTVFKDNVFLTDW--RLGAIIRVR---KSDGG------DMTVVRRGISSIMHVKAYDA--DLQTGT-------NYCSQTTHP--NGDCSHFCFPVPNFQRVCGCPYGMKLQRDQMTCEGDPAREPPTQQCGSSSFPCNNGKCVPS-IFRCDGVDDCHDNSDEHQCGALNNTCSSSAFTCVHGGQCIPGQWRCDKQNDCLDGSDEQNCPTRSPSSTCPPTSFTCD-NHMCIPKEWVCDTDNDCSDGSDEKNCQASGTCHPTQFRCPD----HRCISPLYVCDGDKDCVDGSDEAGCVLNCTSSQFKCADGSSCIN 1203          

HSP 4 Score: 70.8626 bits (172), Expect = 2.460e-11
Identity = 107/488 (21.93%), Postives = 175/488 (35.86%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDR-IEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFAS----------ISVNSDIKPSAAMGMHFYNLQYLKDKLKT---------VVRIMAR----IAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCS--------CPVSMSVTHKSRHKIGFCVKSQLV---------KCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDE----VGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQC--CGSQKFEC-----LSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            SLA+D +S  L W D +   +    L   + + +    V  N       P  I + P    + W  AD+              +I    +DG  ++V++      P+ +T+D  +  +YW D     + +  +             GH+     D  L +       ++ + +  +FWTDW  +              + VN+  KP     +H Y    + +   T         +++   R      P+DF++  L                +   C  +C ST  +    E   +    + DG+  CS        CP       + + + G C   Q +           D  ++ C      + +   +   C+    +CDS  DCLD SDE        TC     + C+    C+P + +CD   DC   SDE    C +  + C      S K   RC+P  A CNG  DCRD SDE GC
Sbjct: 3276 SLAVDWVSRKLYWLDAILDCLFVSDLEGRQRKMLAQHCVDANNTFCFENPRGIVLHPQRGYVYW--ADWGD----------HAYIARIGMDGTNKTVIISTKIEWPNAITIDYTNDLLYWADAHLGYIEFSDLE------------GHHRHTVYDGTLPHPF-----ALTIFEDTVFWTDWNTRTVEKGNKYDGSGRVVLVNTTHKPFDIHVLHPYRQPIMSNPCATNNGGCSHLCLIKAGGRGFTCECPDDFQTVQL---------------RDRTLCMPMCSSTQFLCGNNE-KCIPIWWKCDGQKDCSDGSDESDLCPHRFCRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCEANEWQCANKRCIPEYWQCDSVDDCLDNSDEDPSHCASRTCRPGQ-FKCNNG-RCIPQSWKCDVDNDCGDYSDEPIHECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGC 3716          

HSP 5 Score: 70.4774 bits (171), Expect = 3.413e-11
Identity = 42/108 (38.89%), Postives = 56/108 (51.85%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGC--NTCNISHLYSCSRSDVCLPITKRCDGVMDC----DSDEQC----CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C+    RCD T DCLD +DE+GC   +C  S  + C     C+P +  CD   DC    D  + C    C SQ+  C +G+    C+PI  RC+ + DC DGSDE  C
Sbjct:   40 CIPASWRCDGTRDCLDDTDEIGCPPRSCG-SGFFLCPAEGTCIPSSWVCDQDKDCSDGADEQQNCPGTTCSSQQLTCSNGQ----CVPIEYRCDHVSDCPDGSDERNC 142          

HSP 6 Score: 68.5514 bits (166), Expect = 1.264e-10
Identity = 101/403 (25.06%), Postives = 159/403 (39.45%), Query Frame = 3
Query: 3564 RPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLL--QNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEV----GCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCC------GSQKFECLSGKDVTRCLPISARCNGIVDCRDG--SDEHGC 4721
            +P  I + P    + W   D+  +            IE + L GN R  +V    + P+ LT+D+ +  +YW D    K            I    + G N +V + +       F +  + V  +Y++WTD++ +           K   A      +L  +  +L T             + S + T++  Q   CS    +  N  CSH+C                 A   +G   C CP   S    + +K  +CV     +C+++Q  C  G             C+S   +CD+  DC DGSDE+      +TC  S  ++C+    C+P   RCD   DC  +SDE  C       + +F C +G    RC+P+S  CNGI +C D   SDE  C
Sbjct: 2509 KPRAIVLDPCRGYMYW--TDWGTNAK----------IERATLGGNFRVPIVNTSLVWPNGLTLDLETDLLYWADASLQK------------IERSTLTGSNREVVIST------AFHSFGLTVYGQYIYWTDFYTK-----------KIYRANKYDGSDLIAMTTRLPT-------------QPSGISTVVKTQQQQCSNPCDQF-NGGCSHIC-----------------APGPNGA-ECQCPHEGSWYLANDNK--YCVVDTGARCNQFQFTCLNG------------RCISQDWKCDNDNDCGDGSDELPTVCAFHTCR-STAFTCANG-RCVPYHYRCDFYNDCGDNSDEAGCLFRSCNSTTEFTCSNG----RCIPLSYVCNGINNCHDNDTSDEKNC 2818          

HSP 7 Score: 68.1662 bits (165), Expect = 1.495e-10
Identity = 82/364 (22.53%), Postives = 145/364 (39.84%), Query Frame = 3
Query:  915 RVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRS--LFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR-ILAQKFQEFISLSYFDNFIYWTELETLSIH-SVKFDGSMRSLVTKTRN-------LDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSN 1973
            ++CS  C  ++ S Y C C+ G     +   C         L   N   I ++++DG       L+ +  G      +D V   L ++D     I  + LNK  T Q   +   +      S+AVD  SR +YW++     ++V+ +    R   A   +    +  F+  R         + +     Y++     D    I R  +DGT K TVI ST   WP  + +D     LY+ D   G +   +  G  +  +         +L+ F++ ++WT+  T ++    K+DGS R ++  T +       L     P+++          +PC + +  C  LC  I+     F+C C +
Sbjct: 3163 QLCSQKCENVIGS-YICKCAPGYIREPDGKSCRQNSNIEPYLVFSNRYYIRNLTIDG---TSYSLILQGLGNVVALDFDRVEERLYWIDAEKQIIERMFLNK--TNQETIISHRLRR--AESLAVDWVSRKLYWLDAILDCLFVSDLEGRQRKMLAQHCVDANNTFCFENPR--------GIVLHPQRGYVYWADWGDHA-YIARIGMDGTNK-TVIISTKIEWPNAITIDYTNDLLYWADAHLGYIEFSDLEGHHRHTVYDGTLPHPFALTIFEDTVFWTDWNTRTVEKGNKYDGSGRVVLVNTTHKPFDIHVLHPYRQPIMS----------NPCATNNGGCSHLCL-IKAGGRGFTCECPD 3497          

HSP 8 Score: 63.929 bits (154), Expect = 2.819e-9
Identity = 131/670 (19.55%), Postives = 252/670 (37.61%), Query Frame = 3
Query: 1107 SENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVT--VITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQK---FQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQH---SFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLF---WFETKTKDRQNVAELFQAHLDGSQPM-LIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEI--VNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVES--RECGCGSVYSLSADGATC 3068
            S+N GI     +      + + D   + +FS D+N   T +       +S D P ++AVD  +  +Y +  R + + V  +    R+   T  L                  P  +A+D    YLF +      G   +ER ++DG+ +  ++ +T   WP G+ LD   +++Y+VD+    + +V Y G  ++ +A+          +S F+  +++T+   +++            V    +L    + V    R    +  +PC + +  C Q+C       +    + C C     +  +   C      +++ +++ +     T +T +  +    G     V  +  D   + I++ + + N I +     D   +  I       +  L+ D+I  NLY   T      + +++L    +D S   ++ +      I+    VH    ++F   WF          A++ +A  DGS  M ++   +   + L +D   + + W  +   KI    +  ++RK                            R  ++      + +T+   +  +T  +L  I  V  S G    + V R I+ S   +    +D+ T     C    H N   CS FC PV +  R CGC     L  D  TC
Sbjct:  419 SKNRGIVMGVDFHYQKHRVFWTDPMQAKVFSTDINGLNTQEILN----VSIDAPENLAVDWINNKLYLVETRVNRIDVVNLEGNQRVTLITENLGH----------------PRGIALDPTVGYLFFSDWGSLSGQPKVERAFMDGSNRKDLV-TTKLGWPAGITLDLVSKRVYWVDSRYDYIETVTYDGIQRKTVARGGSLVPHPFGISLFEEHVFFTDWTKMAVMKANKFTDTNPQVYHQSSLTPFGVTVYHALRQP--NATNPCGNNNGGCAQICVLSHRTDNGGLGYRCKCEFGFELDADEHHCVAVKNFLLFSSQTAVRGIPFTLSTQEDVMVPVTGSPSFFVG-IDFDAQHSTIFYSDLSKNIIYQ--QKIDGTGKEVITANRLQNVECLSFDWISRNLY--WTDGGSKSVTVMKL----ADKSRRQIISNLNNPRSIV----VHPAAGYMFLSDWFRP--------AKIMRAWSDGSHLMPIVNTSLGWPNGLAIDWSTSRLYWVDAFFDKIEHSNLDGLDRK----------------------------RLGHVDQMTHPFGLTVFKDNVFLTDWRLGAIIRVRKSDG-GDMTVVRRGIS-SIMHVKAYDADLQT-GTNYCSQTTHPNG-DCSHFCFPVPNFQRVCGCPYGMKLQRDQMTC 1012          

HSP 9 Score: 63.5438 bits (153), Expect = 3.507e-9
Identity = 103/487 (21.15%), Postives = 178/487 (36.55%), Query Frame = 3
Query:  906 CMNRVCSSICLPIVDSAYRCSCSTG-------------ITEPINNAVCPT----------------FPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENA-----------------------GIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYL-DFPISSDIPV--------------SIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITD--GTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYR-QQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSI-HSVKFDGSMRS--LVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNIS-RCSYSSEMIV--------------YFNKSMLITHHLTPNTDKQYIELG 2102
            C  ++C   C  + +  + CSC  G             I E     +CP                 F + S   G        + DG   PPL LL EN                         I + +  + +  S++Y    S        +++G  +R YL DF   S+ PV               +AVD   R+IYW + ++  + VA +      +Y   L++            Q +QP    A  ++N  L +   TD      IE  W++G  + +V++S N  WP GL++D     ++Y+ D+ +  + S+ Y G  +R++     +  SL  F++ +YW   E   +    KF    +   LV        R    +  +++ S    +PC      C  LC    G    +SC C   +  +   +  C  +SE+ +              YF+++ L     +     +Y E+G
Sbjct: 3972 CAEKICEQNCTQLSNGGFICSCRPGFKPSTLDKNSCQDINECEEFGICPQSCRNSKGSYECFCVDGFKSMSTHYGE-----RCAADG--SPPLLLLPENVRIRKYNISSEKFSEYLEEEEHIQAIDYDWDPEGIGLSVVYYTVLSQG------SQFGAIKRAYLPDFESGSNNPVREVDLGLKYLMQPDGLAVDWVGRHIYWSDAKSQRIEVATLDG----RYRKWLIT-----------TQLDQP----AAIAVNPKLGLMFWTDQGKQPKIESAWMNGEHR-SVLASANLGWPNGLSIDYLNGDRIYWSDSKEDVIESIKYDGTDRRLIINDAMKPFSLDIFEDQLYWVAKEKGEVWRQNKFGKGNKEKLLVVNPWLTQVRIFHQLRYNQSVS----NPCKQV---CSHLCLLRPG---GYSCACPQGSDFVTGSTVECDAASELPITMPSPCRCMHGGSCYFDENDLPKCKCSSGYSGEYCEIG 4415          

HSP 10 Score: 63.5438 bits (153), Expect = 4.147e-9
Identity = 44/109 (40.37%), Postives = 57/109 (52.29%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQ--------KFECLSGKDVTRCLPISARCNGIVDCRDGSDEH-GC 4721
            C+S    CD   DC+DGSDE GC     S  + C+    C+    RCDGV DC  +SDE  C ++        +F+C    D T C+P +  C+G  DC  GSDEH GC
Sbjct: 1162 CISPLYVCDGDKDCVDGSDEAGCVLNCTSSQFKCADGSSCINSRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDEFQCQG--DGT-CIPNTWECDGHPDCIQGSDEHNGC 1267          

HSP 11 Score: 59.3066 bits (142), Expect = 7.755e-8
Identity = 40/112 (35.71%), Postives = 54/112 (48.21%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQ-----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRN 4739
            +C +  Q+CD  VDC D SDE  C T      + C  S  C+     CD   DC+  SDE       CG  +F C +G+    C+  +  C+G  DC+D  DE GC  N R+
Sbjct:  156 ACYNTSQKCDHKVDCRDSSDEANCTTLCSQKEFQCG-SGECILRAYVCDHDNDCEDNSDEHNCNYDTCGGHQFTCSNGQ----CINQNWVCDGDDDCQDSGDEDGCESNQRH 262          

HSP 12 Score: 58.5362 bits (140), Expect = 1.443e-7
Identity = 46/123 (37.40%), Postives = 58/123 (47.15%), Query Frame = 3
Query: 4377 CGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDE---VGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCC---GSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            CG+G      EG    +C+     CD   DC DG+DE       TC+   L +CS    C+PI  RCD V DC   SDE+ C      +  C +G     C   S +C+  VDCRD SDE  C
Sbjct:   67 CGSGFFLCPAEG----TCIPSSWVCDQDKDCSDGADEQQNCPGTTCSSQQL-TCSNGQ-CVPIEYRCDHVSDCPDGSDERNCYYPTCDQLTCANGA----CYNTSQKCDHKVDCRDSSDEANC 179          

HSP 13 Score: 58.151 bits (139), Expect = 1.735e-7
Identity = 43/112 (38.39%), Postives = 53/112 (47.32%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCLDGSDEVGCNT-----CNISHLYSCSRSDVCLPITKRCDGVMDC--DSDE------QCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            SC++ + RCD   DC D SDE GC T     C+    + C     C+P T  CDG  DC   SDE      + C    F C +G     C+  S  C+G  DCRD SDE  C
Sbjct: 1200 SCINSRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDE-FQCQGDGTCIPNTWECDGHPDCIQGSDEHNGCVPKTCSPSHFLCDNGN----CIYNSWVCDGDNDCRDMSDEKDC 1306          

HSP 14 Score: 57.7658 bits (138), Expect = 2.195e-7
Identity = 72/280 (25.71%), Postives = 123/280 (43.93%), Query Frame = 3
Query:  171 VFLSRKLYVFVIQENGKSLLKTA---NFSKLDRRKMRDV---LKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE--IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDE--QLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTG 980
            + LS   Y  + Q +    +K A   +F       +R+V   LK+ +Q  + +AVDWV  ++YW+D K+Q IEV  L+           R+ L++  +    ++ V+P    +FW   G    +E + ++G  R V+  + L   + L+ID       +W    E  I  + Y G T   + +    K +S   L   E +L ++  E  ++W  +          L  NP +  + I    HQL   +    +PC  +VCS +CL +    Y C+C  G
Sbjct: 4098 IGLSVVYYTVLSQGSQFGAIKRAYLPDFESGSNNPVREVDLGLKYLMQ-PDGLAVDWVGRHIYWSDAKSQRIEVATLD--------GRYRKWLITTQLDQPAAIAVNPKLGLMFWTDQGKQPKIESAWMNGEHRSVLASANLGWPNGLSIDYLNGDRIYWSDSKEDVIESIKYDG-TDRRLIINDAMKPFS---LDIFEDQLYWVAKEKGEVWRQNKFGKGNKEKLLVVNPWLTQVRIF---HQLRYNQ-SVSNPC-KQVCSHLCL-LRPGGYSCACPQG 4358          

HSP 15 Score: 53.9138 bits (128), Expect = 3.441e-6
Identity = 40/105 (38.10%), Postives = 58/105 (55.24%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCLDGSDE-VGC--NTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQKFECLSGK----DVTRCLPISARCNGIVDCRDGSDE 4712
            +C+     CD   DC+ GSDE  GC   TC+ SH + C   + C+  +  CDG  DC   SDE+ C +Q F C S +      + C+ +SA C+G+ DC +G+DE
Sbjct: 1243 TCIPNTWECDGHPDCIQGSDEHNGCVPKTCSPSH-FLCDNGN-CIYNSWVCDGDNDCRDMSDEKDCPTQPFHCPSSQWQCPGYSICVNLSALCDGVFDCPNGTDE 1345          

HSP 16 Score: 53.1434 bits (126), Expect = 5.936e-6
Identity = 31/126 (24.60%), Postives = 59/126 (46.83%), Query Frame = 3
Query:  252 LDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFW 629
            L++     ++   ++ AES+AVDWVS  LYW D     + V DL       +++       +    +   +V+ P   Y++W   G    + R  +DG+++ VI  + +   + + ID    +L+W
Sbjct: 3258 LNKTNQETIISHRLRRAESLAVDWVSRKLYWLDAILDCLFVSDLEGRQRKMLAQHCVDANNTFCFENPRGIVLHPQRGYVYWADWGDHAYIARIGMDGTNKTVIISTKIEWPNAITIDYTNDLLYW 3383          
BLAST of Low-density lipoprotein receptor-related protein vs. UniProt/SwissProt
Match: sp|Q91VN0|LRP5_MOUSE (Low-density lipoprotein receptor-related protein 5 OS=Mus musculus OX=10090 GN=Lrp5 PE=1 SV=3)

HSP 1 Score: 269.626 bits (688), Expect = 2.666e-71
Identity = 368/1513 (24.32%), Postives = 599/1513 (39.59%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMR---VQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICL-PIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYP---NSRSLYLFMAD-SIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYG----FISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRN 4730
            S + +A DWV   LYW D +   IEV +LN  S        R++L  +++    ++ +DP   Y++W   G    +ER+ +DGS R++I  S ++  + L ID   + L+W   D +   IHR +  G    S R   V+G+     P  LT +   L + + +   + +    TG       +   +P+ I     +   P     +PC   N  CS +CL    +  Y C+C TG+    N   C T     L +     +  +SLD      + L   +        YD +   + + D    +I           +R YLD       ++++I  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  + +  +   ++ T   +    IE   LDG  +  V+ +T+  WP GLALD    +LY+ D  K D I V    G+KR  +L  K       +   +FIYWT+ +  SI  V K   S   ++ +  +L    M + AV+    + T +PC   +  C  LCF       +  CGC     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   K R     + +A +DG+  M +   V   ++L +D     + W   D+  I    ++ ++                        YP      S Y++  D +++ +  +D +S   R   T I   GH        FV   +   +     ++ D   + V       H N   C Q CL +     CGC S Y+L      C   S  L+                        F +   +S   I   Q   D V  L     ++  NY     FI  VD  +    IK+ K    Q   +   TS S++L     S +   + L+ID  S TL W+   T  I   RL+ D      +GV++  R  R +P  IA+      +      F+  +       H   IE + LDG  R VL     I P  L VD   G+++W+D             D  +I +  + G N     D+ +   VG     + VL ++L+W D  QQ+   +   +  K +   G     + +L     T +  +  ++ E+F +         HPC+R     +N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+    RCD   +C D SDE GC  C+ S  + C+R   C+ +  RCDG  DC   SDE  C +     +F C SG+    C+ I  +C+   DC DGSDE  C  N
Sbjct:  108 SPDGLACDWVGKKLYWTDSETNRIEVANLNGTS--------RKVLFWQDLDQPRAIALDPAHGYMYWTDWGEAPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTH--PFALTLSGDTLYWTDWQTRSIHACNKWTGEQRKEILSALYSPMDIQVLSQERQPPF---HTPCEEDNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKTCKTGAEEVLLLARRTDLRRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAI-----------RRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILVS------------EDLDEPRAIVLHPVMGLMYWTDWGENP-KIECANLDGRDRH-VLVNTSLGWPNGLALDLQEGKLYWGD-AKTDKIEVINIDGTKRKTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDL----MGLKAVNVAKVVGT-NPCADGNGGCSHLCF---FTPRATKCGCPIGLELLSDMKTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVK---EASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGL--DYPEGMAVDWMGKNLYWADTGT--NRIEVARL-----DGQFRQVLVWRDLDNP--RSLALDPTKGYIYWTEWGGKPR-----IVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQE---------------RMVIADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNR---TLIQ--GH------LDFVMDILVFHS-----SRQDGLNDCV-------HSNG-QCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSTFLL------------------------FSQKFAISRM-IPDDQLSPDLVLPLHGLRNVKAINYDPLDKFIYWVDGRQ---NIKRAKDDGTQPSML---TSPSQSL-----SPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDGDA-----MGVVL--RGDRDKPRAIAVNAERGYMY-----FTNMQD------HAAKIERASLDGTEREVLFTTGLIRPVALVVDNALGKLFWVDA------------DLKRIESCDLSGANRLTLEDANIVQPVG-----LTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQG----RVTHL-----TGIHAVEEVSLEEFSA---------HPCAR-----DNGGCSHICIA-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPDQFACTTGEI----------DCIPGAWRCDGFPECADQSDEEGCPVCSASQ-FPCARGQ-CVDLRLRCDGEADCQDRSDEANCDAVCLPNQFRCTSGQ----CVLIKQQCDSFPDCADGSDELMCEIN 1372          

HSP 2 Score: 129.028 bits (323), Expect = 2.765e-28
Identity = 202/874 (23.11%), Postives = 358/874 (40.96%), Query Frame = 3
Query:  102 KSILHRHGVDIFFNTDLKLLAADV-------FLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFT-EGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLM------VPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISS---TNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNK----SMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIF---CLSSD-TISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            ++ L R  +D    TD+ L   D+       +   + YV+   +  +++ +    + LD    + ++   +   + +AVDWV+ NLYW D     IEV  LN  S        R+IL+S ++ +  ++V+ P    ++W   G    +E + LDG DR V+  + L   + LA+D     L+W   D +  +++     G   +     +   P    FT  G  ++  D Q            SI        +   II +   LM      V +    +PC   N  CS +C      A +C C  G+    +   C   P   L   +   I+ +SL+     +  PL  + E + + F    D   + + + D +  +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + VAR+    R      +L W         R   N  P  LA+D    Y++ T    G   I R ++DGT   T++      ND     L +D   Q+LY+ D     + S N  G  + ++A        L+ + ++IYWT+    SI    K  G  R+L+    +     +  I V  ++  D  + C  ++ +C QLC  I G      CGC++   +  +   CS  S  +++  K     M+    L+P+       L        V ++  D     IYW++   N  +K A +   Q  +       LS D    +L++D     L+   T  A + I + RL      V    V+   + K +   A++V+++  ++++    T  + + A++ +A LDG++  +L   G+     LVVD     + W  +D  +I
Sbjct:  348 RTDLRRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRR----AYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS--------RKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLYWG--DAKTDKIEVINIDGTKRKT--LLEDKLPHIFGFTLLGDFIYWTDWQR----------RSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADGNGGCSHLCF-FTPRATKCGCPIGLELLSDMKTC-IIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDF----DVSNNHIYWTDVSLKTISRAFMN--GSSVEHVIEFGL--DYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFR-----QVLVW---------RDLDN--PRSLALDPTKGYIYWTEWG-GKPRIVRAFMDGTNCMTLVDKVGRAND-----LTIDYADQRLYWTDLDTNMIESSNMLGQERMVIADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDF----VMDILVFHSSRQDGLNDCVHSNGQCGQLCLAIPGGHR---CGCASHYTLDPSSRNCSPPSTFLLFSQKFAISRMIPDDQLSPDLVLPLHGL------RNVKAINYDPLDKFIYWVDGRQN--IKRAKDDGTQPSMLTSPSQSLSPDRQPHDLSIDIYSRTLF--WTCEATNTINVHRLDGDAMGV----VLRGDRDKPR---AIAVNAERGYMYF----TNMQDHAAKIERASLDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRI 1135          

HSP 3 Score: 119.013 bits (297), Expect = 3.048e-25
Identity = 201/965 (20.83%), Postives = 354/965 (36.68%), Query Frame = 3
Query: 1104 LSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTP-QRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGG-SKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDG-SQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFC-LPVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSD--------LDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDW 3959
            L + A + F+F+  +V     + D +  +I    LN+ G   Q   +   +S D    +A D   + +YW +   + + VA ++  +R      +L WQ            +QP   +A+D  + Y++ T   +    IER  +DG+ +  ++ S + +WP GL +D   Q+LY+ D     +   N  G   ++++        +L+   + +YWT+ +T SIH+  K+ G  R  +          M +  +S+       +PC   +  C  LC  +   +  +SC C     +  N   C   +E ++   +   +        D   I L  G+    +A +  D     +YW +     I +  +  D      +     +    +AVD++  NLY + T +   RI + RL  T        ++VS  +      A+ +H  +  ++W      D     ++  A+LDG  + +L+   +   + L +D Q   + W  + + KI   E++N   ++ +         +    +  HI+      +  + D IY           T  Q   I  V      R          +  K + +AK  +GT           D    CS  C     + +CGC     L +D  TC+ + +  +V T+   I  I     N  D  I      E S    +     I   YW   ++ L+  +  F++                 S  EH I+    Y E               +A+D +   L W+D  T  I   RL+              FR+                L+W   D  +S   D +  + +W E           +DG     LV   G  + LT+D    R+YW D  TN             I + +++G    V  D  L    G +  S      Y++WTDW
Sbjct:   61 LEDAAAVDFQFSKGAV----YWTDVSEEAIKQTYLNQTGAAAQNIVISGLVSPD---GLACDWVGKKLYWTDSETNRIEVANLNGTSRK-----VLFWQ----------DLDQPRA-IALDPAHGYMYWTDWGEAP-RIERAGMDGSTRKIIVDS-DIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKWTGEQRKEILSAL---YSPMDIQVLSQERQPPFHTPCEEDNGGCSHLCL-LSPREPFYSCACPTGVQLQDNGKTCKTGAEEVLLLARRTDLRRISLDTPDFTDIVLQVGDIRHAIA-IDYDPLEGYVYWTDDEVRAIRR--AYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGT--DRIEVTRLNGTSR-----KILVSEDLDEP--RAIVLHPVMGLMYW-----TDWGENPKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKI---EVINIDGTKRK---------TLLEDKLPHIFG-----FTLLGDFIYW----------TDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKV-VGTNPCA-------DGNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCI-IPEAFLVFTSRATIHRISLET-NNNDVAIPLTGVKEASALDFDVSNNHI---YW--TDVSLKTISRAFMNG----------------SSVEHVIEFGLDYPEG--------------MAVDWMGKNLYWADTGTNRIEVARLDG------------QFRQ---------------VLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTN------------MIESSNMLGQERMVIADD-LPYPFGLTQYS-----DYIYWTDW 862          

HSP 4 Score: 84.3445 bits (207), Expect = 1.292e-14
Identity = 139/626 (22.20%), Postives = 242/626 (38.66%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLD-------------------------GEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGIT-EPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP---ISSD-IPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCS 2009
            LKT + + ++   +  V++F +   E +AVDW+  NLYWAD     IEV  L  D  F      R++L+ R++ +  SL +DP + Y++W + G    + R+ +DG++   +   +  +++ L ID   + L+W  LD                         G     DY   T  ++       + S    T  +G L F+ D  ++ SS +   G++  + +N     +        L +P G                      +RC C++  T +P +    P  P+  L       I  M  D  L P L L            YD +   + +VD       ++   K    Q   L  P   +S D  P  +++D  SR ++W     + + V R+          ++L           R  +++P   +AV++   Y++ T + D    IER  LDGT++  V+ +T    P  L +D    +L++VD     + S +  G ++  L      + + L+     +YW + +   I  V K  G  R+ V            V  VS      +  PC   +  C  +C  I     +  C C     +L N+  C 
Sbjct:  695 LKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARL--DGQF------RQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKV-GRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERMVIADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQ--DGLNDCVHSNGQCGQLC-------LAIPGG----------------------HRCGCASHYTLDPSSRNCSP--PSTFLLFSQKFAISRMIPDDQLSPDLVLPLHGLRNVKAINYDPLDKFIYWVDGRQ----NIKRAKDDGTQPSMLTSPSQSLSPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDG----DAMGVVL-----------RGDRDKPRA-IAVNAERGYMYFTNMQDHAAKIERASLDGTER-EVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGIHAVEEVSLEEF--SAHPCARDNGGCSHIC--IAKGDGTPRCSCPVHLVLLQNLLTCG 1253          
BLAST of Low-density lipoprotein receptor-related protein vs. UniProt/SwissProt
Match: sp|O75197|LRP5_HUMAN (Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens OX=9606 GN=LRP5 PE=1 SV=2)

HSP 1 Score: 266.544 bits (680), Expect = 2.142e-70
Identity = 354/1509 (23.46%), Postives = 605/1509 (40.09%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMR---VQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPCMNRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSR-SLYLFMAD-SIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVE-SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLS--KNIVLRLDNYGFISAVDRTRPYVM--IKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCN 4724
            S + +A DWV   LYW D +   IEV +LN  S        R++L  +++    ++ +DP   Y++W   G    +ER+ +DGS R++I  S ++  + L ID   + L+W   D +   IHR +  G    S R   V+G+     P  LT +   L + + +   + +    TG       +   +P  I ++S++ Q   P    +    N  CS +C L   +  Y C+C TG+    N   C       L +     +  +SLD      + L  ++        YD +   + + D    +I           +R YLD       ++++I  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  +A+  +   ++ T   +    IE   LDG ++  +++++   WP GLALD    +LY+ D  K D I V    G+KR  +L  K       +   +FIYWT+ +  SI  V K   S   ++ +  +L    M + AV+    + T +PC   +  C  LCF      H+  CGC     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   K R     + +A +DG+  M +   V   ++L +D     + W   D+  I    ++ ++                 + +  H +  ++ S Y++  D +++ +  +D +S   R   T I   GH        FV   +   + +          + +  C  HN+     C Q CL +     CGC S Y+L      C   +  L+  +    I  +  +  +  D  +       +     +   KFI   YW+   +NI    D        D T+P+V+  + + +    Q HD                        L+ID  S TL W+   T  I   RL+      E +GV++  R  R +P  I +      L + +     ++           IE + LDG  R VL     I P  L VD   G+++W+D             D  +I +  + G N     D+ +   +G     + +L K+L+W D  QQ+   +   +  K +   G     + +L     T +  +  ++ E+F +         HPC+R     +N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+    RCD   +C D SDE GC  C+ +  + C+R   C+ +  RCDG  DC   SDE  C +     +F C SG+    C+ I  +C+   DC DGSDE  C 
Sbjct:  109 SPDGLACDWVGKKLYWTDSETNRIEVANLNGTS--------RKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTH--PFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQ---PFFHTRCEEDNGGCSHLCLLSPSEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAI-----------RRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILVS------------EDLDEPRAIALHPVMGLMYWTDWGENP-KIECANLDGQERRVLVNASLG-WPNGLALDLQEGKLYWGD-AKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDL----MGLKAVNVAKVVGT-NPCADRNGGCSHLCF---FTPHATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVK---EASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGL--DYPEGMAVDWMGKNLYWADTGT--NRIEVARL-----DGQFRQVLVWRDLDNP--RSLALDPTKGYIYWTEWGGKPR-----IVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQE-------------RVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNR---TLIQ--GH------LDFVMDILVFHSSR---------QDGLNDC-MHNNGQ---CGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLL-FSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFI---YWVDGRQNIKRAKD--------DGTQPFVLTSLSQGQNPDRQPHD------------------------LSIDIYSRTLFWTCEATNTINVHRLSG-----EAMGVVL--RGDRDKPRAIVVNAERGYLYFTNMQDRAAK-----------IERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDA------------DLKRIESCDLSGANRLTLEDANIVQPLG-----LTILGKHLYWIDRQQQMIERVEKTTGDKRTRIQG----RVAHL-----TGIHAVEEVSLEEFSA---------HPCAR-----DNGGCSHICIA-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPDQFACATGEI----------DCIPGAWRCDGFPECDDQSDEEGCPVCSAAQ-FPCARGQ-CVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQ----CVLIKQQCDSFPDCIDGSDELMCE 1371          

HSP 2 Score: 132.109 bits (331), Expect = 3.467e-29
Identity = 192/814 (23.59%), Postives = 336/814 (41.28%), Query Frame = 3
Query:  252 LDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFT-EGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLM------VPRGRRKSPCMNR--VCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTIS--------NLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            LD    + ++   +   + +AVDWV+ NLYW D     IEV  LN  S        R+IL+S ++ +  ++ + P    ++W   G    +E + LDG +RRV+  + L   + LA+D     L+W   D +  +++     G   R     +   P    FT  G  ++  D Q            SI        +   II +   LM      V +    +PC +R   CS +C      A RC C  G+ E +++      P   L   +   I+ +SL+     +  PL  + E + + F    D   + + + D +  +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + VAR+    R      +L W         R   N  P  LA+D    Y++ T    G   I R ++DGT   T++          L +D   Q+LY+ D     + S N  G  + ++A        L+ + ++IYWT+    SI    K  G  R+L+    +     +  I V  ++  D  + C   + +C QLC  I G      CGC++   +  +   CS  +  +++  KS +    + P+       +        V ++  D     IYW++   N  +K A +   Q     F L+S +          +L++D     L+   T  A + I + RL    S  +   V+   + K +   A+ V+++  +L++  T  +DR   A++ +A LDG++  +L   G+     LVVD     + W  +D  +I
Sbjct:  402 LDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS--------RKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWG--DAKTDKIEVINVDGTKRRT--LLEDKLPHIFGFTLLGDFIYWTDWQR----------RSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCF-FTPHATRCGCPIGL-ELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDF----DVSNNHIYWTDVSLKTISRAFMN--GSSVEHVVEFGL--DYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFR-----QVLVW---------RDLDN--PRSLALDPTKGYIYWTEWG-GKPRIVRAFMDGTNCMTLVDKVGR--ANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDF----VMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHR---CGCASHYTLDPSSRNCSPPTTFLLFSQKSAI--SRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQN--IKRAKDDGTQP----FVLTSLSQGQNPDRQPHDLSIDIYSRTLF--WTCEATNTINVHRL----SGEAMGVVLRGDRDKPR---AIVVNAERGYLYF--TNMQDR--AAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRI 1136          

HSP 3 Score: 88.1965 bits (217), Expect = 8.861e-16
Identity = 140/633 (22.12%), Postives = 245/633 (38.70%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLD-------------------------GEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGIT-EPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDF---------NSSSIFSL-DLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASID-TGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCS 2009
            LKT + + ++   +  V++F +   E +AVDW+  NLYWAD     IEV  L  D  F      R++L+ R++ +  SL +DP + Y++W + G    + R+ +DG++   +   +  +++ L ID   + L+W  LD                         G     DY   T  ++       + S    T  +G L F+ D  ++ SS +   G++  +  N                              C  +CL I    +RC C++  T +P +    P  PT  L       I  M  D    P L L            YD +   + +VD          + +  F L  L++   P R           P  +++D  SR ++W     + + V R+S     +   ++L           R  +++P   + V++   YL+ T + D    IER  LDGT++  V+ +T    P  L +D    +L++VD     + S +  G ++  L      + + L+     +YW + +   I  V K  G  R   T+ +   A    + AV   +  + +  PC   +  C  +C  I     +  C C     +L N+  C 
Sbjct:  696 LKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARL--DGQF------RQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKV-GRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQ--DGLNDCMHNNGQ----------------------------CGQLCLAI-PGGHRCGCASHYTLDPSSRNCSP--PTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQNPDR----------QPHDLSIDIYSRTLFWTCEATNTINVHRLSG----EAMGVVL-----------RGDRDKPRA-IVVNAERGYLYFTNMQDRAAKIERAALDGTER-EVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGLTILGKHLYWIDRQQQMIERVEKTTGDKR---TRIQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHIC--IAKGDGTPRCSCPVHLVLLQNLLTCG 1254          
BLAST of Low-density lipoprotein receptor-related protein vs. UniProt/SwissProt
Match: sp|O75096|LRP4_HUMAN (Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4)

HSP 1 Score: 206.838 bits (525), Expect = 6.137e-52
Identity = 300/1327 (22.61%), Postives = 514/1327 (38.73%), Query Frame = 3
Query:   69 VFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPF-------RFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHG--GSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVA---------SLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEI--VNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADS-IYQVTLSDSSSSITRKQLTFISNV----GHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVESR-ECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDW 3959
            V L+A+   + + + HR    +  N     +A D F  R+  VF        +L+    + L+   + +V+   ++S   +AVDWV   LYW D     IEV +L+           R++LL +N+    ++ + P E  ++W   G    +E S +DGS RR+I  + LF  + L ID   + ++W  +D + H ++     G   +   +     P  +T  E  L + +     ++S    TG +  +  N    P+ I +  H    P G+ +    N  C+ +CLP     Y C+C TG  + I++  C     + L       I  +S D       E LS++  IP           +DS    + + D ++ +I     +  GT Q   +D  + S  P  +A+D  +  +YW +     + VA      R    T+L+            ++    P D+ V+ +  Y++ T     +  IER  +D + +  +ISS N  WP GLA+D   Q+LY+ D     M ++ + G  GSKR  ++  +      L+ +   IYWT+ +T SI S      +  L  +T   +   +  I V         +PC   +  C  LC     N   FSC C    ++L +   CS      + F + + I      + D  Y       +DV V          ++ +D    ++YW +   + I +  +N D  +   I      T   LAVD I   +Y       W+     R+   + D S   V+V   + +    A+ ++ ++ F++W      D    A+L ++ +DGS + +LI   +   + L VD+ ++ + W  + + +I   ++   NR                        + P      L + DS IY       + SI R      SNV     +  G+     V R+  +   K               C + N      CS  CLP  S   C C +   L  DG TC    +  ++ ++ G I  I  +  +  D  +   E                        N V+ LD       V  T  ++ + +   L+              N+         +   LA+D ++  L W+D     I A RL+    +     V+IN   S   P  IA+ P    L W   D+           H   IE ++LDG+ R VL+    G P+ LT+D  + RIYW+D   +++    ++    Q+   HV  H   +T                    ++++WTDW
Sbjct:  441 VLLFANRIDIRQVLPHRSEYTLLLNNLENAIALD-FHHRRELVFWSDVTLDRILR----ANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLD--------GAHRKVLLWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYW--VDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHT-LHPQRQPAGKNRCGDNNGGCTHLCLP-SGQNYTCACPTGFRK-ISSHACAQSLDKFLLFARRMDIRRISFD------TEDLSDDV-IPLADVRSAVALDWDSRDDHVYWTDVSTDTISRAKWD--GTGQEVVVDTSLES--PAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMR----TVLI------------WENLDRPRDIVVEPMGGYMYWTDWG-ASPKIERAGMDASGRQVIISS-NLTWPNGLAIDYGSQRLYWADA---GMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQSAD---RLTGLDRETLQENLENLMDIHVFHRRRPPVSTPCAMENGGCSHLCL-RSPNPSGFSCTCPTGINLLSDGKTCSPGMNSFLIFARRIDIR---MVSLDIPYF------ADVVVPINITMKNTIAIGVDPQEGKVYWSDSTLHRISR--ANLDGSQHEDIITTGLQTTDGLAVDAIGRKVY-------WTDTGTNRIEVGNLDGSMRKVLVWQNLDSPR--AIVLYHEMGFMYW-----TDWGENAKLERSGMDGSDRAVLINNNLGWPNGLTVDKASSQLLWADAHTERIEAADLNGANRH---------------------TLVSPVQHPYGLTLLDSYIYWTDW--QTRSIHRADKGTGSNVILVRSNLPGLMDMQAVDRAQPLGFNK---------------CGSRNG----GCSHLCLPRPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPE-----------------------LNNVISLDYDSVDGKVYYTDVFLDVIRRADLN------------GSNMETVIGRGLKTTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRK-----VLIN--NSLDEPRAIAVFPRKGYLFW--TDWG----------HIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHV-SHPFALTQQD-----------------RWIYWTDW 1574          

HSP 2 Score: 145.976 bits (367), Expect = 2.459e-33
Identity = 155/625 (24.80%), Postives = 266/625 (42.56%), Query Frame = 3
Query:  126 VDIFFNTDLKLLAADVFLSRKLYVFVIQENGK-----SLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIAL-KTN-PNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNR 1976
            +DI +  D+ ++  ++ +   + + V  + GK     S L   + + LD  +  D++   +Q+ + +AVD +   +YW D     IEV +L+           R++L+ +N+    ++V+     +++W   G    LERS +DGSDR V+  + L   + L +D+    L W   D    R++     G +     +  Q  P  LT  +  + + + +   +   + GTG ++ L ++N P +  +  + R      P G  K    N  CS +CLP   S + C+C TGI    +   C   P   L   +   I  +SLD      + +            YDSV   + Y D     I   DLN              +      +AVD  +RN+YW +   + +  +R+    R     +L++     +  E R         +AV     YLF T        IER  LDG+++  +I+ T+  WP GL LD   +++Y+VD     + S + +G  +++L        +L+  D +IYWT+ +T SI  V K+ G  R+  T   N++   M +I VS      T + C   +  C  LCF        F C C + 
Sbjct: 1064 LDIPYFADV-VVPINITMKNTIAIGVDPQEGKVYWSDSTLHRISRANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLD--------GSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSDRAVLINNNLGWPNGLTVDKASSQLLW--ADAHTERIEAADLNGANRHTLVSPVQ-HPYGLTLLDSYIYWTDWQTRSIHRADKGTGSNVILVRSNLPGLMDMQAVDRAQ----PLGFNKCGSRNGGCSHLCLP-RPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVISLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTD----GLAVDWVARNLYWTDTGRNTIEASRLDGSCR----KVLIN----NSLDEPRA--------IAVFPRKGYLFWTDWGH-IAKIERANLDGSERKVLIN-TDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSG--RNKETVLANVEG-LMDIIVVSPQRQTGTNA-CGVNNGGCTHLCF---ARASDFVCACPDE 1642          

HSP 3 Score: 57.7658 bits (138), Expect = 1.455e-6
Identity = 47/129 (36.43%), Postives = 62/129 (48.06%), Query Frame = 3
Query: 4356 CDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCC---GS-----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            C  +Q PC +G  F    G+    C++   RCD   DC D SDE  C T   +       S  C+ ++ RCDG  DC  +SDE+ C   GS      +F C +G    RC+     CNG+ DC D SDE
Sbjct:  225 CSSHQ-PCRSG-EFMCDSGL----CINAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCHSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCALDQFLCWNG----RCIGQRKLCNGVNDCGDNSDE 343          

HSP 4 Score: 55.4546 bits (132), Expect = 7.504e-6
Identity = 55/190 (28.95%), Postives = 72/190 (37.89%), Query Frame = 3
Query: 4326 GFCVKSQLVKCD-------RYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNT------CNISHLY--------------------------SCSR------------SDVCLPITKRCDGVMDCD--SDEQ-----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            G+C++S L  CD            C       K+   S  SC++    CD   DC DGSDE  C +      CN+                               CS             S +C+    RCDG  DCD  SDE+      C +++F C SG    RC+ +S RC+G  DC D SDE  C
Sbjct:  120 GYCIRS-LWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEENCPSAVPAPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCHSG----RCVRLSWRCDGEDDCADNSDEENC 304          
BLAST of Low-density lipoprotein receptor-related protein vs. UniProt/SwissProt
Match: sp|Q9QYP1|LRP4_RAT (Low-density lipoprotein receptor-related protein 4 OS=Rattus norvegicus OX=10116 GN=Lrp4 PE=1 SV=2)

HSP 1 Score: 206.838 bits (525), Expect = 6.348e-52
Identity = 301/1325 (22.72%), Postives = 521/1325 (39.32%), Query Frame = 3
Query:   69 VFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPF-------RFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHG--GSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVA---------SLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADS-IYQVTLSDSSSSITRKQLTFISNV----GHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVESR-ECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVK-NPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDW 3959
            V L+A+   + + + HR    +  N     +A D F  R+  VF        +L+    + L+   + +V+   ++S   +AVDWV   LYW D     IEV +L+           R++LL +++    ++ + P E  ++W   G    +E S +DGS RR+I  + LF  + L ID   + ++W  +D + H ++     G   +   +     P  +T  E  L + +     ++S    TG +  +  N    P+ I +  H    P G+ +    N  C+ +CLP     Y C+C TG  + IN+  C     + L       I  +S D       E LS++  IP           +DS    + + D ++ +I     +  GT Q+  +D  + S  P  +A+D  +  +YW +     + VA      R    T+L+            ++    P D+ V+ +  Y++ T     +  IER  +D + +  +ISS N  WP GLA+D   Q+LY+ D     M ++ + G  GSKR  ++  +      L+ +   IYWT+ +T SI S      +  L  +T   +   +  I V         +PC   +  C  LC     +   FSC C    ++LL+   CS      + F + + +      + D  Y       +DV V          ++ +D    ++YW +   + I +  ++ D  +   I      T   LAVD I   +Y       W+     R+   + D S   V+V   + +    A+ ++ ++ F++W      D    A+L ++ +DGS + +LI   +   + L VD+ ++ + W  + + +I   E+ +   +                     + P      L + DS IY       + SI R   +  SNV     +  G+     V R+  +   K               C + N      CS  CLP  S   C C +   L  DG TC    +  ++ ++ G I      I  + DD  D          P+               N V+ LD       V  T  ++ + +   L         + S  E +  H      +   LA+D ++  L W+D     I A RL+    +     V+IN   S   P  IA+ P    L W   D+           H   IE ++LDG+ R VL+  + G P+ LT+D  + RIYW+D   +++    ++    Q+   HV  H   +T                    ++++WTDW
Sbjct:  441 VLLFANRIDIRQVLPHRSEYTLLLNNLENAIALD-FHHRRELVFWSDVTLDRILR----ANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLD--------GAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYW--VDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHT-LHPQRQPAGKNRCGDNNGGCTHLCLP-SGQNYTCACPTGFRK-INSHACAQSLDKFLLFARRMDIRRISFD------TEDLSDDV-IPLADVRSAVALDWDSRDDHVYWTDVSTDTISRAKWD--GTGQKVVVDTSLES--PAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMR----TVLI------------WENLDRPRDIVVEPMGGYMYWTDWG-ASPKIERAGMDASNRQVIISS-NLTWPNGLAIDYGSQRLYWADA---GMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGQRIYWTDWQTKSIQSAD---RLTGLDRETLQENLENLMDIHVFHRQRPPVTTPCAVENGGCSHLCL-RSPSPSGFSCTCPTGINLLLDGKTCSPGMNSFLIFARRIDVR---MVSLDIPYF------ADVVVPINMTMKNTIAIGVDPLEGKVYWSDSTLHRISR--ASLDGSQHEDIITTGLQTTDGLAVDAIGRKVY-------WTDTGTNRIEVGNLDGSMRKVLVWQNLDSPR--AIVLYHEMGFMYW-----TDWGENAKLERSGMDGSDRTVLINNNLGWPNGLTVDKTSSQLLWADAHTERI---EVADLNGANRHTL----------------VSPVQHPYGLTLLDSYIYWTDW--QTRSIHRADKSTGSNVILVRSNLPGLMDIQAVDRAQPLGFNK---------------CGSRNG----GCSHLCLPRPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIR----RISLDTDDHTDV-------HVPVPG------------LNNVISLDYDSVDGKVYYTDVFLDVIRRADL---------NGSNMETVIGHGLK---TTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRK-----VLIN--NSLDEPRAIAVFPRKGYLFW--TDWG----------HIAKIERANLDGSERKVLINADLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHV-SHPFALTQQD-----------------RWIYWTDW 1574          

HSP 2 Score: 140.584 bits (353), Expect = 9.558e-32
Identity = 149/588 (25.34%), Postives = 252/588 (42.86%), Query Frame = 3
Query:  222 SLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIAL-KTN-PNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNR 1976
            S L   + + LD  +  D++   +Q+ + +AVD +   +YW D     IEV +L+           R++L+ +N+    ++V+     +++W   G    LERS +DGSDR V+  + L   + L +D+    L W   D    R++     G +     +  Q  P  LT  +  + + + +   +   +  TG ++ L ++N P +  I  + R      P G  K    N  CS +CLP   S + C+C TGI    +   C   P   L   +   I  +SLD      + +            YDSV   + Y D     I   DLN  G+     +   + +     +AVD  +RN+YW +   + +  +R+    R     +L++     +  E R         +AV     YLF T        IER  LDG+++  +I++ +  WP GL LD   +++Y+VD     + S + +G  +++L        +L+  D +IYWT+ +T SI  V K+ G  R+  T   N++   M +I VS      T + C   +  C  LCF        F C C + 
Sbjct: 1100 STLHRISRASLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLD--------GSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSDRTVLINNNLGWPNGLTVDKTSSQLLW--ADAHTERIEVADLNGANRHTLVSPVQ-HPYGLTLLDSYIYWTDWQTRSIHRADKSTGSNVILVRSNLPGLMDIQAVDRAQ----PLGFNKCGSRNGGCSHLCLP-RPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTDDHTDVHVPVPGLNNVISLDYDSVDGKVYYTDVFLDVIRRADLN--GSNMETVIGHGLKT--TDGLAVDWVARNLYWTDTGRNTIEASRLDGSCR----KVLIN----NSLDEPRA--------IAVFPRKGYLFWTDWGH-IAKIERANLDGSERKVLINA-DLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSG--RNKETVLANVEG-LMDIIVVSPQRQTGTNA-CGVNNGGCSHLCF---ARASDFVCACPDE 1642          

HSP 3 Score: 62.003 bits (149), Expect = 7.722e-8
Identity = 48/129 (37.21%), Postives = 63/129 (48.84%), Query Frame = 3
Query: 4356 CDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ-C-------CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            C  +Q PC +G  F    G+    C++   RCD   DC D SDE  C T   +      RS  C+ ++ RCDG  DC  +SDE+ C       C S +F C +G    RC+     CNG+ DC D SDE
Sbjct:  225 CSSHQ-PCRSG-EFMCDSGL----CVNAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQFLCWNG----RCIGQRKLCNGVNDCGDNSDE 343          

HSP 4 Score: 55.4546 bits (132), Expect = 7.378e-6
Identity = 59/262 (22.52%), Postives = 104/262 (39.69%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLST 4205
             LA+D + D L W+D  T  I    L+    ++          +S  +P  IA+ P+  ++ W   D+  +            IE S +DG+ R ++       P+ LT+D    R+YW+D K            ++ I   ++ G + K  +   L +       ++ V +  L+WTDW  +     S+NS  K +        N + +++KL   + I   + P            Q  P  +      N  C+HLCL +
Sbjct:  515 GLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVL-------LWQSLEKPRAIALHPMEGTIYW--TDWGNTPR----------IEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAK------------HHVIERANLDGSHRKAVISQGLPHPF-----AITVFEDSLYWTDWHTK-----SINSANKFTGK------NQEIIRNKLHFPMDIHT-LHP------------QRQPAGKNRCGDNNGGCTHLCLPS 716          

HSP 5 Score: 55.0694 bits (131), Expect = 9.417e-6
Identity = 55/190 (28.95%), Postives = 72/190 (37.89%), Query Frame = 3
Query: 4326 GFCVKSQLVKCD-------RYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNT------CNISHLY--------------------------SCSR------------SDVCLPITKRCDGVMDCD--SDEQ-----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            G+C++S L  CD            C       K+   S  SC++    CD   DC DGSDE  C +      CN+                               CS             S +C+    RCDG  DCD  SDE+      C +++F C SG    RC+ +S RC+G  DC D SDE  C
Sbjct:  120 GYCIRS-LWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEESCPSAVPSPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCVNAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCRSG----RCVRLSWRCDGEDDCADNSDEENC 304          
BLAST of Low-density lipoprotein receptor-related protein vs. UniProt/SwissProt
Match: sp|Q8VI56|LRP4_MOUSE (Low-density lipoprotein receptor-related protein 4 OS=Mus musculus OX=10090 GN=Lrp4 PE=1 SV=3)

HSP 1 Score: 198.364 bits (503), Expect = 2.687e-49
Identity = 299/1325 (22.57%), Postives = 516/1325 (38.94%), Query Frame = 3
Query:   69 VFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPF-------RFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHG--GSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVA---------SLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADS-IYQVTLSDSSSSITRKQLTFISNV----GHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVESR-ECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDW 3959
            V L+A+   + + + HR    +  N     +A D F  R+  VF        +L+    + L+   + +V+   ++S   +AVDWV   LYW D     IEV +L+           R++LL +++    ++ + P E  ++W   G    +E S +DGS RR+I  + LF  + L ID   + ++W  +D + H ++     G   +   +     P  +T  E  L + +     ++S    TG +  +  N    P+ I +  H    P G+ +    N  C+ +CLP     Y C+C TG  + IN+  C     + L       I  +S D       E LS++  IP           +DS    + + D ++ +I     +  GT Q   +D  + S  P  +A+D  +  +YW +     + VA      R    T+L+            ++    P D+ V+ +  Y++ T     +  IER  +D + +  +ISS N  WP GLA+D   Q+LY+ D     M ++ + G  GSKR  ++  +      L+ +   IYWT+ +T SI S      +  L  +T   +   +  I V         + C   +  C  LC     N   FSC C    ++L +   CS      + F + + +      + D  Y       +DV V          ++ +D    ++YW +   + I +  ++ D  +   I      T   LAVD I   +Y       W+     R+   + D S   V+V   + +    A+ ++ ++ F++W      D    A+L ++ +DGS + +LI   +   + L VD+ ++ + W  + + +I   E+ +   +                     + P      L + DS IY       + SI R   +  SNV     +  G+     V R+  +   K               C + N      CS  CLP  S   C C +   L  D  TC    +  ++ ++ G I      I  + DD  D          P+               N V+ LD       V  T  ++ + +   L         + S  E +  H      +   LA+D ++  L W+D     I A RL+    +     V+IN   S   P  IA+ P    L W   D+           H   IE ++LDG+ R VL+    G P+ LT+D  + RIYW+D   +++    ++    Q+   HV  H   +T                    ++++WTDW
Sbjct:  441 VLLFANRIDIRQVLPHRSEYTLLLNNLENAIALD-FHHRRELVFWSDVTLDRILR----ANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLD--------GAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYW--VDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHT-LHPQRQPAGKNRCGDNNGGCTHLCLP-SGQNYTCACPTGFRK-INSHACAQSLDKFLLFARRMDIRRISFD------TEDLSDDV-IPLADVRSAVALDWDSRDDHVYWTDVSTDTISRAKWD--GTGQEVVVDTSLES--PAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMR----TVLI------------WENLDRPRDIVVEPMGGYMYWTDWG-ASPKIERAGMDASSRQVIISS-NLTWPNGLAIDYGSQRLYWADA---GMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGQRIYWTDWQTKSIQSAD---RLTGLDRETLQENLENLMDIHVFHRQRPPVTTLCAVENGGCSHLCL-RSPNPSGFSCTCPTGINLLRDGKTCSPGMNSFLIFARRIDVR---MVSLDIPYF------ADVVVPINMTMKNTIAIGVDPLEGKVYWSDSTLHRISR--ASLDGSQHEDIITTGLQTTDGLAVDAIGRKVY-------WTDTGTNRIEVGNLDGSMRKVLVWQNLDSPR--AIVLYHEMGFMYW-----TDWGENAKLERSGMDGSDRTVLINNNLGWPNGLTVDKTSSQLLWADAHTERI---EVADLNGANRHTL----------------VSPVQHPYGLTLLDSYIYWTDW--QTRSIHRADKSTGSNVILVRSNLPGLMDIQAVDRAQPLGFNK---------------CGSRNG----GCSHLCLPRPSGFSCACPTGIQLKGDRKTCDPSPETYLLFSSRGSIR----RISLDTDDHTDV-------HVPVPG------------LNNVISLDYDSVHGKVYYTDVFLDVIRRADL---------NGSNMETVIGHGLK---TTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRK-----VLIN--NSLDEPRAIAVFPRKGYLFW--TDWG----------HIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHV-SHPFALTQQD-----------------RWIYWTDW 1574          

HSP 2 Score: 141.354 bits (355), Expect = 5.252e-32
Identity = 160/658 (24.32%), Postives = 274/658 (41.64%), Query Frame = 3
Query:  222 SLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIAL-KTN-PNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAH---------VLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQ 2159
            S L   + + LD  +  D++   +Q+ + +AVD +   +YW D     IEV +L+           R++L+ +N+    ++V+     +++W   G    LERS +DGSDR V+  + L   + L +D+    L W   D    R++     G +     +  Q  P  LT  +  + + + +   +   +  TG ++ L ++N P +  I  + R      P G  K    N  CS +CLP   S + C+C TGI    +   C   P   L   +   I  +SLD      + +            YDSV   + Y D     I   DLN  G+     +   + +     +AVD  +RN+YW +   + +  +R+    R     +L++     +  E R         +AV     YLF T        IER  LDG+++  +I+ T+  WP GL LD   +++Y+VD     + S + +G  +++L        +L+  D +IYWT+ +T SI  V K+ G  R+  T   N++   M +I VS      T + C   +  C  LCF        F C C +            ++    R +  +E       ++  T H +    +  +E   G    + A L L  + N+
Sbjct: 1100 STLHRISRASLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLD--------GSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSDRTVLINNNLGWPNGLTVDKTSSQLLW--ADAHTERIEVADLNGANRHTLVSPVQ-HPYGLTLLDSYIYWTDWQTRSIHRADKSTGSNVILVRSNLPGLMDIQAVDRAQ----PLGFNKCGSRNGGCSHLCLP-RPSGFSCACPTGIQLKGDRKTCDPSPETYLLFSSRGSIRRISLDTDDHTDVHVPVPGLNNVISLDYDSVHGKVYYTDVFLDVIRRADLN--GSNMETVIGHGLKT--TDGLAVDWVARNLYWTDTGRNTIEASRLDGSCR----KVLIN----NSLDEPRA--------IAVFPRKGYLFWTDWGH-IAKIERANLDGSERKVLIN-TDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSG--RNKETVLANVEG-LMDIIVVSPQRQTGTNA-CGVNNGGCTHLCF---ARASDFVCACPDEPDGHPCSLVPGLVPPAPRATSMNEKSPVLPNTLPTTLHSSTTKTRTSLEGAGGRCSERDAQLGLCAHSNE 1712          

HSP 3 Score: 62.003 bits (149), Expect = 8.122e-8
Identity = 49/129 (37.98%), Postives = 63/129 (48.84%), Query Frame = 3
Query: 4356 CDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ-C-------CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            C  +Q PC +G  F    G+    C++   RCD   DC D SDE  C T   +      RS  C+ ++ RCDG  DC  +SDE+ C       C S +F C +G    RC+     CNGI DC D SDE
Sbjct:  225 CSSHQ-PCRSG-EFMCDSGL----CINSGWRCDGDADCDDQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQFLCWNG----RCIGQRKLCNGINDCGDSSDE 343          

HSP 4 Score: 55.4546 bits (132), Expect = 7.195e-6
Identity = 59/262 (22.52%), Postives = 104/262 (39.69%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLST 4205
             LA+D + D L W+D  T  I    L+    ++          +S  +P  IA+ P+  ++ W   D+  +            IE S +DG+ R ++       P+ LT+D    R+YW+D K            ++ I   ++ G + K  +   L +       ++ V +  L+WTDW  +     S+NS  K +        N + +++KL   + I   + P            Q  P  +      N  C+HLCL +
Sbjct:  515 GLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVL-------LWQSLEKPRAIALHPMEGTIYW--TDWGNTPR----------IEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAK------------HHVIERANLDGSHRKAVISQGLPHPF-----AITVFEDSLYWTDWHTK-----SINSANKFTGK------NQEIIRNKLHFPMDIHT-LHP------------QRQPAGKNRCGDNNGGCTHLCLPS 716          
BLAST of Low-density lipoprotein receptor-related protein vs. TrEMBL
Match: U3D8T7 (Low-density lipoprotein receptor-related protein OS=Callithrix jacchus OX=9483 GN=LRP5 PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 1.541e-69
Identity = 361/1513 (23.86%), Postives = 607/1513 (40.12%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMR---VQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPCMNRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSR-SLYLFMAD-SIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVE-SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLS--KNIVLRLDNYGFISAVDRTRPYVM--IKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMG--MHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRN 4730
            S + +A DWV   LYW D +   IEV +LN  S        R++L  +++    ++ ++P   Y++W   G +  +ER+ +DG+ R +I  S ++  + L ID   + L+W   D +   IHR +  G    S R   V+G+     P  LT +   L + + +   + +    TG       +   +P  I ++S++ Q   P    +    N  CS +C L  V+  Y+C+C TG+    N   C       L +     +  +SLD      + L  ++        YD +   + + D    +I           +R YLD       I++DI  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  +A+  +   ++ T   +    IE   LDG ++  +++++   WP GLALD    +LY+ D  K D I V    G+KR  +L  K       +   +FIYWT+ +  SI  V K   S   ++ +  +L    M + AV+  A I   +PC   +  C  LCF       S  CGC     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   K R     + +A +DG+  M +   V   ++L +D     + W   D+  I    ++ ++                 + +  H +  ++ S Y++  D +++ +  +D +S   R   T I   GH        FV   +   +     ++ D   + V       HDN   C Q CL +     CGC S Y+L   G  C   +  L+  +    I  +  +  +  D  +       +     +   KFI   YW+   +NI    D        D T+P+V+  + + +    Q HD                        L+ID  S TL W+   T  I   RL+      E +GV++  R  R +P  I +      L + +     ++           IE + LDG  R VL     I P  L VD   G+++W D             D  +I +  + G N     D+ +   +G     + VL K+L+W D  QQ+   +   +  K +   G   H   +  ++D           ++ E+F +         HPC+R     +N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+    RCD   +C D SDE GC  C+ +  + C+R   C+ +  RCDG  DC   SDE  C +     +F C SG+    C+ I  +C+   DC DGSDE  C  N
Sbjct:  105 SPDGLACDWVGKKLYWTDSETNRIEVANLNGTS--------RKVLFWQDLDQPRAIALNPAHGYMYWTDWGEMPRIERAGMDGTTRNIIVDSDIYWPNGLTIDLEEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTH--PFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQ---PFFHTRCEEDNGGCSHLCLLSPVEPFYKCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAI-----------RRAYLDGSGAQTLINTDINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILVS------------EDLDEPRAIALHPVMGLMYWTDWGENP-KIECANLDGQERRVLVNASLG-WPNGLALDLQEGKLYWGD-AKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDIIIDQLPDL----MGLKAVNV-AKIMGTNPCADENGGCSHLCF---FTPRSTRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVK---EASALDFDVANNHIYWTDVSLKTISRAFLNGSSVEHVVEFGL--DYPEGMAVDWMGKNLYWADTGT--NRIEVARL-----DGQFRQVLVWRDLDNP--RSLALDPTEGYIYWTEWGGKPR-----IVRAFMDGTNCMTLVDKVGRANDLTIDYTDRRLYWTDLDTNMIESSNMLGQE-------------RVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNR---TLIQ--GH------LDFVMDILVFHS-----SRQDGLNDCV-------HDNG-QCGQLCLAIPGGHRCGCASHYTLDPSGRNCSPPTTFLL-FSQKSAISRMIPDDQHSPDLVLPLHGLRNVKAIDYDPLDKFI---YWVDGRQNIKRAKD--------DGTQPFVLTSLSQAQNPDRQPHD------------------------LSIDIYSRTLFWTCEATNTINVHRLSG-----EAIGVVL--RGDRDKPRAIVVNAERGYLYFTNMQDRAAK-----------IERAALDGTEREVLFTTGLIRPVALVVDNALGKLFWADA------------DLKRIESCDLSGANRLTLEDANIVQPLG-----LTVLGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVTHLTGIHAVED-----------VSLEEFSA---------HPCAR-----DNGGCSHICIA-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPDQFACATGEI----------DCIPGAWRCDGFPECDDQSDEEGCPVCSAAQ-FPCARGQ-CVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQ----CVLIKQQCDSFPDCIDGSDELMCEIN 1369          

HSP 2 Score: 85.5001 bits (210), Expect = 1.553e-12
Identity = 138/634 (21.77%), Postives = 242/634 (38.17%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLD-------------------------GEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGIT-EPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDF---------NSSSIFSL-DLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASID--TGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCS 2009
            LKT + + L+   +  V++F +   E +AVDW+  NLYWAD     IEV  L  D  F      R++L+ R++ +  SL +DP E Y++W + G    + R+ +DG++   +   +  +++ L ID   + L+W  LD                         G     DY   T  ++       + S    T  +G L F+ D  ++ SS +   G++  +  N     +        L +P G                      +RC C++  T +P      P  PT  L       I  M  D    P L L            YD +   + +VD          + +  F L  L++   P R           P  +++D  SR ++W     + + V R+S     +   ++L           R  +++P   + V++   YL+ T + D    IER  LDGT++  V+ +T    P  L +D    +L++ D     + S +  G ++  L      + + L+     +YW + +   I  V K  G  R+ +          +  I    + S++  +  PC   +  C  +C  I     +  C C     +L N+  C 
Sbjct:  692 LKTISRAFLNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARL--DGQF------RQVLVWRDLDNPRSLALDPTEGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKV-GRANDLTIDYTDRRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQ--DGLNDCVHDNGQCGQLC-------LAIPGG----------------------HRCGCASHYTLDPSGRNCSP--PTTFLLFSQKSAISRMIPDDQHSPDLVLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQAQNPDR----------QPHDLSIDIYSRTLFWTCEATNTINVHRLSG----EAIGVVL-----------RGDRDKPRA-IVVNAERGYLYFTNMQDRAAKIERAALDGTER-EVLFTTGLIRPVALVVDNALGKLFWADADLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRIQGR----VTHLTGIHAVEDVSLEEFSAHPCARDNGGCSHIC--IAKGDGTPRCSCPVHLVLLQNLLTCG 1250          
BLAST of Low-density lipoprotein receptor-related protein vs. TrEMBL
Match: F7B2X4 (Low-density lipoprotein receptor-related protein OS=Callithrix jacchus OX=9483 GN=LRP5 PE=3 SV=3)

HSP 1 Score: 271.552 bits (693), Expect = 1.701e-69
Identity = 361/1513 (23.86%), Postives = 607/1513 (40.12%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMR---VQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPCMNRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSR-SLYLFMAD-SIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVE-SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLS--KNIVLRLDNYGFISAVDRTRPYVM--IKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMG--MHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRN 4730
            S + +A DWV   LYW D +   IEV +LN  S        R++L  +++    ++ ++P   Y++W   G +  +ER+ +DG+ R +I  S ++  + L ID   + L+W   D +   IHR +  G    S R   V+G+     P  LT +   L + + +   + +    TG       +   +P  I ++S++ Q   P    +    N  CS +C L  V+  Y+C+C TG+    N   C       L +     +  +SLD      + L  ++        YD +   + + D    +I           +R YLD       I++DI  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  +A+  +   ++ T   +    IE   LDG ++  +++++   WP GLALD    +LY+ D  K D I V    G+KR  +L  K       +   +FIYWT+ +  SI  V K   S   ++ +  +L    M + AV+  A I   +PC   +  C  LCF       S  CGC     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   K R     + +A +DG+  M +   V   ++L +D     + W   D+  I    ++ ++                 + +  H +  ++ S Y++  D +++ +  +D +S   R   T I   GH        FV   +   +     ++ D   + V       HDN   C Q CL +     CGC S Y+L   G  C   +  L+  +    I  +  +  +  D  +       +     +   KFI   YW+   +NI    D        D T+P+V+  + + +    Q HD                        L+ID  S TL W+   T  I   RL+      E +GV++  R  R +P  I +      L + +     ++           IE + LDG  R VL     I P  L VD   G+++W D             D  +I +  + G N     D+ +   +G     + VL K+L+W D  QQ+   +   +  K +   G   H   +  ++D           ++ E+F +         HPC+R     +N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+    RCD   +C D SDE GC  C+ +  + C+R   C+ +  RCDG  DC   SDE  C +     +F C SG+    C+ I  +C+   DC DGSDE  C  N
Sbjct:   99 SPDGLACDWVGKKLYWTDSETNRIEVANLNGTS--------RKVLFWQDLDQPRAIALNPAHGYMYWTDWGEMPRIERAGMDGTTRNIIVDSDIYWPNGLTIDLEEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTH--PFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQ---PFFHTRCEEDNGGCSHLCLLSPVEPFYKCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAI-----------RRAYLDGSGAQTLINTDINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILVS------------EDLDEPRAIALHPVMGLMYWTDWGENP-KIECANLDGQERRVLVNASLG-WPNGLALDLQEGKLYWGD-AKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDIIIDQLPDL----MGLKAVNV-AKIMGTNPCADENGGCSHLCF---FTPRSTRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVK---EASALDFDVANNHIYWTDVSLKTISRAFLNGSSVEHVVEFGL--DYPEGMAVDWMGKNLYWADTGT--NRIEVARL-----DGQFRQVLVWRDLDNP--RSLALDPTEGYIYWTEWGGKPR-----IVRAFMDGTNCMTLVDKVGRANDLTIDYTDRRLYWTDLDTNMIESSNMLGQE-------------RVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNR---TLIQ--GH------LDFVMDILVFHS-----SRQDGLNDCV-------HDNG-QCGQLCLAIPGGHRCGCASHYTLDPSGRNCSPPTTFLL-FSQKSAISRMIPDDQHSPDLVLPLHGLRNVKAIDYDPLDKFI---YWVDGRQNIKRAKD--------DGTQPFVLTSLSQAQNPDRQPHD------------------------LSIDIYSRTLFWTCEATNTINVHRLSG-----EAIGVVL--RGDRDKPRAIVVNAERGYLYFTNMQDRAAK-----------IERAALDGTEREVLFTTGLIRPVALVVDNALGKLFWADA------------DLKRIESCDLSGANRLTLEDANIVQPLG-----LTVLGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVTHLTGIHAVED-----------VSLEEFSA---------HPCAR-----DNGGCSHICIA-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPDQFACATGEI----------DCIPGAWRCDGFPECDDQSDEEGCPVCSAAQ-FPCARGQ-CVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQ----CVLIKQQCDSFPDCIDGSDELMCEIN 1363          

HSP 2 Score: 85.8853 bits (211), Expect = 1.311e-12
Identity = 138/634 (21.77%), Postives = 242/634 (38.17%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLD-------------------------GEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGIT-EPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDF---------NSSSIFSL-DLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASID--TGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCS 2009
            LKT + + L+   +  V++F +   E +AVDW+  NLYWAD     IEV  L  D  F      R++L+ R++ +  SL +DP E Y++W + G    + R+ +DG++   +   +  +++ L ID   + L+W  LD                         G     DY   T  ++       + S    T  +G L F+ D  ++ SS +   G++  +  N     +        L +P G                      +RC C++  T +P      P  PT  L       I  M  D    P L L            YD +   + +VD          + +  F L  L++   P R           P  +++D  SR ++W     + + V R+S     +   ++L           R  +++P   + V++   YL+ T + D    IER  LDGT++  V+ +T    P  L +D    +L++ D     + S +  G ++  L      + + L+     +YW + +   I  V K  G  R+ +          +  I    + S++  +  PC   +  C  +C  I     +  C C     +L N+  C 
Sbjct:  686 LKTISRAFLNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARL--DGQF------RQVLVWRDLDNPRSLALDPTEGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKV-GRANDLTIDYTDRRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQ--DGLNDCVHDNGQCGQLC-------LAIPGG----------------------HRCGCASHYTLDPSGRNCSP--PTTFLLFSQKSAISRMIPDDQHSPDLVLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQAQNPDR----------QPHDLSIDIYSRTLFWTCEATNTINVHRLSG----EAIGVVL-----------RGDRDKPRA-IVVNAERGYLYFTNMQDRAAKIERAALDGTER-EVLFTTGLIRPVALVVDNALGKLFWADADLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRIQGR----VTHLTGIHAVEDVSLEEFSAHPCARDNGGCSHIC--IAKGDGTPRCSCPVHLVLLQNLLTCG 1244          
BLAST of Low-density lipoprotein receptor-related protein vs. TrEMBL
Match: A0A2K6S508 (Low-density lipoprotein receptor-related protein OS=Saimiri boliviensis boliviensis OX=39432 GN=LRP5 PE=3 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 2.108e-69
Identity = 362/1511 (23.96%), Postives = 608/1511 (40.24%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMR---VQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPCMNRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSR-SLYLFMAD-SIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVE-SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLS--KNIVLRLDNYGFISAVDRTRPYVM--IKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRN 4730
            S + +A DWV   LYW D +   IEV +LN  S        R++L  +++    ++ ++P   Y++W   G +  +ER+ +DGS R +I  S ++  + L ID   + L+W   D +   IHR +  G    S R   V+G+     P  LT +   L + + +   + +    TG       +   +P  I ++S++ Q   P    +    N  CS +C L  V+  Y C+C TG+    N   C       L +     +  +SLD      + L  ++        YD +   + + D    +I           +R YLD       I+++I  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  +A+  +   ++ T   +    IE   LDG ++  +++++   WP GLALD    +LY+ D  K D I V    G+KR  +L  K       +   +FIYWT+ +  SI  V K   S   ++ +  +L    M + AV+    I T +PC   +  C  LCF      HS  CGC     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   K R     + +A +DG+  M +   V   ++L +D     + W   D+  I    ++ ++                 + +  H +  ++ S Y++  D +++ +  +D +S   R   T I   GH        FV   +   +     ++ D   + V       HDN   C Q CL +     CGC S Y+L   G  C   +  L+  +    I  +  +  +  D  +       +     +   KFI   YW+   +NI    D        D T+P+V+  + + +    Q HD                        L+ID  S TL W+   T  I   RL+      E +GV++  R  R +P  I +      L + +     ++           IE + LDG  R VL     I P  L VD   G+++W D             D  +I +  + G N     D+ +   +G     + VL K+L+W D  QQ+   +   +  K +   G     + +L     T +  +  ++ E+F +         HPC+R     +N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+    RCD   +C D SDE GC  C+ +  + C+R   C+ +  RCDG  DC   SDE  C +     +F C SG+    C+ I  +C+   DC DGSDE  C  N
Sbjct:  142 SPDGLACDWVGKKLYWTDSETNRIEVANLNGTS--------RKVLFWQDLDQPRAIALNPAHGYMYWTDWGEMPRIERAGMDGSTRNIIVDSDIYWPNGLTIDLEEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTH--PFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQ---PFFHTRCEEDNGGCSHLCLLSPVEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAI-----------RRAYLDGSGAQTLINTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILVS------------EDLDEPRAIALHPVMGLMYWTDWGENP-KIECANLDGQERRVLVNASLG-WPNGLALDLQEGKLYWGD-AKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDIIIDQLPDL----MGLKAVNVARIIGT-NPCADENGGCSHLCF---FTPHSTRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVK---EASALDFDVANNHIYWTDVSLKTISRAFLNGSSVEHVVEFGL--DYPEGMAVDWMGKNLYWADTGT--NRIEVARL-----DGQFRQVLVWRDLDNPR--SLALDPTEGYIYWTEWGGKPR-----IVRAFMDGTNCMTLVDKVGRANDLTIDYTDQRLYWTDLDTNMIESSNMLGQE-------------RVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNR---TLIQ--GH------LDFVMDILVFHS-----SRQDGLNDCV-------HDNG-QCGQLCLAIPGGHRCGCASHYTLDPSGRNCSPPTTFLL-FSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFI---YWVDGRQNIKRAKD--------DGTQPFVLTSLSQAQNPDRQPHD------------------------LSIDIYSRTLFWTCEATNTINVHRLSG-----EAMGVVL--RGDRDKPRAIIVNAERGYLYFTNMQDRAAK-----------IERAALDGTEREVLFTTGLIRPVALVVDNALGKLFWADA------------DLKRIESCDLSGANRLTLEDANIVQPLG-----LTVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQG----RVTHL-----TGIHAVEEVSLEEFSA---------HPCAR-----DNGGCSHICIA-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPDQFACATGEI----------DCIPGAWRCDGFPECDDQSDEEGCPVCSAAQ-FPCARGQ-CVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQ----CVLIKQQCDSFPDCIDGSDELMCEIN 1406          

HSP 2 Score: 83.5741 bits (205), Expect = 6.550e-12
Identity = 140/632 (22.15%), Postives = 239/632 (37.82%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLD-------------------------GEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGIT-EPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDF---------NSSSIFSL-DLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCS 2009
            LKT + + L+   +  V++F +   E +AVDW+  NLYWAD     IEV  L  D  F      R++L+ R++ +  SL +DP E Y++W + G    + R+ +DG++   +   +  +++ L ID   + L+W  LD                         G     DY   T  ++       + S    T  +G L F+ D  ++ SS +   G++  +  N     +        L +P G                      +RC C++  T +P      P  PT  L       I  M  D    P L L            YD +   + +VD          + +  F L  L++   P R           P  +++D  SR ++W     + + V R+S     +   ++L           R  +++P   + V++   YL+ T + D    IER  LDGT++  V+ +T    P  L +D    +L++ D     + S +  G ++  L      + + L+     +YW + +   I  V K  G  R+ V            V  VS      +  PC   +  C  +C  I     +  C C     +L N+  C 
Sbjct:  729 LKTISRAFLNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARL--DGQF------RQVLVWRDLDNPRSLALDPTEGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKV-GRANDLTIDYTDQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQ--DGLNDCVHDNGQCGQLC-------LAIPGG----------------------HRCGCASHYTLDPSGRNCSP--PTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQAQNPDR----------QPHDLSIDIYSRTLFWTCEATNTINVHRLSG----EAMGVVL-----------RGDRDKPRA-IIVNAERGYLYFTNMQDRAAKIERAALDGTER-EVLFTTGLIRPVALVVDNALGKLFWADADLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGIHAVEEVSLEEF--SAHPCARDNGGCSHIC--IAKGDGTPRCSCPVHLVLLQNLLTCG 1287          
BLAST of Low-density lipoprotein receptor-related protein vs. TrEMBL
Match: U3D8R2 (Low-density lipoprotein receptor-related protein OS=Callithrix jacchus OX=9483 GN=LRP5 PE=2 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 2.490e-69
Identity = 361/1513 (23.86%), Postives = 607/1513 (40.12%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMR---VQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPCMNRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSR-SLYLFMAD-SIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVE-SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLS--KNIVLRLDNYGFISAVDRTRPYVM--IKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMG--MHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRN 4730
            S + +A DWV   LYW D +   IEV +LN  S        R++L  +++    ++ ++P   Y++W   G +  +ER+ +DG+ R +I  S ++  + L ID   + L+W   D +   IHR +  G    S R   V+G+     P  LT +   L + + +   + +    TG       +   +P  I ++S++ Q   P    +    N  CS +C L  V+  Y+C+C TG+    N   C       L +     +  +SLD      + L  ++        YD +   + + D    +I           +R YLD       I++DI  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  +A+  +   ++ T   +    IE   LDG ++  +++++   WP GLALD    +LY+ D  K D I V    G+KR  +L  K       +   +FIYWT+ +  SI  V K   S   ++ +  +L    M + AV+  A I   +PC   +  C  LCF       S  CGC     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + RL     D  +  V+V   + N    ++++     +++W E   K R     + +A +DG+  M +   V   ++L +D     + W   D+  I    ++ ++                 + +  H +  ++ S Y++  D +++ +  +D +S   R   T I   GH        FV   +   +     ++ D   + V       HDN   C Q CL +     CGC S Y+L   G  C   +  L+  +    I  +  +  +  D  +       +     +   KFI   YW+   +NI    D        D T+P+V+  + + +    Q HD                        L+ID  S TL W+   T  I   RL+      E +GV++  R  R +P  I +      L + +     ++           IE + LDG  R VL     I P  L VD   G+++W D             D  +I +  + G N     D+ +   +G     + VL K+L+W D  QQ+   +   +  K +   G   H   +  ++D           ++ E+F +         HPC+R     +N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+    RCD   +C D SDE GC  C+ +  + C+R   C+ +  RCDG  DC   SDE  C +     +F C SG+    C+ I  +C+   DC DGSDE  C  N
Sbjct:  105 SPDGLACDWVGKKLYWTDSETNRIEVANLNGTS--------RKVLFWQDLDQPRAIALNPAHGYMYWTDWGEMPRIERAGMDGTTRNIIVDSDIYWPNGLTIDLEEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTH--PFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQ---PFFHTRCEEDNGGCSHLCLLSPVEPFYKCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAI-----------RRAYLDGSGAQTLINTDINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILVS------------EDLDEPRAIALHPVMGLMYWTDWGENP-KIECANLDGQERRVLVNASLG-WPNGLALDLQEGKLYWGD-AKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDIIIDQLPDL----MGLKAVNV-AKIMGTNPCADENGGCSHLCF---FTPRSTRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVK---EASALDFDVANNHIYWTDVSLKTISRAFLNGSSVEHVVEFGL--DYPEGMAVDWMGKNLYWADTGT--NRIEVARL-----DGQFRQVLVWRDLDNP--RSLALDPTEGYIYWTEWGGKPR-----IVRAFMDGTNCMTLVDKVGRANDLTIDYTDRRLYWTDLDTNMIESSNMLGQE-------------RVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNR---TLIQ--GH------LDFVMDILVFHS-----SRQDGLNDCV-------HDNG-QCGQLCLAIPGGHRCGCASHYTLDPSGRNCSPPTTFLL-FSQKSAISRMIPDDQHSPDLVLPLHGLRNVKAIDYDPLDKFI---YWVDGRQNIKRAKD--------DGTQPFVLTSLSQAQNPDRQPHD------------------------LSIDIYSRTLFWTCEATNTINVHRLSG-----EAIGVVL--RGDRDKPRAIVVNAERGYLYFTNMQDRAAK-----------IERAALDGTEREVLFTTGLIRPVALVVDNALGKLFWADA------------DLKRIESCDLSGANRLTLEDANIVQPLG-----LTVLGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVTHLTGIHAVED-----------VSLEEFSA---------HPCAR-----DNGGCSHICIA-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPDQFACATGEI----------DCIPGAWRCDGFPECDDQSDEEGCPVCSAAQ-FPCARGQ-CVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQ----CVLIKQQCDSFPDCIDGSDELMCEIN 1369          

HSP 2 Score: 85.1149 bits (209), Expect = 2.069e-12
Identity = 138/634 (21.77%), Postives = 242/634 (38.17%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLD-------------------------GEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGIT-EPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDF---------NSSSIFSL-DLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASID--TGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCS 2009
            LKT + + L+   +  V++F +   E +AVDW+  NLYWAD     IEV  L  D  F      R++L+ R++ +  SL +DP E Y++W + G    + R+ +DG++   +   +  +++ L ID   + L+W  LD                         G     DY   T  ++       + S    T  +G L F+ D  ++ SS +   G++  +  N     +        L +P G                      +RC C++  T +P      P  PT  L       I  M  D    P L L            YD +   + +VD          + +  F L  L++   P R           P  +++D  SR ++W     + + V R+S     +   ++L           R  +++P   + V++   YL+ T + D    IER  LDGT++  V+ +T    P  L +D    +L++ D     + S +  G ++  L      + + L+     +YW + +   I  V K  G  R+ +          +  I    + S++  +  PC   +  C  +C  I     +  C C     +L N+  C 
Sbjct:  692 LKTISRAFLNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARL--DGQF------RQVLVWRDLDNPRSLALDPTEGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKV-GRANDLTIDYTDRRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQ--DGLNDCVHDNGQCGQLC-------LAIPGG----------------------HRCGCASHYTLDPSGRNCSP--PTTFLLFSQKSAISRMIPDDQHSPDLVLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQAQNPDR----------QPHDLSIDIYSRTLFWTCEATNTINVHRLSG----EAIGVVL-----------RGDRDKPRA-IVVNAERGYLYFTNMQDRAAKIERAALDGTER-EVLFTTGLIRPVALVVDNALGKLFWADADLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRIQGR----VTHLTGIHAVEDVSLEEFSAHPCARDNGGCSHIC--IAKGDGTPRCSCPVHLVLLQNLLTCG 1250          
BLAST of Low-density lipoprotein receptor-related protein vs. TrEMBL
Match: G3VNB7 (Low-density lipoprotein receptor-related protein OS=Sarcophilus harrisii OX=9305 GN=LRP5 PE=3 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 7.509e-69
Identity = 353/1518 (23.25%), Postives = 604/1518 (39.79%), Query Frame = 3
Query:  267 MRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMR---VQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPCM--NRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFP-----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR-ILAQKFQEFISLSYFDNFIYWTELETLSI---HSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSR-SLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPV-ESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLS--KNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGS----QKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            +++V+   + S + +A DW+   LYW D +   IEV +LN  S        R++L  +++    ++ +DP   Y++W   G    +ER+ +D S R++I  S ++  + L ID   + L+W   D +   IHR +  G    S R   V+G+     P  LT +   L + + +   + +    TG           +P  I ++S+  Q         +PC   N  CS +C L   +  Y C+C TG+    N   C       L +     +  +SLD      + L  ++        YD V   + + D    +I           +R YLD       +S++I  P  IAVD  +RN+YW +     + V R++  +R     +L+S            +    P  + ++ +  Y++ T   +    IE   LDG Q   V+ +T+  WP GLALD    +LY+ D     +  +N  G  +R +L  K       +   ++IYWT+ +  SI   H VK D  +  ++ +  +L    M + AV+    I T +PC   +  C  LCF      H+  CGC     +L ++  C      +V+ +++ +    L  N +   I L   +   + ++L  D   N IYW + +   I +   N      +  F L  D    +AVD++  NLY + T +  +RI + RL     D  +  V+V   + N    ++++     +L+W E   K R     + +A++DG+  + +   V   ++L +D     + W   D+  I    ++ ++                 + +  H +  ++ S Y++  D  + +   + ++ +T K  T I   GH        FV   +   + +          + +  C  +N      C Q CL V     C C + YSL  +   C   +  L+  +    I  +  +     D  +       +     +   KFI   YW+   +NI    D        D ++P+++    +    Q HD                        L+ID  S TL W+   T  +   RL+      E +GV++  R  R RP  IA+      + + +     ++           IE + LDG  R VL     I P  L VD H G+++W+D             D  +I +  + G N     DS +   VG     + VL  +L+W D  QQ+   +      K +   G     + +L     T +  +  +  E+F +         HPCSR     +N  CSH+C++                 + DG  RCSCPV + +              +   C   Q  C  G +           C+ +  RCD   +C D SDE  C  C+ +  + C +   C+ +  RC+G +DC   SDE  C +     +F C SG+    C+ I  +C+   DC DGSDE  C
Sbjct:   96 VQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANLNGTS--------RKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLEEQKLYW--ADAKLSFIHRANLDG----SFRQKVVEGSLTH--PFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILGALYSPMDIQVLSQDRQPYF-----HTPCEEDNGGCSHLCLLSPREPFYTCACPTGVQLEDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDIILQIDDIRHAIAIDYDPVERYVYWTDDEVRAI-----------RRAYLDGSGAQTLVSTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR----KILIS------------ENLDEPRAIVLNPVMGYMYWTDWGESP-KIECAHLDG-QARRVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTRRRTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKVKADRDV--IIDQLPDL----MGLKAVNVAKVIGT-NPCGEKNGGCSHLCF---FTPHATKCGCPIGLELLSDLQTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVK---EASALDFDVSNNHIYWTDVSLKTISRAYMNGSSVEHVIQFGL--DYPEGMAVDWMGRNLYWADTGT--NRIEVARL-----DGQYRQVLVWKDLDNP--RSLALDPTKGYLYWTEWGGKPR-----IVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQE-------------RIIIADDLPHPFGLTQYSDYIYWTD--WNLHSIERANKLTGKNRTLIQ--GH------LDFVMDILVFHSSR---------QDGLNDCVQNNGH----CGQLCLAVPNGYRCACATHYSLDPNHRNCSSPTTFLL-FSQKCAISRMIPDDQQSPDVVLPLHGLRNVRAIDYDPLDKFI---YWVDGRQNIKRARD--------DGSQPFIVTSASQGQEKQPHD------------------------LSIDVYSHTLYWTCEATNTVNVHRLSG-----EAIGVVL--RGDRDRPRAIAVNAERGYMYFTNMQDRAAK-----------IERAALDGTEREVLFTTGLIRPVALVVDNHLGKLFWVDA------------DLKRIESCDLSGANRVTLEDSNIVQPVG-----LTVLGDHLYWIDRQQQMIERVEKTGGYKRTRIQG----RISHL-----TGIHAVEEVDMEEFAA---------HPCSR-----DNGGCSHICIA-----------------KGDGTPRCSCPVHLVLLQN------LLTCGEPPTCSPDQFTCATGEI----------DCIPMAWRCDGFPECDDHSDEADCPVCSAAQ-FQCEKGQ-CIDLRWRCNGEIDCQDKSDEADCDAICLPNQFRCASGQ----CILIKQQCDSFPDCMDGSDELLC 1365          

HSP 2 Score: 137.502 bits (345), Expect = 2.200e-28
Identity = 188/817 (23.01%), Postives = 338/817 (41.37%), Query Frame = 3
Query:  252 LDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKL------VFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLM------VPRGRRKSPC--MNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTIS------NLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            LD    + ++   +   + +AVDWV+ NLYW D     IEV  LN  S        R+IL+S N+ +  ++V++P   Y++W   G    +E + LDG  RRV+  + L   + LA+D     L+W   D +  +++        + V GT ++      T  E KL        + D   W             +K + ++    II +   LM      V +    +PC   N  CS +C      A +C C  G+ E +++      P   L   +   I+ +SL+     +  PL  + E + + F    D   + + + D +  +I    +N  G+     + F +  D P  +AVD   RN+YW +   + + VAR+      +Y  +L+            ++    P  LA+D    YL+ T    G   I R ++DGT   T++          L +D   Q+LY+ D     + S N  G  + I+A        L+ + ++IYWT+    SI    K  G  R+L+    +     +  I V  ++  D  + C   +  C QLC  +    + + C C+    +  N   CS  +  +++  K  +    + P+  +    +        V ++  D     IYW++   N  +K A +   Q     F ++S +        +L++D   + LY   T  A + + + RL       S   + V  +       A++V+++  ++++  T  +DR   A++ +A LDG++  +L   G+     LVVD     + W  +D  +I
Sbjct:  399 LDGSGAQTLVSTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS--------RKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAHLDGQARRVLVNTSLGWPNGLALDLQEGKLYWG--DAKTDKIEV-------INVDGTRRR------TLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKVKADRDV----IIDQLPDLMGLKAVNVAKVIGTNPCGEKNGGCSHLCF-FTPHATKCGCPIGL-ELLSDLQTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDF----DVSNNHIYWTDVSLKTISRAYMN--GSSVEHVIQFGL--DYPEGMAVDWMGRNLYWADTGTNRIEVARLDG----QYRQVLV------------WKDLDNPRSLALDPTKGYLYWTEWG-GKPRIVRAYMDGTNSITLVDKVGR--ANDLTIDYADQRLYWTDLDTNMIESSNMLGQERIIIADDLPHPFGLTQYSDYIYWTDWNLHSIERANKLTGKNRTLIQGHLDF----VMDILVFHSSRQDGLNDCVQNNGHCGQLCLAV---PNGYRCACATHYSLDPNHRNCSSPTTFLLFSQKCAI--SRMIPDDQQSPDVVLPLHGLRNVRAIDYDPLDKFIYWVDGRQN--IKRARDDGSQP----FIVTSASQGQEKQPHDLSIDVYSHTLYW--TCEATNTVNVHRL-------SGEAIGVVLRGDRDRPRAIAVNAERGYMYF--TNMQDR--AAKIERAALDGTEREVLFTTGLIRPVALVVDNHLGKLFWVDADLKRI 1131          

HSP 3 Score: 97.4413 bits (241), Expect = 4.050e-16
Identity = 134/633 (21.17%), Postives = 248/633 (39.18%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLD-------------------------GEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDF---------NSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASID----TGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCS 2009
            LKT + + ++   +  V++F +   E +AVDW+  NLYWAD     IEV  L+         + R++L+ +++ +  SL +DP + YL+W + G    + R+ +DG++   +   +  +++ L ID   + L+W  LD                         G     DY   T  ++       + +    T  +G L F+ D  ++ SS +   G++  ++ N +                            C  +CL  V + YRC+C+T  +   N+  C + PT  L       I  M  D    P + L            YD +   + +VD          + S  F +     G  ++           P  +++D  S  +YW     + V V R+S     +   ++L           R  +++P   +AV++   Y++ T + D    IER  LDGT++  V+ +T    P  L +D +  +L++VD     + S +  G ++  L      + + L+   + +YW + +   I  V+  G  +    +TR +  R   +  +     +D       PC   +  C  +C  I     +  C C     +L N+  C 
Sbjct:  693 LKTISRAYMNGSSVEHVIQFGLDYPEGMAVDWMGRNLYWADTGTNRIEVARLD--------GQYRQVLVWKDLDNPRSLALDPTKGYLYWTEWGGKPRIVRAYMDGTNSITLVDKV-GRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERIIIADDLPHPFGLTQYSDYIYWTDWNLHSIERANKLTGKNRTLIQGHLDFVMDILVFHSSRQ--DGLNDCVQNNGH----------------------------CGQLCL-AVPNGYRCACATHYSLDPNHRNCSS-PTTFLLFSQKCAISRMIPDDQQSPDVVLPLHGLRNVRAIDYDPLDKFIYWVDGRQNIKRARDDGSQPFIVTSASQGQEKQ-----------PHDLSIDVYSHTLYWTCEATNTVNVHRLSG----EAIGVVL-----------RGDRDRPRA-IAVNAERGYMYFTNMQDRAAKIERAALDGTER-EVLFTTGLIRPVALVVDNHLGKLFWVDADLKRIESCDLSGANRVTLEDSNIVQPVGLTVLGDHLYWIDRQQQMIERVEKTGGYK----RTR-IQGRISHLTGIHAVEEVDMEEFAAHPCSRDNGGCSHIC--IAKGDGTPRCSCPVHLVLLQNLLTCG 1249          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Cavefish
Match: lrp5 (low density lipoprotein receptor-related protein 5 [Source:ZFIN;Acc:ZDB-GENE-050518-2])

HSP 1 Score: 177.178 bits (448), Expect = 6.169e-44
Identity = 189/791 (23.89%), Postives = 342/791 (43.24%), Query Frame = 3
Query:  291 VQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDSA-YRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFA--YDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            + S + +A DW+   LYW D +   IEV +L+  S        R++L  +++    ++ ++P ++Y++W   G    +ER+ +DGS RRVI +  ++  + L ID   + L+W   D +   IHR +  G T     V+GT     P  LT  E  L + + +   + +    TG +     N   +P  I ++ ++ Q  +      +PC   N  CS +CL       Y C+C TG+    +   C     + L +     +  +SLD  L    +++ + + I    A  YD V   + + D    +I    L+  GT  +  +   I+   P  IAVD  +RN+YW +     + V R++  +R    +  LS                 P  + +D I+ Y++ T   +    IER  LDG+++  +++S+   WP GLALD    +LY+ D  K D I V    GS R  +L  K       +   ++IYW++ +  SI  V    ++R ++ +        M + A     +  T   C  ++  C  LCF         SC C     +L ++  C      +++ N++ +    L  N++   I L       + ++L  D   N+I+W + +   I     N      +  F L  D    +AVD++  N+Y + T +  +RI + RL     D  +  V+V   ++N    ++++     +++W E   + R     + +AH+DG+  + +   V   + L +D     + W   D+  I
Sbjct:   81 LDSPDGLACDWLGRKLYWTDSETNRIEVANLDGTS--------RKVLFWQDLDQPRAIALNPQQRYMYWTDWGEEPRIERAGMDGSSRRVIVEEEIYWPNGLTIDLEEQKLYW--ADAKLSFIHRANLDG-TARETVVEGTLTH--PFALTLFEETLYWTDWQTRSIHACNKHTGDNRREILNGIYSPMDIQVLGQERQPYI-----HTPCSDDNGGCSHLCLLSPSPPFYSCACPTGVKLREDGKTCRPGAEQVLLLARRTDLRRISLD--LPDFTDIVLQVSDIRHAIAIDYDPVEGYVYWTDDEVKAIRRARLD--GTEAQTLITTEINH--PDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRRVLISERLS----------------EPRAIVLDPIHGYMYWTDWGEKP-KIERANLDGSERVVLVNSSLG-WPNGLALDYATGKLYWGD-AKTDKIEVINMDGSNRMVLLEDKLPHIFGFTLLGDYIYWSDWQRRSIERVHTSKAVREVIVEQL---PDLMGLKATKVTETFGTNG-CADSNGGCSHLCF---FGPRGVSCACPMGLELLSDLHTCVVPEAFLLFTNRAEIRRISLGTNSNNVAIPLTGVR---EASALDFDMAENRIFWTDVSTKTISMAFMNGSGVETVIEFGL--DYPEGMAVDWMGRNIYWADTGT--NRIEVARL-----DGQYRQVLVCKDLENP--RSLALDPANGYMYWAEWGGRPR-----IARAHMDGTNIVTLVDKVGRANGLTIDYADQRLYWTDLDTCMI 802          

HSP 2 Score: 124.02 bits (310), Expect = 1.067e-27
Identity = 159/710 (22.39%), Postives = 294/710 (41.41%), Query Frame = 3
Query:  102 KSILHRHGVDIFFNTDLKLLAADV-------FLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFIND-EQLWVSSFECGTGI-SIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSL---DGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYG--TPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAAN 2186
            ++ L R  +D+   TD+ L  +D+       +   + YV+   +  K++ +    ++LD  + + ++   +   + +AVDWV+ NLYW D     IEV  LN  S        RR+L+S  +++  ++V+DP   Y++W   G    +ER+ LDGS+R V+  S L   + LA+D     L+W   D +  +++     G +  V    +   P    FT  G  ++ +D ++  +        +  + ++  P++  +    +  ++    G       N  CS +C         C+C  G+ E +++      P   L   N  +I  +SL      +  PL  + E + + F    D   + + + D ++ +I    +N  G  T   F LD+P        +AVD   RNIYW +   + + VAR+      +Y  +L+             +  + P  LA+D  N Y++      G   I R  +DGT   T++         GL +D   Q+LY+ D +   MI      G K I+A        L+ + ++IYWT+    SI        +   V + +      + V   SR    D  + C   + +C  LC     +     C C++   +  N   CS  S  +++  +S +    L   +    + +   ++   + ++  D     IYW++   N
Sbjct:  323 RTDLRRISLDLPDFTDIVLQVSDIRHAIAIDYDPVEGYVYWTDDEVKAIRR----ARLDGTEAQTLITTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTS--------RRVLISERLSEPRAIVLDPIHGYMYWTDWGEKPKIERANLDGSERVVLVNSSLGWPNGLALDYATGKLYWG--DAKTDKIEVINMDGSNRMV--LLEDKLPHIFGFTLLGDYIYWSDWQRRSIERVHTSKAVREVIVEQLPDLMGL----KATKVTETFGTNGCADSNGGCSHLCF-FGPRGVSCACPMGL-ELLSDLHTCVVPEAFLLFTNRAEIRRISLGTNSNNVAIPLTGVREASALDF----DMAENRIFWTDVSTKTISMAFMNGSGVETVIEFGLDYP------EGMAVDWMGRNIYWADTGTNRIEVARLDG----QYRQVLVC------------KDLENPRSLALDPANGYMYWAEWG-GRPRIARAHMDGTNIVTLVDKVGR--ANGLTIDYADQRLYWTD-LDTCMIESTNMQGEKEIVADDLPHPFGLTQYRDYIYWTDWTLRSIERADKRSGLNRTVVQGQVEYVMDILVFHSSRQ---DGSNECSHNNGQCAHLCL---ASPSGAQCRCASHYTLDPNGRNCSSPSSFLLFSQRSSISRMVLGEQSPDMILPIHVLKN---LRAISFDPLERLIYWVDGRQN 971          

HSP 3 Score: 72.7886 bits (177), Expect = 3.769e-12
Identity = 80/343 (23.32%), Postives = 127/343 (37.03%), Query Frame = 3
Query: 3690 DGNRRSVLVKNPGI------PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVD---SLLSNGVGFSTSS----------------------------MVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ 4601
            D   ++  V +PG       P  L++D  S  +YW    TN +        N Q   G  +G  ++  +D   ++L NG   S ++                            + VL  +L+W D  QQ+   +   +  K +   G     +QYL     T +  +  + PE+F S         HPCSR     +N  CSH+C++                 + DG  RCSCP+ + +              +   C   Q  C  G +           C+ +  RCD   +C D SDE+ C  C+    + C +   C+    RC+G  DC   SDE+
Sbjct:  977 DDGSQAATVVSPGPTQQTKQPYDLSLDPFSRTVYWTCETTNTI--------NIQRMDGQTVGEVLRDDLDKPRAILVNGEKGSKNTSHTLIFFLCKTGANRIVLQDSNILQPIGLTVLGDHLYWIDKQQQMIERVDKRTGDKRTRIQG----RIQYL-----TGIHAVEYMEPEEFAS---------HPCSR-----DNGGCSHICIA-----------------KGDGTPRCSCPMHLVLLQN------LLSCGEPPTCSSEQFTCATGEI----------DCIPMAWRCDGIAECADKSDEMNCPMCSDLQ-FQCDKHQ-CVDAQLRCNGEPDCADSSDEK 1253          

HSP 4 Score: 69.707 bits (169), Expect = 4.057e-11
Identity = 63/260 (24.23%), Postives = 113/260 (43.46%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCL 4199
             +A+D ++  L W+D  T  I   RLN    R     V+I+ R S   P  I + PI   + W   D+ +             IE ++LDG+ R VLV +  G P+ L +D  +G++YW D KT+K+  +++             G N  V ++  L +  GF+     +L  Y++W+DW ++    +  +  ++            + + ++L  ++ + A    E F ++          C+ +     N  CSHLC 
Sbjct:  394 GIAVDWVARNLYWTDTGTDRIEVTRLNGTSRR-----VLISERLS--EPRAIVLDPIHGYMYW--TDWGEKPK----------IERANLDGSERVVLVNSSLGWPNGLALDYATGKLYWGDAKTDKIEVINMD------------GSNRMVLLEDKLPHIFGFT-----LLGDYIYWSDWQRRSIERVHTSKAVR------------EVIVEQLPDLMGLKATKVTETFGTNG---------CADS-----NGGCSHLCF 591          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Cavefish
Match: lrp6 (LDL receptor related protein 6 [Source:NCBI gene;Acc:103025328])

HSP 1 Score: 172.94 bits (437), Expect = 1.278e-42
Identity = 186/789 (23.57%), Postives = 339/789 (42.97%), Query Frame = 3
Query:  291 VQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPC--MNRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            + S + +A DW+   LYW D +   IEV + +           R++L    +    ++ +DP   Y++W   G I  +ER+ +DG++R +I  + ++  + L +D  ++ L+W   D +   IHR +  G TG  + V+G+     P  LT  E  L + +     + S    TG       +   +P  I + S+K Q +       +PC   N  CS +C L  V   Y+C+C TG+    +N  C    T+ L +     +  +SLD      + L +E+        YD V   + + D    +I    L+  G+  +F +   ++   P  IAVD  +RN+YW +     + V R++   R     +L+S            +    P  + +D ++ Y++ T   +    IER  LDGT +  V+ +T+  WP GLALD   +++Y+ D     +  +N +G ++RIL + K       +   ++IYWT+ +  SI  V K       +V +  +L    M + A   + +  T +PC   +  C  LC          +C C     ++ ++S C      +++   + +    L  N +   I L   +   + ++L  D   N+IYW +     I +   N      +  F L  D    +AVD++  NLY + T +  +RI + +L   H  V     + S +       A+++     F++W E   + +     + +A +DG+  + +   V   + L +D     + W   D+  I
Sbjct:   96 LASPDGLACDWLGNKLYWTDSETNRIEVSEFD--------GSYRKVLFWEGLDQPRAIALDPCRGYMYWTDWGEIPKIERAGMDGTNRAIIIDTDIYWPNGLTLDYSQQKLYW--ADAKFNFIHRSNLDG-TGREVVVKGSLPH--PFALTLYEDTLFWTDWNTHSIHSCNKHTGEERREIHSNIFSPMDIHVFSQKRQPI----DVSTPCSPKNGGCSHLCLLSPVKPFYQCACPTGVELLEDNKTCRIGATQLLLLARRTDLRRISLDTPDFTDIVLHAEDIRHAIAIDYDPVDGHIYWTDDEVQAIRRSHLD--GSDAQFIVTTQVNH--PDGIAVDWIARNLYWTDTGTDRIEVTRLNGTMR----KILIS------------EDLDEPRAIVLDPVSGYMYWTDWGEFP-KIERAALDGTDR-EVMVNTSLGWPNGLALDYAERKIYWGDAKTDKIEVMNMNGTNRRILVEDKLPHIFGFTLLGDYIYWTDWQLRSIERVHKHTAEREVIVDQLPDL----MGLKATYVHQTFGT-NPCAENNGGCSHLCL---YKPQGVACACPIGLELISDMSTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPLTGVK---EASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGL--DYPEGMAVDWLGKNLYWADTGT--NRIEVAKLDGQHRQVLVWKDLDSPR-------ALALDPAEGFMYWTEWGGRPK-----IDRAAMDGTGRITLVPNVGRANGLTIDYAERRLYWTDLDTTLI 818          

HSP 2 Score: 148.673 bits (374), Expect = 3.292e-35
Identity = 189/819 (23.08%), Postives = 343/819 (41.88%), Query Frame = 3
Query:  246 SKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLM------VPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLD-ARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISR--CSYSSEMIVYFNKS----MLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTIS----NLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            S LD    + ++   V   + +AVDW++ NLYW D     IEV  LN           R+IL+S ++ +  ++V+DP   Y++W   G    +ER+ LDG+DR V+  + L   + LA+D   + ++W   D +  +++     G + R+    K   P    FT  G  ++  D QL           SI            I+ +   LM      V +    +PC   N  CS +CL        C+C  G+ E I++      P   L       I  +SL+     +  PL  + E + + F    D   + + + D    +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + VA++   +R      +L W+               P  LA+D    +++ T    G   I+R  +DGT + T++ +       GL +D   ++LY+ D     + S N  G  + ++A        L+ + ++IYWT+    SI    K  G  R+L+    +LD    + V   SR    +    C ST+  C  LC  +  +  S+ CGC   AH  LN     CS  +  +++  K+    M++    +P+       +    S   V ++  D    Q+YWI+   N I +   N +    +    +    +     +L++D     +Y   TS   + I + R       ++ T V V  + ++    A+ V+ +  ++++    T  ++   ++ +A LDG++  +L + G++    L +D +   + W   D  +I
Sbjct:  390 SHLDGSDAQFIVTTQVNHPDGIAVDWIARNLYWTDTGTDRIEVTRLN--------GTMRKILISEDLDEPRAIVLDPVSGYMYWTDWGEFPKIERAALDGTDREVMVNTSLGWPNGLALDYAERKIYWG--DAKTDKIEVMNMNGTNRRILVEDKL--PHIFGFTLLGDYIYWTDWQL----------RSIERVHKHTAEREVIVDQLPDLMGLKATYVHQTFGTNPCAENNGGCSHLCL-YKPQGVACACPIGL-ELISDMSTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPLTGVKEASALDF----DVTDNRIYWTDITLKTISRAFMN--GSALEHVVEFGL--DYPEGMAVDWLGKNLYWADTGTNRIEVAKLDGQHRQ-----VLVWK-----------DLDSPRALALDPAEGFMYWTEWG-GRPKIDRAAMDGTGRITLVPNVGR--ANGLTIDYAERRLYWTDLDTTLIESSNMLGLEREVIADDLPHPFGLTQYQDYIYWTDWSQRSIERANKTSGQNRTLIQG--HLDYVMDILVFHSSRQGGWNA---CASTNGHCSHLCLAVPVS--SYVCGCP--AHYSLNNDNKTCSAPTSFLLFSQKTAINRMVMDEQQSPDI------ILPIHSLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQENGNQSMTVVSNSVGGHNLGLQPFDLSIDIYSRFIYW--TSEVTNVINVTR-------INGTRVGVVLRGEHDKPRAIVVNPERGYMYF----TNLQERSPKIERAALDGTEREVLFFTGLSKPVSLAIDNELGKLFWVDMDLRRI 1129          

HSP 3 Score: 117.472 bits (293), Expect = 1.079e-25
Identity = 156/642 (24.30%), Postives = 245/642 (38.16%), Query Frame = 3
Query: 2985 CSQFCL--PVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVD-----RTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLV-KNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARI-APEDFKSSSLGTLLQ--NHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDE-QC---CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSVALSACSFAIIYIC 4859
            CS  CL  PV S  CGC + YSL+ D  TC   +  L+    T     I   +++E+                              S +I+L + +   + A+D     +   ++  K+      QE+  ++ T  S ++  H        + L+ID  S  + W+  VT +I   R+N  +     +GV++  R    +P  I + P    + + +      +           IE + LDG  R VL       P  L +D   G+++W+D             D  +I +  + G N  V  DS +   VG     + V   +L+W D  QQ+   I                      K   +   +I ARI A  D  +     + +   HPC+      +N  CSH+C+                  + DG   CSCPV + V  +     G     +   C   Q PC +G V           C+    RCD   +C D SDE GC  C+    + C  S  C+ I+ RC+G ++C   SDE +C   C   +F C SG+    C+    +C+  +DC D SDE GC          T +P+     P N T+  I G V       A+ ++C
Sbjct:  903 CSHLCLAVPVSSYVCGCPAHYSLNNDNKTCSAPTSFLLFSQKTA----INRMVMDEQQ-----------------------------SPDIILPIHSLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQENGNQSMTVVSNSVGGHNLG--LQPFDLSIDIYSRFIYWTSEVTNVINVTRINGTR-----VGVVL--RGEHDKPRAIVVNPERGYMYFTNLQERSPK-----------IERAALDGTEREVLFFTGLSKPVSLAIDNELGKLFWVDM------------DLRRIESSDLSGANRIVIEDSNILQPVG-----LTVFGDHLYWIDRQQQMIERID---------------------KTTREGRTKIQARISALTDIHAVHEIDMEEYNKHPCTS-----DNGGCSHICIV-----------------KGDGTTSCSCPVHL-VLLQDELSCG-----EPPTCSPVQFPCASGEVV----------CIPQAWRCDGFAECDDESDERGCPVCS-EEEFQCD-SKQCVDISLRCNGDINCQDRSDENKCEGHCPPDQFACNSGQ----CIGKHKKCDHNMDCTDNSDEIGC--------YPTDEPSP---QPTN-TIGSIVGVVMTLFVVGAVYFVC 1397          

HSP 4 Score: 109.768 bits (273), Expect = 2.269e-23
Identity = 210/1034 (20.31%), Postives = 365/1034 (35.30%), Query Frame = 3
Query: 1266 PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHG-GSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCF--PIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNK---ILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCL-PVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFW--------IEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSR 4316
            P  +A D     +YW +   + + V+      R      +L W+            +QP   +A+D    Y++ T   +    IER  +DGT +  +I  T+ +WP GL LD  +Q+LY+ D     +   N  G G + ++        +L+ +++ ++WT+  T SIHS  K  G  R  +    N+ +     +   +   ID  +PC   +  C  LC   P++     + C C     +L +   C   +  ++   +   +        D   I L   E      ++  D     IYW +     I +  S+ D      I     +    +AVD+I  NLY + T +   RI + RL  T        +++S  +      +L  VS      +++W      D     ++ +A LDG+ + +++   +   + L +D     + W  + + KI   E++N   +                        N R L       I+  TL       T  QL  I  V      R    V +   +   K        GT           +N   CS  CL   +   C C     L +D +TC+     L+   +T     IR   L   ++ +  +    + E          + +YW   +I L+  +  F++                 S  EH ++    Y E               +A+D +   L W+D  T  I   +L+    ++                           L+W   D  ++   D +    +W        I+ + +DG  R  LV N G  + LT+D    R+YW D  T              I + +++G   +V  D L           +   + Y++WTDW Q+     S+    K S        N   ++  L  V+ I+       F SS  G     + C+       N  CSHLCL+ +P+S                 + C CP   S+ + ++
Sbjct:   99 PDGLACDWLGNKLYWTDSETNRIEVSEFDGSYRK-----VLFWE----------GLDQPRA-IALDPCRGYMYWTDWGE-IPKIERAGMDGTNRAIIID-TDIYWPNGLTLDYSQQKLYWADAKFNFIHRSNLDGTGREVVVKGSLPHPFALTLYEDTLFWTDWNTHSIHSCNKHTGEERREIHS--NIFSPMDIHVFSQKRQPIDVSTPCSPKNGGCSHLCLLSPVK---PFYQCACPTGVELLEDNKTCRIGATQLLLLARRTDLRRISLDTPDFTDIVL-HAEDIRHAIAIDYDPVDGHIYWTDDEVQAIRR--SHLDGSDAQFIVTTQVNHPDGIAVDWIARNLYWTDTGT--DRIEVTRLNGTMR-----KILISEDLDEPRAIVLDPVS-----GYMYW-----TDWGEFPKIERAALDGTDREVMVNTSLGWPNGLALDYAERKIYWGDAKTDKI---EVMNMNGT------------------------NRRILVEDKLPHIFGFTLLGDYIYWTDWQLRSIERVHKHTAEREV-IVDQLPDLMGLKATYVHQTFGTNPCA-------ENNGGCSHLCLYKPQGVACACPIGLELISDMSTCIVPEAFLLFSRHTD----IRRISLETNNNNV-AIPLTGVKEASALDFDVTDNRIYW--TDITLKTISRAFMNG----------------SALEHVVEFGLDYPE--------------GMAVDWLGKNLYWADTGTNRIEVAKLDGQHRQV---------------------------LVWKDLDSPRALALDPAEGFMYWTEWGGRPKIDRAAMDGTGRITLVPNVGRANGLTIDYAERRLYWTDLDTT------------LIESSNMLGLEREVIADDLP------HPFGLTQYQDYIYWTDWSQR-----SIERANKTSGQ------NRTLIQGHLDYVMDILV------FHSSRQGGW---NACAST-----NGHCSHLCLA-VPVS----------------SYVCGCPAHYSLNNDNK 930          

HSP 5 Score: 108.997 bits (271), Expect = 4.532e-23
Identity = 136/603 (22.55%), Postives = 251/603 (41.63%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTN--PNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSD----IPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQK----FTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGS----PCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLL 1991
            LKT + + ++   +  V++F +   E +AVDW+  NLYWAD     IEV  L+         + R++L+ +++    +L +DP E +++W + G    ++R+ +DG+ R  +  ++  +++ L ID   + L+W  LD  +  ++     G    V        P  LT  +  + + +  Q  +      +G +  L       +  I +     Q     G       N  CS +CL +  S+Y C C    +   +N  C + PT  L       I  M +D    P + L   +        YD +   L ++D   + I     N  G      +   +        P  +++D  SR IYW +   + + V RI   N  +   +L            R + ++P   + V+    Y++ T + + +  IER  LDGT++    FT +S      P  LA+D    +L++VD     + S +  G ++ ++      + + L+ F + +YW + +   I   + D + R   TK   + AR   +  +     ID       PC S +  C  +C  ++G+  + SC C    H++L
Sbjct:  686 LKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVAKLD--------GQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGRPKIDRAAMDGTGRITLVPNV-GRANGLTIDYAERRLYWTDLDTTL--IESSNMLGLEREVIAD-DLPHPFGLTQYQDYIYWTDWSQRSIERANKTSGQNRTLIQGHLDYVMDILVFHSSRQ----GGWNACASTNGHCSHLCLAVPVSSYVCGCPAHYSLNNDNKTC-SAPTSFLLFSQKTAINRMVMDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQEN--GNQSMTVVSNSVGGHNLGLQPFDLSIDIYSRFIYWTSEVTNVINVTRI---NGTRVGVVL------------RGEHDKPRA-IVVNPERGYMYFTNLQERSPKIERAALDGTEREVLFFTGLSK-----PVSLAIDNELGKLFWVDMDLRRIESSDLSGANRIVIEDSNILQPVGLTVFGDHLYWIDRQQQMIE--RIDKTTREGRTK---IQARISALTDIHAVHEIDMEEYNKHPCTSDNGGCSHICI-VKGDG-TTSCSCP--VHLVL 1239          

HSP 6 Score: 73.559 bits (179), Expect = 2.598e-12
Identity = 150/722 (20.78%), Postives = 268/722 (37.12%), Query Frame = 3
Query: 2100 GKGESDVQVASLQ------LDHYRNQIYWIN---QAANCIMKTASN-TDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLY---LFMAD-SIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCL--PVES-RECGCGSVYSLSADGATC-VDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDA-VYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQF-WIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCL 4199
            G+G + V V+ L+       D+ +  +YW +   +A  C +  AS  + IQ  +     S D    LA D++ N LY       W+     R+  +  D S+  V+    +      A+++     +++W      D   + ++ +A +DG+ + ++I   +   + L +D     + W  +    I+R  +                       +    +P + +LY   LF  D + + +   +  +   R+++   SN+     I  FS   + I +ST                 C   N      CS  CL  PV+   +C C +   L  D  TC +  + LL++   T     +R  I  +  D  D V   E     I      +D  +YW    +           A+ R+        +   S  +  + T  ++ +               +A+D I+  L W+D  T  I   RLN    +I          E    P  I + P+S  + W               W +F  IE + LDG  R V+V    G P+ L +D    +IYW D KT+K+  ++++            G N ++ V+  L +  GF+     +L  Y++WTDW             ++    +  H    + + D+L  ++ + A    + F +         +PC+       N  CSHLCL
Sbjct:   39 GRGNATVVVSGLEDAAAVDFDYTQGLVYWSDVSEEAIKCTVLNASGPSGIQTTVVSGLASPD---GLACDWLGNKLY-------WTDSETNRIEVSEFDGSYRKVLFWEGLDQP--RAIALDPCRGYMYW-----TDWGEIPKIERAGMDGTNRAIIIDTDIYWPNGLTLDYSQQKLYWADAKFNFIHRSNL--------------DGTGREVVVKGSLPHPFALTLYEDTLFWTDWNTHSIHSCNKHTGEERREIH--SNIFSPMDIHVFSQKRQPIDVSTP----------------CSPKNGG----CSHLCLLSPVKPFYQCACPTGVELLEDNKTCRIGATQLLLLARRTD----LR-RISLDTPDFTDIVLHAEDIRHAIAIDYDPVDGHIYWTDDEV----------QAIRRS--------HLDGSDAQFIVTTQVNHPD--------------GIAVDWIARNLYWTDTGTDRIEVTRLNGTMRKIL-------ISEDLDEPRAIVLDPVSGYMYWTD-------------WGEFPKIERAALDGTDREVMVNTSLGWPNGLALDYAERKIYWGDAKTDKIEVMNMN------------GTNRRILVEDKLPHIFGFT-----LLGDYIYWTDW------------QLRSIERVHKHTAEREVIVDQLPDLMGLKATYVHQTFGT---------NPCAE-----NNGGCSHLCL 607          

HSP 7 Score: 54.6842 bits (130), Expect = 1.534e-6
Identity = 50/192 (26.04%), Postives = 83/192 (43.23%), Query Frame = 3
Query:  459 SLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPT 1025
            ++VV+P   Y+++  +      +ER+ LDG++R V+  + L K   LAID     LFW  +D ++ R++    +G +  V        P  LT     L +I+ +Q  +   +  T      K    I+ +  I   H++ +     K PC   N  CS IC+   D    CSC   +    +   C   PT
Sbjct: 1064 AIVVNPERGYMYFTNLQERSPKIERAALDGTEREVLFFTGLSKPVSLAIDNELGKLFW--VDMDLRRIESSDLSGANRIVIEDSNILQPVGLTVFGDHLYWIDRQQQMIERID-KTTREGRTKIQARISALTDIHAVHEIDMEE-YNKHPCTSDNGGCSHICIVKGDGTTSCSCPVHLVLLQDELSCGEPPT 1251          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Cavefish
Match: lrp1bb (LDL receptor related protein 1B [Source:NCBI gene;Acc:103026098])

HSP 1 Score: 142.51 bits (358), Expect = 4.091e-33
Identity = 337/1604 (21.01%), Postives = 593/1604 (36.97%), Query Frame = 3
Query:   72 FLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKL--YVFVIQEN--GKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKS--SQLAIDRHRKMLFWWGLDGE-IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKS--PCMNR----VCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIP-----FRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIP--VSIAVDSASRNIYWMNHRNSE--VWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRI---LAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVI----AVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVES--RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQ--IFASISVNSDIK------PSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVG--CNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNN 4733
             +++  H + +  LH+   ++        +A D   +R L  +  V+++      L  T   + ++      V++  + + E +AVDW+ GNLYW D     IEV  LN +         R  L++  M    +L +DP E  LFW    A    +E + + GS RRV+ K +   +  + L +D   + + W     + I    Y G +G    ++G      P  ++   G + + +     ++     TG ++ +    +  P  +     Q+  P  + +S  PC        CS +CL   +    CSC   +    +N  C       L++    +I  + +D    P + +++    +P         YD++   + + D  + +I    +N  GT     L+  IS DI     +A+D  SRN+YW++  N E  + VAR+                   + K S       P  LAV      ++    TDG  +I    +DG+ +  +    N   P GL++D    +LY++ +  G +   N  G    +   + +   +  +L+     ++W + +   + ++        +V + +      M V        RNA       C   +  C QLC P   ++++ SC C+   ++  +   C   S  ++Y     +    L P    + +    G   +    +      + +YW +   N I +   +   +  +    +S   +  +AVD+I  NLY   T    + I I RL     +  + +VV+S  +      A++VH    +LFW E           + +A LDGS Q  L+  G+A  + + +D + N + W  + + KI R  +   +  E  +       + S +    +IY + R+       SI +   SD++ ++T +        G    ++     ++     T     A+S+ G                 C Q C  + S  R C C   Y L+ DG  C      L+    T     I  +I     DE D    ++  E P     +F        KN++    +Y   S+ D  R +     Y  + +    I  D S  + +  +  S E   Y  A     DT+ W+   T  I+   ++  + R      ++   E    P  +A+    + + W + +  +             I  S L GN   V++      P+ LT+D  + ++Y+ D    K            I      G N  V V S L    G     + +   Y+FW+DW ++  + A+     D K      P   MG+    +   KD                            + C  +   + N  C  LCL T                  DG   CSC     +   +R     CV          +  CG G             C+  Q  CD    C D SDE    C+  +    Y    +  C+   + CDG+ DC  +SDE      C + +  C  G     C+PIS+ CN ++DC D SDE  C+  +
Sbjct: 1240 IIFSIRHEIRRIDLHKRDYNLLVPGLRNTIALDFHFNRSLLYWTDVVEDKIYRGRLSDTGGVTGIEV-----VVQHGLATPEGLAVDWIGGNLYWIDSNLDQIEVAKLNGE--------MRTTLIAGGMEHPRALALDPGEGILFWTDWDASFPRIEAASMSGSGRRVVFKDMEIGAWPNGLTLDHLERRIIWTDARSDAIFSALYDG-SGVIEILRGHEYLSHPFAVSLFGGSVYWTDWRTNTLARANKWTGRNVTVIQKTSAQPFGL-----QIYHPSRQPQSSNPCEGNGGRGPCSHLCLIDYNRTASCSCPHLMKISPSNRSCVALKRFLLYV-RRSEIRGVDID---NPYMNIMTA-LTVPDIDDVTVVDYDALEERIYWADVKTQTIKRAFIN--GTS----LETVISGDIQNCRGLALDWLSRNMYWLSSENEETQINVARLDG-----------------SLKTSVIHGIDKPKCLAVHPAKGKIY---WTDGN-TINAANMDGSNRKVL--HQNQREPVGLSIDFPASKLYWISSANGTINRCNLDGSGFEVIETMKRDLTKATALAVMGGKLWWADDDLAQLGTIAKRDGRNPMVLRNKTSGVVHMKVYDRDGQKGRNA-------CQLNNGGCSQLCLPT--SENTRSCSCTVGYNLRTDRLSCEGLSSFLMYSIHEGVRGISLDPTDHTETLMPISGT--LFAVGVDFHAGNDTVYWTDMGLNRISRAKRDQTWREHIITTGISR--VEGIAVDWIAGNLY--WTDHGLNLIEIARL-----NGMYRSVVISEDLDQPR--AIAVHPQRGYLFWTEWGKS-----PCIGRARLDGSDQVTLVSSGIAWPNGISIDYEENRLYWCDARTDKIERINLETGESREI-VLSAANVDLFSVAVFGAYIYWSDRA---HANGSIRRGLKSDATEAVTMRS-------GLGVNLKDVKVFNKGREKGTN--PCARSNGG-----------------CQQLCFHLGSGRRTCSCAHGY-LAEDGFACQRYEGYLLYSERT-----ILKSI--HLSDESDLNSPLQPFENP-----EFF-------KNVIALAFHYQQHSS-DHNRIFFSDIHYGNIQM----INDDWSGRQIIVDNVGSVEGLAYHRAW----DTIYWTSSTTSSISRHTVDQSRHRAFNRQAVVTMSED-DHPHVLALDECQNLMFWTNWNEQRPS-----------IMRSTLAGNNIKVVISTDVFTPNGLTIDHKAEKLYFSDGSLGK------------IERCEYDGSNRHVIVRSGLGTFFG-----LAIHGNYVFWSDWARRAVLRANKFTGGDTKVLRADIPHQPMGI----IAVAKD---------------------------TNNCELSLCRVLNGGCGDLCLLT-----------------PDGTVNCSCRGERVLLDDNR-----CVSENSSCSVHTEFECGNG------------ECIDYQLTCDGIAHCKDKSDEKMQYCDNRSCRKGYRPCYNRRCVANHRFCDGIDDCGDNSDESYCNVTCAASESSCQDGT----CIPISSWCNQVIDCADASDEKNCSNTD 2606          

HSP 2 Score: 107.842 bits (268), Expect = 1.324e-22
Identity = 143/624 (22.92%), Postives = 258/624 (41.35%), Query Frame = 3
Query:  225 LLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWG--LDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRK----HQLMVPRGRRKSPCMNRV-----CSSICLPIVDSAYR---CSCSTGITEPINNAVCPTFPTRSLFI----GNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVT-----VITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEF---ISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSS 2018
            + K ++FSK   R+++ V    + + E +A+DW++GN+Y+ ++ +  I V   + D+           ++  ++ +   + VDP    LF+   G +  LER  +DG++R  +    + + + +A+D  +K+++W    LD  I  VDY G+   ++ +QG+   +      F E  L     E L  ++ +    I+    T+P +      SR     H+L  P+ +  +  +N       C+ +CL  +  +Y+   C C  G +   +   C   P   LF+    G P  I  + ++        L  E+   P    Y + +    Y+ F  ++ F +   K     R  +      D    I+VD    N+YW N         +  S  RL+ A      +   T  E        P  + VD +N +++ T      + D    IE+ W+DG+ +   ++S N  WP GL LD     +Y+ D    D I   Y  G+ R++    +E      +S++ N I+WTE    SI  +       +L+   R      +  + V    S    + C      C  LC  + G +    C C++  H+  N   CS S+
Sbjct:  242 MRKPSSFSK--EREIKTVQN--LHNVEQMAIDWLTGNVYFVERASGRIFVCSRSGDT--------CVSVIDLDLLNPKGIAVDPLMGMLFFTDYGNLAKLERCNMDGTNRTRLVDYKIEQPTAVALDLVKKLVYWADAYLD-YIEAVDYNGKNRHTI-IQGSQVAYLHGLAVF-EDYLYATRSESLGEAAVDV-LRINRFNVTDPELLTSVGNSRAVRVYHKLTQPKVKGHACEVNPYGKAGGCAHLCL--LSGSYKSRSCRCRAGFSLGSDGQTCKK-PKNELFLFYGKGRPGVIRGLDINVKSSNEHMLPVEDLVNPRALDYHAESG---YIYFADTTSFLIGRQKTDGSSRETI-LKDDLDNVEGISVDWIGNNLYWTNDG-----YRKTISVARLEKAA-----ETRRTLLEGDMSH---PRAIVVDPLNSWMYWTDWEEDEVNDSIGRIEKAWMDGSNRKIFVTS-NMLWPNGLTLDHGTSTMYWCDAYY-DHIERIYLNGTGRMVVYNGKELNHPFGISHYRNSIFWTEYMNASIFQLDLLSGEVTLLRSER----PPLFGLRVFDAQSQQGDNACRVNYGGCGTLCLAVPGGR---VCACADNQHLDRNNVTCSGSA 820          

HSP 3 Score: 80.8777 bits (198), Expect = 1.978e-14
Identity = 143/641 (22.31%), Postives = 230/641 (35.88%), Query Frame = 3
Query: 2985 CSQFCLPVE-SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFI--------------DAVYWLSK---NIVLRLD---NYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSD--------LDGNRRSVLV-KNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLV-----------KCDRYQIPCGAG-------LVFSKKEG---MSVMSCMSVQQRCDSTVDCLDGSDEVGCNT--CNISHLYSCSRSDVCLPITKRCDGVMDC-------DSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNR 4727
            C+Q C  +    +C C   + L  DG +CVD+ +    +  +   I   G+      D  +  +    S + ++A + F+               + Y L K   N ++ LD      FI  VD +RP    ++  ++ +   D+K               +     +LA+D I   L W D     I  + L   K    Y  V+++     + P  +A+                    D+ + + FWI+  +        +DG  ++V+V K    PS LT+D  + RIYW D         HI + N      H + H+    V              + + + +++WTD       S S+    K S A  +   N       +K++        PE          +  H C     ++ N  CSHLCL +                   G  +C+CP +  +   ++  +  C  SQ             KCD     CG G         F  + G        C      CD   DC D SDE  C+T  C +   + C+R   C+PI +RC+G  +C       D  E  C   +F+C   K    C+     C+   DC DGSDE  C+ 
Sbjct: 2915 CTQDCQDLRVGYKCKCWPGFRLKNDGKSCVDIDECSSSLPCSQTCINTYGSYKCLCVDGYEASKHDPNSCRSLSAEEPFLILADHHEIRKLSVDGSNYTLLKQGLNNIISLDFDYRKEFIYWVDSSRPSG--RRINRIRLNGSDLKV------------VHRTAVPSALAVDWIGKNLYWCD-----IERKTLEVSKSNGLYPTVLLS--SGLKNPTDLAL--------------------DAQLGYMFWIDCCENPHVGRVGMDGRGQTVIVDKEIYSPSALTIDYTNKRIYWADDS-------HILFANMDGSQRHKVPHDHIQGV------------MGLTLFEDFIYWTD-----GKSKSLRRAHKTSGAHAVELLNSW---QAIKSITVYHPLRQPE----------VPKHQC-----QVANGGCSHLCLLSP-----------------GGGHKCACPTNFYLAADNKTCLSNCTSSQFRCGTDECIPFWWKCDTVD-DCGDGSDEPADCPEFKCQPGRFQCGTGLCALPPFICDGENDCGDNSDETNCDTYIC-LPGQFKCTRKQKCIPINQRCNGQDECGDGEDETDCPESTCSPDQFQC---KSTMHCISKLWVCDEDPDCADGSDEANCDE 3450          

HSP 4 Score: 60.4622 bits (145), Expect = 2.931e-8
Identity = 73/300 (24.33%), Postives = 126/300 (42.00%), Query Frame = 3
Query:  174 FLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFW--------WGLDG-EIHRVDY---QGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLF 1037
            F  RK +++ + ++ +   +  N  +L+   ++ V +  V SA  +AVDW+  NLYW D + + +EV   N    +P       +LLS  + +   L +D    Y+FW+       + R  +DG  + VI    ++  S L ID   K ++W          +DG + H+V +   QG  G ++            F+ +T+GK      + L  +    G      L +   I  I +     Q  VP  + +    N  CS +CL      ++C+C T      +N  C +  T S F
Sbjct: 3027 FDYRKEFIYWV-DSSRPSGRRINRIRLNGSDLKVVHRTAVPSA--LAVDWIGKNLYWCDIERKTLEVSKSN--GLYP------TVLLSSGLKNPTDLALDAQLGYMFWIDCCENPHVGRVGMDGRGQTVIVDKEIYSPSALTIDYTNKRIYWADDSHILFANMDGSQRHKVPHDHIQGVMGLTL---------FEDFIYWTDGK-----SKSLRRAHKTSGAHAVELLNSWQAIKSITVYHPLRQPEVP--KHQCQVANGGCSHLCLLSPGGGHKCACPTNFYLAADNKTCLSNCTSSQF 3299          

HSP 5 Score: 59.3066 bits (142), Expect = 5.881e-8
Identity = 43/111 (38.74%), Postives = 56/111 (50.45%), Query Frame = 3
Query: 4416 SVMSCMSVQQRCDSTVDCLDGSDEVGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ-----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            S M C+S    CD   DC DGSDE  C+  TC   H + C +++ C+P   RCD   DC  +SDE+      C  + F C +G     C+    RC+G  DC D SDE  C
Sbjct: 3422 STMHCISKLWVCDEDPDCADGSDEANCDEKTCG-PHEFRC-KNNNCIPDHWRCDSQNDCGDNSDEENCRPVTCNHKDFACANGD----CISARFRCDGDYDCVDNSDEKDC 3526          

HSP 6 Score: 58.5362 bits (140), Expect = 9.098e-8
Identity = 93/417 (22.30%), Postives = 162/417 (38.85%), Query Frame = 3
Query:  810 SIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMN-RVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKI----YHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSY----FDNFIYWTEL--ETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEM 2024
            ++  +TN N+        +  L   +    + C+    CS  C     S Y+C+C     +   N +      R L+I N  +I    Y  +   G    L  + ENA I    A       +    FN   +F  ++ + G  +            P  +A D  + NIYW +H     +    + + +L+Y ++ +     P            P  +A++ +   ++ +VI D +  IE   +DG+ +  V+       P GLA+D + Q+LY+ D     + SV +  GS  +     ++ +S  Y    F++ IY T L  E   +H   K+   +  L T+      +   V+   R    +  +PC   +  CD +C     N    SC C      L+N S C   SE+
Sbjct: 3791 AVCNQTNANVICHCKAGFQRNLKTKQCEEMNECLYFGTCSHYCTNTKGS-YKCTCDKNYKDISGNCIAKGPEDRVLYIANDTEIRSFVYPFNQSHG-HKVLTRIEENARIIGMDALLHQQKFIWATQFNPGGLFYKEILEKGQTKTNVGIICPDFRRPRDVAADWVTGNIYWTDHSRMHWFSYYTAHWTKLRY-SINVGQLKGPNCTRLITDIAGEPYAIAINPVKGMMYWSVIGDHS-HIEESAMDGSMR-RVLLDKKLRRPTGLAIDYFGQRLYWADAELSVIGSVRFD-GSDPLEVISGRQGVSQPYRIDIFEDLIYGTGLKHEVFRVHKYGKYPVELLDLGTE------KATNVMISHRFKQQEVANPCLKIT--CDFMCLL---NPTGASCTCP-EGKTLVNGS-CIDPSEL 4188          

HSP 7 Score: 57.7658 bits (138), Expect = 1.765e-7
Identity = 51/234 (21.79%), Postives = 97/234 (41.45%), Query Frame = 3
Query: 1263 IPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSK-RILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSC 1961
            +P ++AVD   +N+YW +     + V++ +      Y T+LLS               + P DLA+D+   Y+F     +    + R  +DG  + TVI     + P  L +D   +++Y+ D     ++  N  G  + ++     Q  + L+ F++FIYWT+ ++ S+          ++         +++ V    R   +     C   +  C  LC    G  H  +C
Sbjct: 3065 VPSALAVDWIGKNLYWCDIERKTLEVSKSNGL----YPTVLLS------------SGLKNPTDLALDAQLGYMFWIDCCENP-HVGRVGMDGRGQ-TVIVDKEIYSPSALTIDYTNKRIYWADDSH--ILFANMDGSQRHKVPHDHIQGVMGLTLFEDFIYWTDGKSKSLRRAHKTSGAHAVELLNSWQAIKSITVYHPLRQPEVPK-HQCQVANGGCSHLCLLSPGGGHKCAC 3277          

HSP 8 Score: 55.8398 bits (133), Expect = 6.703e-7
Identity = 43/125 (34.40%), Postives = 61/125 (48.80%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCLDGSDEVGCNTCNISHL-YSCSRSDVCLPITKRCDGVMDC--DSDEQ-C---CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVIN 4778
            +C+    RCDS  DC D SDE  C     +H  ++C+  D C+    RCDG  DC  +SDE+ C   C   +F+C +      C+ +   C+G  DC+ G DE  C        L T+ P+  IN
Sbjct: 3464 NCIPDHWRCDSQNDCGDNSDEENCRPVTCNHKDFACANGD-CISARFRCDGDYDCVDNSDEKDCEARCAEDQFQCHN----NLCISVKWLCDGQEDCKTGEDERNC--------LGTVLPSCSIN 3575          

HSP 9 Score: 53.1434 bits (126), Expect = 4.735e-6
Identity = 39/108 (36.11%), Postives = 51/108 (47.22%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCLDGSDEVGCNT----CNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQKFECLS------GKDVTRCLPISARCNGIVDCRDGSDE 4712
            +C+  + RCD   DC DGSDE  C      C+    ++C  S  C+  +  CDG  DC+  SDE+ C   K    S        D + CLP    C+G  DC D SDE
Sbjct: 1043 TCIPERWRCDGDKDCEDGSDEGNCEGIKRMCDPQAKFTCKDSGKCISKSWVCDGDNDCEDRSDEESC---KLSVCSPPTQACANDTSVCLPPHKICDGRRDCADQSDE 1147          

HSP 10 Score: 51.9878 bits (123), Expect = 8.519e-6
Identity = 46/145 (31.72%), Postives = 63/145 (43.45%), Query Frame = 3
Query: 4332 CVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC----DSDEQCCGSQKFECLSG----KDVTRCLPISARCNGIVDCRDGSDE---HGCNRNN 4733
            C  S   +C+     C +G            +C+S    CD   DC DG+DE  C++  + + ++CS++  C+     CDG  DC    D  E  CGS    C  G         C+P    C+G  DC DGSDE    GC  NN
Sbjct: 2651 CQASHAHRCEEGHFACPSG------------NCISSVWLCDGQKDCEDGADEFQCDSSCLWNQFACSKNK-CIAKQWLCDGEDDCGDGVDEGEDLCGS--VTCGPGLFSCPGSYACVPKRWLCDGERDCPDGSDELAAAGCAPNN 2780          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Cavefish
Match: lrp1ba (low density lipoprotein receptor-related protein 1Ba [Source:ZFIN;Acc:ZDB-GENE-050208-608])

HSP 1 Score: 132.494 bits (332), Expect = 4.549e-30
Identity = 179/813 (22.02%), Postives = 324/813 (39.85%), Query Frame = 3
Query:  276 VLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKS--SQLAIDRHRKMLFWWGLDGE-IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFIND---EQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPR----GRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIP-----FRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWM--NHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRI---LAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWR-GVADIDELVVDEQANYVCWKSSDSGKIYRYEI 2642
            V++  + + E +AVDW++GNLYW D     IEV  L+         + R  L++  M    ++ +DP +  LFW    A+   +E + + GS R V+++ +   +  + L +D   K + W     + I+   Y G +G    ++G  +  S  F     G  VF  D     L  +S   G  +++  KT+     + I+    Q   P      R K P     CS +CL   + +  C+C   +    NN  C     R L      +I  + LD    P L +++    +P         YD+    + + D  + +I    +N  GT     L+  +S+D+     +AVD  SRN+YWM  +   +++ VAR+                   + K +       P  L +      +F    TDG  +I    +DG+   + I   N   P GL +D    +LY++ +  G +   N  G    +   L ++  +  +L+   + ++W +              + + V      D + M V+       +   + C   +  C QLC P   ++++  C C+    +  + S C      ++Y     +    L P  +     L      +  A L      + +YW +  +N I +   +   + +  +   S      LAVD+I  NLY       W+   +  +  +  + ++ +VV+S  +     GA++VH    FL W E     R     + +A LDGS+ M++   G++    + +D Q N + W  +   KI R  +
Sbjct: 1306 VVQHGLATPEGLAVDWIAGNLYWIDSNLDQIEVAKLD--------GKLRTTLIAGGMEHPRAIALDPGQGALFWTDWDAMFPRIEGASMSGSHRHVVYRDMEVGAWPNGLTLDHVEKRIVWTDARSDAIYSALYDG-SGLIEILRGH-EYLSHPFAVSVYGGSVFWTDWRTNTLTKASKWTGANVTVIQKTSAQPFDLEIVHPSRQPQTPNPCEANRGKGP-----CSHLCLLNYNGSAACACPYLMKLSTNNRTCQAV-KRFLLYARRSEIRGVDLD---NPYLNIITA-LTVPDIDDVTAMDYDATDERIYWADVKTRTIKRASIN--GT----RLETVMSADVLNVRGLAVDWLSRNLYWMSSDSEETQINVARLDG-----------------SLKSTLIHGIDKPRSLVLHPAKGKMF---WTDGN-TINVASMDGSN--SKILHQNQKEPVGLCIDHSSSKLYWISSGNGTINRCNLDGSGLEVIDSLKKELMKATALAVMGDKLWWAD-------------DVLAQVGTINKKDGKNMEVLRSKTTGVVQIRNVCMVNNGGCSQLCLPT--SENTRICSCTTGYSLRTDRSTCQGVGSFLLYSTHEGIRGIALEPGDNSD--ALTPMSRTLSAAGLDYHAGNDTLYWTDVVSNKIWRAGRDQTWREE--VVGSSVGHAEGLAVDWIAGNLY-------WTDHSLDLIEVSRLNGAFRDVVISEGLDKP--GAIAVHPLKGFLIWTEWGETPR-----ISRARLDGSEQMVLANSGISWPSGISIDYQENKLYWCDARMDKIERISL 2036          

HSP 2 Score: 127.487 bits (319), Expect = 1.204e-28
Identity = 144/634 (22.71%), Postives = 274/634 (43.22%), Query Frame = 3
Query:  231 KTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGL-DGEIHRVDYQGQTGCSMRVQGTWKQ--WSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGG-----LQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISS-DIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSI---HSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQY 2090
            +T   + ++  ++  V+   V +   +AVDW+S NLYW    ++  ++    +D          +  L   +    SLV+ P +  +FW     I V   + +DGS+ +++H++   +   L ID     L+W    +G I+R +  G     + V  + K+     T L     KL + +D    V +     G ++ +  +     + I   ++  MV  G          CS +CLP  ++   CSC+TG +   + + C    +  L+      I  ++L+ G     L P    LS  AG+ +    D    +L + D  S+ I+     + G  Q +  +   SS      +AVD  + N+YW +H    + V+R++      +  +++S            +    PG +AV  +  +L  T   + T  I R  LDG+++  V++++   WP G+++D    +LY+ D     +  ++   G++R  +L+    +  S++ F +++YW++    +     S K D S    V     L+ R + V    R    +   PC  ++  C+QLCF +  N+ S SC   +  ++  +  RC      ++Y  ++ L T HL+  T + Y
Sbjct: 1605 RTIKRASINGTRLETVMSADVLNVRGLAVDWLSRNLYWMSSDSEETQINVARLDGSL-------KSTLIHGIDKPRSLVLHPAKGKMFWTDGNTINV---ASMDGSNSKILHQN-QKEPVGLCIDHSSSKLYWISSGNGTINRCNLDGS---GLEVIDSLKKELMKATALAVMGDKLWWADDVLAQVGTINKKDGKNMEVLRSKTTGVVQI---RNVCMVNNGG---------CSQLCLPTSENTRICSCTTGYSLRTDRSTCQGVGSFLLY-STHEGIRGIALEPGDNSDALTPMSRTLSA-AGLDYHAGND----TLYWTDVVSNKIW-----RAGRDQTWREEVVGSSVGHAEGLAVDWIAGNLYWTDHSLDLIEVSRLNG----AFRDVVIS------------EGLDKPGAIAVHPLKGFLIWTEWGE-TPRISRARLDGSEQM-VLANSGISWPSGISIDYQENKLYWCDARMDKIERISLESGAEREIVLSAGGADMFSVAVFGSYLYWSDRNYANGSIRRSSKNDASNAVTVRSGLGLNLRDVKVFNRDREKGTN---PCGRSNGGCEQLCFYMGENRKSCSC---SHGYLAQDGLRCRPYEGYLLYSERTTLRTAHLSDQTTRNY 2177          

HSP 3 Score: 113.235 bits (282), Expect = 2.469e-24
Identity = 205/951 (21.56%), Postives = 363/951 (38.17%), Query Frame = 3
Query: 1161 LLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTN-DFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFIS----LSYFDNFIYWTELETLSI-HSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNK--CDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGES--DVQ-VASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPV--ESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFI---DAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQF-WIEMSDLDGNRRSVLVKNPGI--PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTD 3956
            L + D     I+   L+  G      +        P  +AVD  + N+YW++    ++ VA++      K  T L++               + P  +A+D     LF T        IE   + G+ +  V        WP GL LD   +++ + D  + D I    + GS  I   +  E++S    +S +   ++WT+  T ++  + K+ G+  +++ KT    A+   +  V  +    T +PC +   K  C  LC  +     S +C C     +  N   C      ++Y  +S +    L    D  Y+ +    +  D+  V ++  D    +IYW +     I + + N    R   +       +  LAVD++  NLY   + S  ++I + RL     D S  + ++    K + L    +H     +FW +  T        +  A +DGS   ++ +   +   L +D  ++ + W SS +G       +NR                           N     L + DS+ +  +  ++ ++   +L +  +V         + V        K + + +S   T  V+        N   CSQ CLP    +R C C + YSL  D +TC  +   L+  T+ G    IRG  L E  D  D +    +S     AG  +    D +YW        + N  + +  D+T              +E  + +   ++E               LA+D I+  L W+D    +I   RLN       +  V+I+  E   +P  IA+ P+   LIW             + W +   I  + LDG+ + VL  N GI  PS +++D    ++YW D + +K+  + +             G   ++    +LS G G    S+ V   YL+W+D
Sbjct: 1279 LYWTDVVEDQIYRGKLSDSGGVSGIEVVVQHGLATPEGLAVDWIAGNLYWIDSNLDQIEVAKLDG----KLRTTLIA------------GGMEHPRAIALDPGQGALFWTDWDAMFPRIEGASMSGSHRHVVYRDMEVGAWPNGLTLDHVEKRIVWTD-ARSDAIYSALYDGSGLIEILRGHEYLSHPFAVSVYGGSVFWTDWRTNTLTKASKWTGANVTVIQKT---SAQPFDLEIVHPSRQPQTPNPCEANRGKGPCSHLC--LLNYNGSAACACPYLMKLSTNNRTCQAVKRFLLYARRSEIRGVDL----DNPYLNIITALTVPDIDDVTAMDYDATDERIYWADVKTRTIKRASING--TRLETVMSADVLNVRGLAVDWLSRNLYWMSSDSEETQINVARL-----DGSLKSTLIHGIDKPRSL---VLHPAKGKMFWTDGNT--------INVASMDGSNSKILHQNQKEPVGLCIDHSSSKLYWISSGNG------TINR--------------------------CNLDGSGLEVIDSLKKELMKATALAVMGDKLWWADDV--------LAQVGTINKKDGKNMEVLRSK--TTGVVQIRNVCMVNNGGCSQLCLPTSENTRICSCTTGYSLRTDRSTCQGVGSFLLYSTHEG----IRGIAL-EPGDNSDAL--TPMSRTLSAAGLDYHAGNDTLYWTDV-----VSNKIWRAGRDQT-------------WREEVVGSSVGHAE--------------GLAVDWIAGNLYWTDHSLDLIEVSRLNG-----AFRDVVIS--EGLDKPGAIAVHPLKGFLIW-------------TEWGETPRISRARLDGSEQMVLA-NSGISWPSGISIDYQENKLYWCDARMDKIERISLE-----------SGAEREI----VLSAG-GADMFSVAVFGSYLYWSD 2067          

HSP 4 Score: 104.375 bits (259), Expect = 1.423e-21
Identity = 140/626 (22.36%), Postives = 241/626 (38.50%), Query Frame = 3
Query:  255 DRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSF------ECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPC--MNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLE---LLSENAGIPFRFAYDSVTSSLLYVDFNSSSIF------SLDLNKY--GTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKY--ATLLLSWQPSPTFKESRY--QQNQP----------------PGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKF-QEFISLSYFDNFIYWTELETLSI-HSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCF-PIRGNQHSFSCGCSNRAHVLLNISRC 2006
            D+    +V+   V  AE +AVDW++GNLYW D     IEV  LN           R +++S  +    ++ V P + +L W + G    + R+RLDGS++ V+  S +   S ++ID     L+W   D  + +++       + R        +  F     G  ++ +D      S       +    +++      N+  + + +R       R +  +PC   N  C  +C  + ++   CSCS G                           +++ DG    P E   L SE   +      D  T +     + + + F      + D  +   GT + FY D   +S   +         N  W  H   +V    + S   L Y      L W  S T    R+   Q++P                P  LA+D     +F T   +    I R  L G +   +I S     P GL +D   ++LYF D   G +   +Y G  + ++ +     F  L+ + +F++W++ E  S+  S K  G+  +++        + M + AV+ +      SPC   +  C  LC    RG   + +CGC     +LL+ +RC
Sbjct: 1907 DQTWREEVVGSSVGHAEGLAVDWIAGNLYWTDHSLDLIEVSRLN--------GAFRDVVISEGLDKPGAIAVHPLKGFLIWTEWGETPRISRARLDGSEQMVLANSGISWPSGISIDYQENKLYW--CDARMDKIERISLESGAEREIVLSAGGADMFSVAVFGSYLYWSDRNYANGSIRRSSKNDASNAVTVRSGLGLNLRDVKVFNRD------REKGTNPCGRSNGGCEQLCFYMGENRKSCSCSHG---------------------------YLAQDGLRCRPYEGYLLYSERTTLRTAHLSDQTTRNYPIRPYENPAYFKNIIALAFDYRQKTDGTNRIFYSDVHYASIQMI---------NDDWTGH---QVLAKGVGSVEGLAYHRGWDALYWTSSTTASIIRHSVDQSRPGAFHQDTVLRMAEDDHPHVLALDECQNLMFWTNWNERRPGILRATLSG-RNMRLIISERILTPNGLTIDHRAEKLYFSDGSLGSLERCDYDGSHRYVVVKAGPGTFFGLAVYGDFLFWSDWEQRSVMRSDKLTGADVTILRADST--QQPMGITAVANDTHSCELSPCTVNNGGCQDLCLITPRG---TVTCGCRGE-RILLDDNRC 2470          

HSP 5 Score: 103.219 bits (256), Expect = 2.717e-21
Identity = 166/700 (23.71%), Postives = 292/700 (41.71%), Query Frame = 3
Query:   69 VFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQEN-GKSLLKTANFSKLDRRKMRDVLKFP--VQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEI-HRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISI-ALKTN----PNIAPIAIISRK------HQLMVPRGRRKSPCMN-----RVCSSICLPIVDSAYR---CSCSTGITEPINNAVCPTFP-TRSLFIGN--PPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKY-GTPQRFYLDFPISSDIPVSIAVDSASRNIYWM--NHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPG-----DLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEF---ISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAV----------SRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMI 2027
            + L A+ ++LS S L+   V      D+       F+ R   +  +Q +     L  A  +K      +  ++ P  +Q+ E +AVDW++G+ Y+ D+ +  I       D+           ++  ++ +  ++ +DP    LF+   G++  LER  LDGS+RR I +S + + + L +D   K+++W  +  +I   VDY G+   ++ ++G         ++   G  +F  ++ L+ S  +   G  +  L+ N     +  P+  +         H+L  P  R  +  ++       CS +CL  + S+Y+   C C  G T   ++  C     T  LF G   P  +    L+   +   +L+++  G+    A D  ++S  Y+ F+ ++ F +   K  GT +   L   + +     I+VD    N+YW    HR + V VAR+      +  TLL      P         N P G     D   D +N         D    IE+ W+DG+ + T ISS    WP GL +D     LY+ D    D I   Y  G+ R +    +E      +S++ N I+WT+    SI  +        L  K   L   + P+  +          +   S+D G  C  T+     LC  + G +    C C++  H+L +   CS SS ++
Sbjct:  184 MLLIANQNLLSVSYLNGSSVTNMKAVDVNGTQTLDFIHRDETLCWLQTSRSAGQLWCAKLTKQKGISEKRQIRIPQDLQNVEHMAVDWLTGSFYFVDRVSDRIFACSERADA--------CVTVVELDIQNPRAITLDPVLGKLFFTDYGSVAKLERCGLDGSERRRIVESRMEQPTALTLDLISKLVYWADVYLDIIEVVDYDGKKRHTV-IRGN-------SVSHLYGLALF--EDYLFASCLDPSRGGKVDVLRINRFNSSDTHPVITLESSRTLRVYHKLTQPTVRTHACVLDVQGRSGGCSHLCL--LSSSYKSRVCRCRAGYTLASDSTDCKKMKDTPFLFYGKGRPGVVRGFGLES--KSANQLMTQIEGLVSPRALDFHSASG-YIYFSDTTSFLIGRQKVDGTGRETVLKDDLEN--VEGISVDWLGSNLYWTSDGHRKA-VSVARLDGAAESR-KTLLEGGMTHP----RAIAVNPPAGWMYWTDWEEDEVN---------DSRGRIEKAWMDGSHRQTFISSRV-LWPNGLTIDPSSSVLYWCDAYY-DHIEKIYLNGTHRTVIYDGKELNHPFGISHYQNSIFWTDYMNASIFQLDL------LSGKVALLRRESPPLFGLQVYDPQKQKGTNACSVDHGG-CGLTA-----LCLTVPGGR---VCACADGQHLLKDDLTCSASSVLL 826          

HSP 6 Score: 90.8929 bits (224), Expect = 1.756e-17
Identity = 142/620 (22.90%), Postives = 227/620 (36.61%), Query Frame = 3
Query: 2985 CSQFC--LPVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKF-IDAVYWLSKNIVLRLDNYGFISA-------------------VDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSD--------LDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDE-VGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQKFECLSGK----DVTRCLPISARCNGIVDCRDGSDEHGCNRN 4730
            CSQ C  +PV   +C C S + L ADG TCVD+ + +     + + +   G+    K   +D  +   L   P ++ + F I A +   + I L   NY  +                     +D +RP    ++  ++ +   D+K               +     +LA+D I   L W D       AER   +  +   L   +      R P  +A+                    D++    FWI+  +        +DG++  V+V      PS LT+D  + RIYW D                     H++  NM  +    + N      +S+ + + +L+W+D   +  +     +  K S  +     + Q ++D     +++   +   D         +  H C     ++ N  CSHLCL +                   G +RC+CP    + + +        K+ L  C   Q  CG               C+    +CD+  DC DGSDE   C            R+ +C      CDG  DC  +SDE  C S  + CLSG        RC+P + RCNG  DC DG DEH C  N
Sbjct: 2890 CSQDCQDMPV-GYKCTCWSGFRLKADGRTCVDVDECVESFPCSQQCVNTYGSY---KCLCVDGYQ--RLDTDPHSSDEPFLILADHHEIRKISLDGLNYTLLKQGLSNVLSLDFDYRKELIFWIDTSRPSG--RRINRMRLNGSDLKV------------VHRTSVPNALAVDWIGKNLYWCD-------AERKTVEVAKANGLYPTVLLSTGLRNPSALAL--------------------DTNTGFVFWIDCCEYPHIGRIGMDGSKAQVIVDTEIHTPSALTIDYVNQRIYWADQN-------------------HILFSNMDGSRRYRVPNEGMGGVTSLALFEDFLYWSDQKTKTLSRAHKTTGAKRSELLS----SWQTIRD-----IKVYHPLRQPD---------VPKHQC-----QVNNGGCSHLCLLSP-----------------GGGYRCACPTHFYLANDN--------KTCLSNCTASQFRCGTD------------ECIPFWWKCDTVDDCGDGSDEPADCPEFKCQPGRFQCRTGLCALPPFICDGENDCGDNSDEANCDS--YICLSGHFKCTQTHRCIPGNLRCNGQDDCGDGEDEHECPDN 3381          

HSP 7 Score: 62.3882 bits (150), Expect = 6.521e-9
Identity = 44/107 (41.12%), Postives = 57/107 (53.27%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ-----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C+S    CD   DC DGSDE  C+  TC   H + C R++ C+P   RCDG  DC  +SDE+      C  + F C +G+    C+    RC+G  DC D SDE GC
Sbjct: 3396 CISKLWVCDEDPDCADGSDEANCDEKTCG-PHEFRC-RNNNCIPEHWRCDGQSDCGDNSDEENCKPVTCSWKDFVCANGE----CISARFRCDGDFDCTDHSDERGC 3496          

HSP 8 Score: 62.3882 bits (150), Expect = 6.916e-9
Identity = 43/107 (40.19%), Postives = 53/107 (49.53%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCLDGSDEVGCN----TCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQ-----KFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            SC+  + RCD   DC DGSDEV C      C+    ++C  S  C+  +  CDG  DC+  SDE  C S      +F C    D + CLP    CNG  DC D SDE
Sbjct: 1042 SCIPERWRCDGDKDCEDGSDEVACEGVRRACDPKAKFTCKSSGKCISRSWVCDGDQDCEDHSDETGCVSSVCKPPRFSC--ANDSSTCLPPERICNGRRDCADHSDE 1146          

HSP 9 Score: 62.003 bits (149), Expect = 8.970e-9
Identity = 70/293 (23.89%), Postives = 120/293 (40.96%), Query Frame = 3
Query:  918 VCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPK----IYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTEL--ETLSIH 1772
            VCS  C      +Y+C+C     E     +      + L++ N  +    +Y  +   G    L  L +NA I    A   +   +    FN   IF  DL +  TP R      I SD   P  I+ D  +  +YW +H     +    + + RL+Y ++ +     P            P  + V+ +   ++ TVI D +  IE   +DG+ +  V+   N   P GLA+D Y ++LY+ D+    + SV   G   ++          +  F++++Y T+L  E   +H
Sbjct: 3793 VCSQYCAN-AKGSYKCTCDRNFKEIDGECITKGNDDQVLYVANDTEMHSFVYPFNQSHG-HTQLARLPDNARIVGMDALFHLHKFVWATQFNPGGIFYRDLGER-TPTRGS-SGTICSDFRRPRDISADWVTGALYWTDHSRMHWFSYYTAHWRRLRY-SINVGQLNGPNCTRLITDLQGEPFAITVNPVRGMMYWTVIGDNS-HIEEAAMDGSLR-RVLLEKNLRKPTGLAIDYYGERLYWSDSELSVIGSVRLDGSDAQLFP------FRIDVFEDYVYGTDLKHEVFRVH 4072          

HSP 10 Score: 59.6918 bits (143), Expect = 4.166e-8
Identity = 82/333 (24.62%), Postives = 135/333 (40.54%), Query Frame = 3
Query:   72 FLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWW--------GLDG-EIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGI--SIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLF 1037
             + A +H + K  L      +       +L+ D F  RK  +F I +  +   +  N  +L+   ++ V +  V +A  +AVDW+  NLYW D + + +EV   N    +P       +LLS  + +  +L +D    ++FW+       + R  +DGS  +VI  + +   S L ID   + ++W          +DG   +RV  +G  G              T L   E  L + + +   +S     TG   S  L +   I  I +     Q  VP  + +    N  CS +CL      YRC+C T      +N  C +  T S F
Sbjct: 2964 LILADHHEIRKISLDGLNYTLLKQGLSNVLSLD-FDYRKELIFWI-DTSRPSGRRINRMRLNGSDLKVVHRTSVPNA--LAVDWIGKNLYWCDAERKTVEVAKAN--GLYP------TVLLSTGLRNPSALALDTNTGFVFWIDCCEYPHIGRIGMDGSKAQVIVDTEIHTPSALTIDYVNQRIYWADQNHILFSNMDGSRRYRVPNEGMGG-------------VTSLALFEDFLYWSDQKTKTLSRAHKTTGAKRSELLSSWQTIRDIKVYHPLRQPDVP--KHQCQVNNGGCSHLCLLSPGGGYRCACPTHFYLANDNKTCLSNCTASQF 3269          

HSP 11 Score: 58.9214 bits (141), Expect = 7.128e-8
Identity = 88/396 (22.22%), Postives = 158/396 (39.90%), Query Frame = 3
Query:  906 CMNRV---CSSIC--LPIVDSAYRCSCSTGITEPINNAVC-------PTFPTRSLFIGNPPKIYHMSLDG---------GLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSD--------------------IPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSK-RILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRS-LVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSC 1961
            C+NR    CS  C  +P+    Y+C+C +G     +   C        +FP     +        + +DG             P  +L+++  I  + + D +  +LL      S++ SLD + Y     F++D    S                     +P ++AVD   +N+YW +     V VA+ +      Y T+LLS               + P  LA+D+   ++F     +    I R  +DG+ K  VI  T    P  L +D   Q++Y+ D  +  ++  N  G  + R+  +      SL+ F++F+YW++ +T ++    K  G+ RS L++  + +  R + V    R   +     C   +  C  LC    G  +  +C
Sbjct: 2882 CLNRKVSGCSQDCQDMPV---GYKCTCWSGFRLKADGRTCVDVDECVESFPCSQQCVNTYGSYKCLCVDGYQRLDTDPHSSDEPFLILADHHEI-RKISLDGLNYTLLKQGL--SNVLSLDFD-YRKELIFWIDTSRPSGRRINRMRLNGSDLKVVHRTSVPNALAVDWIGKNLYWCDAERKTVEVAKANGL----YPTVLLS------------TGLRNPSALALDTNTGFVFWIDCCEYP-HIGRIGMDGS-KAQVIVDTEIHTPSALTIDYVNQRIYWAD--QNHILFSNMDGSRRYRVPNEGMGGVTSLALFEDFLYWSDQKTKTLSRAHKTTGAKRSELLSSWQTI--RDIKVYHPLRQPDVPK-HQCQVNNGGCSHLCLLSPGGGYRCAC 3247          

HSP 12 Score: 54.6842 bits (130), Expect = 1.414e-6
Identity = 39/108 (36.11%), Postives = 52/108 (48.15%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDE-QC---CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNN 4733
            C+S++  CD   DC +G DE  C   N    Y C     C+    RCDG  DC   SDE  C   C  ++F C   ++   C+P   RC+G+ DC D SDE  C  + 
Sbjct: 3512 CISMKWLCDGQEDCKNGEDEKHCQPANT---YVCVGGG-CVSAGLRCDGKNDCTDGSDEVDCVRECKQEEFVC---RNRAHCVPSGWRCDGVADCLDQSDEENCENDG 3612          

HSP 13 Score: 53.5286 bits (127), Expect = 3.244e-6
Identity = 40/97 (41.24%), Postives = 50/97 (51.55%), Query Frame = 3
Query: 4464 DCLDGSDEVGC-NTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQC--------CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            DC DGSDEVGC + C+++  + C  S  C+P    CDG  DC   SDE          C  ++F C S      C+P   RC+G  DC DGSDE  C
Sbjct:  974 DCGDGSDEVGCVHACSVAQ-FQCF-SGKCIPEHWLCDGDNDCGDYSDENITLLASVSDCSEEEFRCRSDGS---CIPERWRCDGDKDCEDGSDEVAC 1065          

HSP 14 Score: 52.373 bits (124), Expect = 6.619e-6
Identity = 69/278 (24.82%), Postives = 99/278 (35.61%), Query Frame = 3
Query: 3918 SMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVG--CNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDE-----QCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCN 4724
             + V   +LFW+DW Q+      + SD    A +               T++R  +   P    + +  T    H C  +   + N  C  LCL T                   G   C C     +   +R             C      C A L F    G     C+  Q  CD    C D SDE    C+  N  + Y    +  C+  +  C+GV DC  +SDE       C +++  C  G     C+P +A CN I+DC D SDE  C+
Sbjct: 2377 GLAVYGDFLFWSDWEQRSV----MRSDKLTGADV---------------TILRADSTQQPMGITAVANDT----HSCELSPCTVNNGGCQDLCLITPR-----------------GTVTCGCRGERILLDDNR-------------CVSLNSSCNAHLEFECGNG----ECIGYQLTCDGVPHCKDKSDEKRQYCDNRNCRNGYKSCYNQRCVSNSHFCNGVDDCGDNSDEVYCNSSSCSAEERRCADGA----CVPQAAWCNQIIDCADASDEKNCS 2593          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Cavefish
Match: lrp1ab (low density lipoprotein receptor-related protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-030131-7126])

HSP 1 Score: 130.183 bits (326), Expect = 1.767e-29
Identity = 321/1599 (20.08%), Postives = 577/1599 (36.09%), Query Frame = 3
Query:   66 IVFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKS--SQLAIDRHRKMLFWWGLDGE-IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFIN--DEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM----NRVCSSICLPIVDSAYRCSCSTGITEPINNAVC----------PTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVS--IAVDSASRNIYWMNHRNS--EVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ---KFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSS-EMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPM-LIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCL--PVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQP-INAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQF--WIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLL---QNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVG--CNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDE-----QCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            I      + VL  S+ +   +D   N    L   DV +  K+Y   + ENG                   V+++ + + E +AVDW++ N+YW +     IEV  L+           R  LL+  +    ++ +DP +  LFW    A    +E + + G  RR IH+        + L +D   + + W     + I+   Y G +G    ++G      P  +T   G++ + +     L  ++   G  +++  +TN     + +     Q   P     +PC        CS +CL   +  + C+C   +    +N  C               R + I NP   Y +S      P ++ ++          YD++   + + D  +  I    +N  G      ++  +S+DIP +  +AVD  SRN++W ++  S  ++ VAR+                   +FK S       P  L V  +   L+    TDG  +I     DGT +  +   TN   P GL++D   ++LY++ +    +      G    I+     K  +  +L+   + ++W    T  + +   DG    ++   RN  +  M +   +        + C   +  C QLC P   +  + SC C+    +      C  ++    V  + S  ++H LT + +                        + IYW++   + I +   +   +  +    +    +  +AVD+I  N+Y   T   +  I + RL     + S+  VV+S  +      A++VH +  +LFW E     R     + ++ LDGS+ + L+   ++  + + +D +   + W  + + KI R  +      E   + +++  V +     + ++ N    Y++ +D  +      ++ SI R         G+        ++   I +  K I +       +   +C     DN   C Q CL     +R C C     L+ DG TC D    L+    T                    ++ + LS++  +NA  K  +    +   I L  D+ G      +    +        ++Q+  I  D S    + ++  S E   Y  A     DTL W+ + T  I    ++  +    +   ++        P   A+      + W +             W++    I  + L G    V+V N    P+ L +D  + ++Y+ D   +K            I      G N  V + +   +  G     + V  +Y+FWTDW ++              A +    Y             R M  + P D     +G +      + C  +     N  C  LCL T                  +G+  CSC     +   +      CV          +  CG G             C++    CD    C D SDE    C+       Y    +  C+  +  CDG  DC   SDE       C + +F+C  G     C+  S+RCN +VDC D SDE  C
Sbjct: 1260 IDLYKGEFSVLVPSLRNTIALDFHLNQS-SLYWTDV-VEDKIYRGKLSENGALT------------SFEVVIQYGLATPEGLAVDWIAENIYWVESNLDQIEVAKLD--------GTMRTTLLAGEVEHPRAIALDPRDGILFWTDWDASSPRIEAASMSGVGRRTIHRETGSGGWPNGLTVDYLERRILWIDARSDAIYSAAYDG-SGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPQAP-----NPCAANGGKGPCSHLCLINYNQTFSCACPHLMKLQADNHTCYESRQFLLYARQIEIRGVDIDNPYYNYIISF---TVPVIDNVTA-------VDYDALEQRIYWSDVRTQMIKRAFINGTG------VETVVSADIPNAQGLAVDWVSRNLFWTSYDASKKQINVARLDG-----------------SFKNSVIHGLDKPHCLVVHPMLGKLY---WTDGD-NISMANTDGTNRTLLF--TNQKSPVGLSIDFNEERLYWISSGNSTINRCMLDGTGLEIIEAVKGKLTKATALAVMGDKLWWANQGTDQVGTCDKDGRNWKIL---RNSTSPVMHMKVYNETVQQRGTNLCTKNNGDCSQLCLPT--SPTTRSCMCTAGYSLKSGQQSCEGTTLSQSVSRSLSWSVSHSLTHSVNN-----------------------DTIYWVDMGLSTISRAKRDQTWREDVVTNGIGR--VEGIAVDWIAGNIY--WTDQGFDMIEVARL-----NGSFRYVVISHGLDKPR--AIAVHPERGYLFWTEWGQYPR-----IERSRLDGSERIVLVNVSISWPNGVSIDYEEGLLYWCDARTDKIERINL------ETGGNRELVLAVHNMDMFAVSVFEN----YIYWSDRTH------ANGSIKR---------GNKNNATDMVYLRTGIGVQLKDIKVFNR-ARQQGTNVC----KDNNGGCEQLCLYRGNGARTCACAHGM-LADDGRTCRDYEGYLLYSERT-------------------ILKSIHLSDETNLNAPIKPFEDPDHMKNVIALTFDHRG---GGGKGANRIFYSDIHFGNIQQ--INDDGSGRRTIVENVGSVEGLAYHRAW----DTLYWTSYTTSTITRHTVDQTRSGAFHRETVVTM-TGDDHPRAFALDECQGLMFWTN-------------WNELSPSIMRASLAGGNVLVIVGNSIRTPNGLAIDHRAEKLYFSDASLDK------------IERCEYDGSNRFVVLKNEPVHPFG-----LAVYGEYIFWTDWVRR--------------AVLRADKYG------------RDMKVLRP-DIPQQPMGIIAVAKDTNSCEFSPCHTNNGGCEDLCLLT-----------------SEGRVNCSCRGDRKLVEGNT-----CVAENTTCNSVDEFECGNG------------DCINYSLTCDGRAHCKDKSDEKPSYCSNRGCKKGYRRCLNGRCIKHSSWCDGTDDCGDHSDELPCNMTMCAAAEFQCKDGS----CISNSSRCNQVVDCEDASDELNC 2592          

HSP 2 Score: 99.7525 bits (247), Expect = 2.991e-20
Identity = 147/621 (23.67%), Postives = 233/621 (37.52%), Query Frame = 3
Query: 2985 CSQFCLPVE-SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNI--------LNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIK---TDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPED---FKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLV----KCDRYQIPCG----AGLVFSKKEGMSVMSCMSVQQRC------------DSTVDCLDGSDEVGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC-------DSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            C+Q C  ++   +C C   + L  DG TCVD+ +       +   +   G+         + + +D        E     I A + ++  +     N  L         A+D      MI  +  ++ Q   I+    + S  E L++   S       LA+D +   L W D     I   +LN       Y  V++N     R P  +A+   +  L W  +D+         V H   I M   DG  R +++K+    P+ LT+D  + RIYW D + + + +  +   N        I H                   +M + ++Y++WTDW      + S+N   +    MG++           KTV+ I     P D   F  S     ++NHPC     +++N  CS+LCL      LA             G ++C+CP +  +    +  +  C  SQ V    KC  +   C      G    + E      C   Q +C            D   DC D SDE  C+   C +   + CS    C+P   RC+G  +C       D  E  C   +F+C+  K   RC+P    C+   DC DGSDE
Sbjct: 2904 CTQLCEDLKIGYKCRCEPGFRLKQDGKTCVDIDECTTTYPCSQRCVNTHGSFHCFCIDGYIVQVNDTTRCKSTSEEEPYLIFANRYYLRKLNLDGTNYTLIKQGLNNAVALDYHYAEQMIY-WTDVTTQGSMIRRMHMNGSNVEVLHRTSLSNPDG---LAVDWVGGNLYWCDKGRDTIEVSKLNG-----AYRSVLVN--SGLREPRAVAVDVRNGYLYW--SDWG-------DVPHIGRIGM---DGTDRRIIIKDKITWPNGLTLDFINDRIYWADAREDYIAFASLDGTNRHTVLTQDIPHIF-----------------AMTLFEEYIYWTDW-----ETKSIN---RAHKTMGIN-----------KTVL-ISTLHRPMDIHIFHPSRQPEAVENHPC-----QVDNGGCSNLCL------LAP-----------GGGYKCACPTNFYLAADGKQCLSNCTASQFVCKNDKCIPFWWKCDTEDDCGDRSDEPEDCPAFKCRPGQFQCVTGICTNPAYICDGDDDCQDLSDEANCDIHVC-LPSQFKCSHPSRCIPGIFRCNGQNNCGQGEDEKDCPEVTCAPNQFQCVITK---RCIPRVWMCDRDNDCVDGSDE 3438          

HSP 3 Score: 93.2041 bits (230), Expect = 3.133e-18
Identity = 137/628 (21.82%), Postives = 243/628 (38.69%), Query Frame = 3
Query:  153 KLLAADVFLSRK--LYVFVIQENGKSLLKTANF----SKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDR-RVIHKSILFKSSQLAIDRHRKMLFWWG--LDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDE----QLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRV-----CSSICLPIVDSAYR-CSCSTGITEPINNAVCPTFPTRSLFI----GNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPV--SIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGT-----CSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTV--KGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAV----SRNASIDTGSPCYSTSNKCDQLCF 1928
            K  A D   + +   ++ V   +G + LK A F    S  D R +   +   +   E +A+DW++GN Y+ D  +  I V                 ILL   + +   + +DP    +F+   G I  +ER  +DG +R +++   I+F    + +D   ++++W    LD  I  VDY+G+   ++ +QG   +   +   F E  L   N +    Q   S        S   +    +     +   HQ   P  R  +   ++      CS ICL       R C C +G +   +   C   P   LF+    G P  I  M L   +     +  EN   P    Y + T    ++ F+ ++ +++   K     R   D  +   I     IAVD   +N+YW +    +           +  A L  + Q      E +      P  + VD ++  ++ +   + +      SI + W+DG+    +I+S N  WP GL+LD  +  LY+VD    + +M+ +N          Q+      L ++ NF++W E    SI+       +  +  K   L     P+  +    ++   I   + C + +  C  LC 
Sbjct:  211 KTTAMDFIYAEETVCWILVGDTSGGTQLKCAKFPNAKSFTDERTIN--VSLSLHHVEQMAIDWLTGNFYFVDDVDDRIFVC--------TNDGSTCIILLDLELYNPKGIALDPTMGKMFFTDYGQIPKVERCDMDGQNRTKLVDSKIVFPHG-ITLDLVSRLVYWADAYLD-YIEVVDYEGKNRHTI-IQGLLIEHLYSLTVF-ENYLYATNSDNANMQPKTSVIRVNRFNSSEFQVVTRVDKGGALHVYHQRRQPAVRSHACAPDQYGKPGGCSDICLLANSHKSRTCRCRSGFSVGSDGKSCKK-PEHELFLLYGKGRPGVIRGMDLHARVYDEHIIPIENLNNPRALDYHAETE---FIYFSDATTYTIGRQKIDGTDR---DIIVKDGIHTVEGIAVDWMGQNLYWTDDGLEKT----------INVAKLEKASQTRKVLVEGKMTH---PRAIVVDPVHGMMYCSDWQEDSRDANLGSIRKAWMDGSNFGVLITSKNMLWPNGLSLDIQQGILYWVDAYYDRIEMVLLNTTERRTVYEGQELSHPFGLCHYKNFLFWNEYRVGSIY------KLDQITKKVTLLRTERPPIYEIRTYDAQQQQITGHNLCRANNGGCSSLCL 798          

HSP 4 Score: 87.0409 bits (214), Expect = 2.550e-16
Identity = 138/584 (23.63%), Postives = 230/584 (39.38%), Query Frame = 3
Query:  921 CSSICLPIVDSAYRCSCSTG-ITEPINNAVCPTFPTRSLFI-GNPPKIYHMSL-DGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTN-DFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFIS----LSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNK--CDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSD--TISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYR 2633
            CS  C+    +  +C+C  G   EP N +   T P +   I  N  +I  + L  G     +  L     + F        SSL + D     I+   L++ G    F +        P  +AVD  + NIYW+     ++ VA++    R    TLL               + + P  +A+D  +  LF T     +  IE   + G  + T+   T    WP GL +D   +++ ++D  + D I    + GS  I   +  E++S    ++ +   +YWT+  T ++    K+ G   ++V +T N     + V   SR       +PC +   K  C  LC  I  NQ +FSC C +   +  +   C Y S   + + + + I      N    YI          V ++  D    +IYW +     I +   N      +    +S+D      LAVD++  NL+ +   ++  +I + RL     D S+ N V+    K   L    VH  L  L+W      D  N++    A+ DG+   L++        L +D     + W SS +  I R
Sbjct: 1211 CSQRCIQ-EKATVKCACYEGWALEPDNESCKSTDPFKPFIIFSNRHEIRRIDLYKGEFSVLVPSLRNTIALDFHLN----QSSLYWTDVVEDKIYRGKLSENGALTSFEVVIQYGLATPEGLAVDWIAENIYWVESNLDQIEVAKLDGTMR---TTLLAG-------------EVEHPRAIALDPRDGILFWTDWDASSPRIEAASMSGVGRRTIHRETGSGGWPNGLTVDYLERRILWID-ARSDAIYSAAYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRT-NTQPFDLQVYHPSRQPQ--APNPCAANGGKGPCSHLCL-INYNQ-TFSCACPHLMKLQADNHTC-YESRQFLLYARQIEIRGVDIDNPYYNYIISFTVPVIDNVTAVDYDALEQRIYWSDVRTQMIKRAFINGTGVETV----VSADIPNAQGLAVDWVSRNLFWTSYDASKKQINVARL-----DGSFKNSVIHGLDKPHCL---VVHPMLGKLYW-----TDGDNIS---MANTDGTNRTLLFTNQKSPVGLSIDFNEERLYWISSGNSTINR 1746          

HSP 5 Score: 71.633 bits (174), Expect = 1.223e-11
Identity = 64/252 (25.40%), Postives = 110/252 (43.65%), Query Frame = 3
Query: 1266 PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKT--RNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRC 2006
            P  +AVD    N+YW +     + V++++      Y ++L++       +E R         +AVD  N YL+ +   D    I R  +DGT +  +I      WP GL LD    ++Y+ D  + D I+     G+ R  +L Q      +++ F+ +IYWT+ ET SI+   K  G  ++++  T  R +D   + +   SR        PC   +  C  LC    G    + C C    ++  +  +C
Sbjct: 3056 PDGLAVDWVGGNLYWCDKGRDTIEVSKLNG----AYRSVLVN----SGLREPRA--------VAVDVRNGYLYWSDWGDVP-HIGRIGMDGTDRRIIIKD-KITWPNGLTLDFINDRIYWAD-AREDYIAFASLDGTNRHTVLTQDIPHIFAMTLFEEYIYWTDWETKSINRAHKTMGINKTVLISTLHRPMD---IHIFHPSRQPEAVENHPCQVDNGGCSNLCLLAPGG--GYKCACPTNFYLAADGKQC 3283          

HSP 6 Score: 69.3218 bits (168), Expect = 4.883e-11
Identity = 68/261 (26.05%), Postives = 110/261 (42.15%), Query Frame = 3
Query:  291 VQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLM---------VPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFI 1040
            + + + +AVDWV GNLYW D+    IEV  LN           R +L++  + +  ++ VD    YL+W   G +  + R  +DG+DRR+I K  +   + L +D     ++W   D     + +    G +     T  Q  P     T      + +E ++ + +E    I+ A KT   I    +IS  H+ M          P      PC   N  CS++CL      Y+C+C T      +   C +  T S F+
Sbjct: 3053 LSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLN--------GAYRSVLVNSGLREPRAVAVDVRNGYLYWSDWGDVPHIGRIGMDGTDRRIIIKDKITWPNGLTLDFINDRIYW--ADAREDYIAFASLDGTNRHTVLT--QDIPHIFAMT------LFEEYIYWTDWE-TKSINRAHKTM-GINKTVLISTLHRPMDIHIFHPSRQPEAVENHPCQVDNGGCSNLCLLAPGGGYKCACPTNFYLAADGKQCLSNCTASQFV 3293          

HSP 7 Score: 63.929 bits (154), Expect = 2.544e-9
Identity = 43/140 (30.71%), Postives = 68/140 (48.57%), Query Frame = 3
Query: 4368 QIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLY----------SCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQK--------FECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNR 4727
            ++PC   +  + +      SC+S   RC+  VDC D SDE+ C+  + S  Y           C  + +C   + +CDG  DC   SDE+ C +++        F C SG    RC+P+S  C+   DC +G+DE  C++
Sbjct: 2550 ELPCNMTMCAAAEFQCKDGSCISNSSRCNQVVDCEDASDELNCSPTDCSSFYLLGVKSMTFQKCEFTTLCYAPSWQCDGSNDCGDFSDERNCPAKRKQKCPVNFFACPSG----RCIPMSWTCDKENDCENGTDETHCDK 2685          

HSP 8 Score: 58.151 bits (139), Expect = 1.358e-7
Identity = 35/118 (29.66%), Postives = 63/118 (53.39%), Query Frame = 3
Query:  279 LKFP-VQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFW 629
            L+ P +++   +AVDWV+GNLYW D     IEV  ++  +        R+ L+S  + + +++VVDP    ++W   G    +E + +DG+ R+ +    L   + LA+D   + L+W
Sbjct: 3839 LQIPGLKTPRGIAVDWVAGNLYWTDSGRDVIEVAQISGQN--------RKTLISGMIDEPYAIVVDPPRGTMYWADWGNHPKIETAAMDGTLRQTLVHEHLQWPTGLAVDYFNERLYW 3948          

HSP 9 Score: 56.225 bits (134), Expect = 4.586e-7
Identity = 42/114 (36.84%), Postives = 58/114 (50.88%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQC-------------CGSQKFEC-LSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C++V  RCD+  DC D SDE GC+    S  + C+ S  C+P    CDG  DC  +SDE+              C + +F+C + G     C+P+  RC+G  DC D SDE  C
Sbjct:  968 CINVNWRCDNDNDCGDNSDEAGCSHSCSSVQFKCN-SGRCIPEYWTCDGDNDCGDNSDEKSANCTNQATRPPGGCHTDEFQCRMDG----LCIPMRWRCDGDTDCMDLSDEKHC 1076          

HSP 10 Score: 54.6842 bits (130), Expect = 1.342e-6
Identity = 46/147 (31.29%), Postives = 66/147 (44.90%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGC----NTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQKFE-----CLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSVALSAC 4835
            C+ ++ RCD   DC+D SDE  C    + C+ +  ++C  S  C+     CDG  DC+  SDE  C +   +     C S   +  CLP    C+G  DC DGSDE  C            D  +V N   ++  +I  G   L +C
Sbjct: 1054 CIPMRWRCDGDTDCMDLSDEKHCEGVTHMCDPAVKFTCRDSARCISKAWVCDGDSDCEDNSDEDNCEALMCKLSHHVCASNSSI--CLPAEKLCDGKDDCPDGSDEKLC------------DLCSVENGGCSHNCSIAPGEGILCSC 1186          

HSP 11 Score: 54.299 bits (129), Expect = 2.130e-6
Identity = 42/133 (31.58%), Postives = 61/133 (45.86%), Query Frame = 3
Query: 4350 VKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQKFECLSGKDV-----TRCLPISARCNGIVDCRDGSDEHGCNR 4727
            +KCD  Q  C  G             C+ ++ RCD+  DC+DGSDE        +  + C+ + +C P+  +CDG  DC  +SDE     +KF C   ++        CL    RC+G+  C D SDE  C  
Sbjct: 3564 LKCDVDQFQCKNG------------HCIPLRWRCDADADCMDGSDEERSERLCPNDEFQCNNT-LCKPLAWKCDGEDDCGDNSDENPEECRKFVCPPTRNFRCQNDRVCLWNGKRCDGVNHCGDNSDELNCGE 3683          

HSP 12 Score: 53.9138 bits (128), Expect = 2.375e-6
Identity = 45/130 (34.62%), Postives = 66/130 (50.77%), Query Frame = 3
Query: 4368 QIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVG--CN--TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ-C----CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCN 4724
            Q+ CG      K  G     C+  + +CD   DC D SDE    C+  TC   + + C +++ C+P   +CD   DC  +SDE+ C    C   +F C +G    RC+    +C+G  DC DGSDE+GC+
Sbjct: 3444 QMTCGVDEFRCKDSGR----CIPARWKCDGEDDCGDSSDEPKEECDERTCE-PYQFPC-KNNRCVPGRWKCDYDNDCGDNSDEEDCVPRQCSESEFACTNG----RCIAGRWKCDGDHDCSDGSDENGCD 3563          

HSP 13 Score: 53.1434 bits (126), Expect = 4.310e-6
Identity = 125/602 (20.76%), Postives = 208/602 (34.55%), Query Frame = 3
Query: 2985 CSQFCLPV---ESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLV--KNPGIPSCLTVDVHSGRIYWIDTKTNKL-MYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMS---VQQR--CDSTVDCLDGSDEVGCNTCNISHLYSC------SRSDVCLPITKRCDGVMDCDSDE---------QCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            CS  CL     +SR C C S +S+ +DG +C      L ++   G    IRG  L+ +                          VY      ++ ++N     A+D       I      +      K D +  + + K       +   +A+D +   L W+D   G+     +   +   +   V++  + +   P  I + P+   +          + N  S+  + W     +DG+   VL+  KN   P+ L++D+  G +YW+D   +++ M L    +   +  G  + H                    +   K +LFW ++         V S            Y L  +  K+ T++R       E     +    +  H   RA+    N  CS LCL T                          PV  +           C   Q++  D          V   +      +C +   +Q+R  CD   DCLD SDE       + H ++C       +++ C+P    CDG  DC +DE         + C   +F C SG    RC+P S  C+   DC D SDE
Sbjct:  471 CSDICLLANSHKSRTCRCRSGFSVGSDGKSCKKPEHELFLLYGKGRPGVIRGMDLHAR--------------------------VY---DEHIIPIENLNNPRALDYHAETEFIYFSDATTYTIGRQKIDGTDRDIIVKDGI---HTVEGIAVDWMGQNLYWTD--DGLEKTINVAKLEKASQTRKVLVEGKMTH--PRAIVVDPVHGMMYCSDWQEDSRDANLGSI-RKAW-----MDGSNFGVLITSKNMLWPNGLSLDIQQGILYWVDAYYDRIEMVLLNTTERRTVYEGQELSHPF-----------------GLCHYKNFLFWNEY--------RVGS-----------IYKLDQITKKV-TLLRTERPPIYEIRTYDAQQQQITGHNLCRAN----NGGCSSLCLLT--------------------------PVGRTCA---------CADDQILDSDNKTCKANPSYVPPPQCQQGEFACKNNRCIQERWKCDGDDDCLDKSDEAP----ELCHQHTCPEDRFKCQNNRCIPKRWLCDGDNDCGTDEDESNTTCSARTCPPNQFPCASG----RCIPSSWTCDLDDDCGDRSDE 946          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Sea Lamprey
Match: lrp1ab (low density lipoprotein receptor-related protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-030131-7126])

HSP 1 Score: 128.257 bits (321), Expect = 1.369e-29
Identity = 326/1653 (19.72%), Postives = 614/1653 (37.14%), Query Frame = 3
Query:   60 IIIVFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRK-LYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQI-GAIMVLERSRLDGSDRRVIHKSILFKS--SQLAIDRHRKMLFWWGLDGE-IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFIN--DEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNR----VCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFA-YDSVTSSLLYVDFNSSS--IFSLDLNKYGTPQRFY----LDFPISSDIPVS--IAVDSASRNIYWMNH--RNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRI---LAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLF----MADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCL--PVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKD--DEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEF-SRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSA-DFSKSETNDSSVWHQFWIEMSDL----------DGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQ--IFASISVNSDIK------PSAAMGM----------HFYNLQYLKDKLKTVV------RIMARIAPEDFKSSSLGTLLQNHPCS-RASHEMENKRCSHLCLSTLPIS----LAEEYSFLMTAQQL-DGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLY----------SCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQK---------FECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCN 4724
             +   ++++ H + +  LH+    +        +A D  L++  LY   + E+     K +    L   ++  V++  + + E +AVDW++GN+YW +     IEV  LN           R  L++  +    ++ +DP    LFW     +   +E   + G+ R VIH  +      + L +D     + W     + I+   Y G T     ++G      P  +T   G++ + +     L  ++   G  +++  +TN     + +     Q M       +PC +      CS  CL   +    C+C   +    +   C     + L      +I  + +D    P    +     I F     D+VT+    VDF+ +   I+  D+      + F     ++  +S+D+  +  +AVD  S N+YW ++     ++ VAR+                   +FK +  Q    P  LA+  I   ++    TDG  +I    +DG++K  + S      P GL++D    +LY++ +  G +      G    I   +  K  +  +L+   + ++W +  +  + +  K DGS   ++   RN  A  M +    R+    T +PC   +  C QLC P   ++   +C C+   ++  +   C      ++Y     +    L P      +    G S      +      + IYW++   + I +   +   +  +    L    +  +AVD+I  N+Y       +  I + RL     + S+  VV+S  +      A++VH D  +LFW E     R     + ++ LDG++  +L+   +A  + + VD + + + W  + + KI R ++   +  E                    +  ++ ++ +F      D IY    + ++ SI R      ++V           +   I +  K + +   +   +   +C   N      C Q CL      R C C     L+ DG +C D    L+    T         IL      DE++    V   E P +             KN++    +YG  S    T   V  ++ +      H       +++   +    +   S   LA     D+L W+ + T  I   R   D+ R          RE               +++ +SA D  ++   D  +   FW   ++L            N + ++  N   P+ L +D  + ++Y+ D   +K+            R  +   H   V + S   +  G     + V   ++FWTDW ++  + A+    +D+K      P   MGM               + +    + +       R+  +   E         + + + C  +   E  N  C    L+   ++     ++E  F  T++Q  +G   C       +  +    +  C        +  +I C      + +      SC++   RC+  VDC D SDE+GC   N +H +          SC+ + +C+     CDG  DC   +DE+ C  +          F C SG     C+P + +C+   DC DG+DE  C+
Sbjct: 1240 FVPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIAIDFHLNQSSLYWTDVVEDKIYHGKLSETGGLTSVEV--VVQHGLATPEGLAVDWIAGNIYWVESNLDQIEVARLN--------GTMRSTLVAGGIEHPRAIALDPRYGILFWTDWDSSFPRIEAISMSGTGRHVIHHEMGAGGWPNGLTVDYLENRIMWIDARSDSIYSALYDG-TELIEVLRGHEFLSHPFAVTLFGGEVYWTDWRTNTLVRANKWTGQNVTVVQRTNTQPFDLHVFHPTRQPMA-----NNPCGDNEGRGPCSHHCLINYNRTAACTCPHLMKLQPDKRTCSEH-WKFLLYARQMEIRGVDIDA---PYYNFI-----ISFTVPDIDNVTA----VDFHGAEQRIYWSDVRTQTIKRAFINGTNVETIVSADLANAHGLAVDWISGNLYWTSYDANKKQINVARMDG-----------------SFKTAVLQGLDKPHGLALHPIKGKMY---WTDGD-TINVANMDGSEKAILHSQQKG--PVGLSIDYEESKLYWISSGNGTINRCELDGSGLEIVETMKSKLTKPSALAIMGDKLWWADQASEQLGTCSKRDGSNAVVL---RNSTANVMHLRVYDRDLQKGT-NPCSVNNGNCAQLCLPR--SETVPTCRCTAGYNLQADQRNCEGIGAFLLYSVHEGIRGIPLDPADKTDALVPISGTS--LAVGIDFHAGNDTIYWVDMGLSSIHRAKRDQTWREDIITNGLGR--VEGIAVDWIAGNIY--WIDQGFDVIEVARL-----NGSFRYVVISQGLDKPR--AIAVHPDKGYLFWTEWGQNPR-----IERSRLDGTERTVLVNVSIAWPNGISVDYEEDKLYWCDARTDKIERIDLETGENRE--------------------VVLSTSNMDMFSVSVFGDYIYWSDRTHANGSIKRGSKENATDV---------VALRTGIGVQLKDVKVFNKER-QKGTNVCARQNG----GCEQLCLYRGKARRMCACAHGL-LAEDGVSCRDYDGYLLYSERT---------ILKSVHLFDELNLNAPVRPFEDPEHM------------KNVIALAFDYG--SGPRSTSGGVPYRRRRIFFSDIHFGNIQQLFNDGTGRRVIVENVGSVEGLAYHRGWDSLYWTSYTTSTIT--RHTVDQARPGAFD-----RE---------------TVVTMSADDHPRAFVMDECLNLMFWTNWNELSPSIMRSFLSGANVQVIVGSNIRTPNGLAIDHRAEKLYFSDATLDKIE-----------RCEYDGSHRYVVILRSEPVHSFG-----LAVYGDFVFWTDWVRRAVLRANKFTGTDVKVLRGEIPQQPMGMIALANDTNSCELSPCKVMNGGCEDLCLITEDGRVNCKCRGERVLVDGTRCVARKNSCDLQTEFECNNGDCIRYHLTCDGVADCKDKSDEKPFYCTSRQCKNGYVNC-------LNGRCMETLKLCNGVNDCGDNSDEIACNNSTCGADEFRCGDGSCIANVTRCNQVVDCDDISDEIGCGPMNCTHYHRLGVQASGYVSCNSTSLCVLPAWICDGANDCGDYADEKNCKKKSGSPGCSPDYFNCPSGP----CIPTAWKCDREPDCDDGADELNCD 2709          

HSP 2 Score: 93.5893 bits (231), Expect = 5.620e-19
Identity = 136/597 (22.78%), Postives = 241/597 (40.37%), Query Frame = 3
Query:  279 LKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSD-RRVIHKSILFKSSQLAIDRHRKMLFWWG--LDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECG------TGISIALKTNPNIAPIAIISRKHQLMVPRGRRKS-----PCMNRV------CSSICLPIVDSAYR-CSCSTGITEPINNAVCPTFPTRSLFI---GNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKY-GTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITD---GT--CSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRIL--AQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSN 1973
            +   V   E +A+DW++GN Y+ D  +  I V +   D+           LL   + +  ++ +DP    LF+   G I  +ER  +DG +  +++   I+F    +A+D   ++++W    LD  I  VDY+G+   ++ +QG      P+ +    G  VF N   L+ +S +        T I +    + +   +  + +   L +   RR+      PC          CS ICL       R C C +G +   +   C    T    +     P  I  M + G +Q    +  EN   P    + + T    YV F  ++ F +   K  GT +   L   I++     IAVD    N+YW +     + VAR+   ++ +            T  E        P  +AVD ++ +++ T   +   GT    IE  W+DGT +   +SS    WP GL+LD     LY+ D     +  +   G  ++++   Q+      L++  + I+WTE    +++  ++D   R+  T  RN       +    R       + C+  +  C  LC  +       +C C++
Sbjct:  253 ISLNVHHVEQMAIDWLTGNFYFMDDVDDRIFVCNKQGDT--------CVTLLDLELYNPKAIALDPTMGKLFFTDYGQIPKVERCDMDGGNCSKLVDSKIVFPHG-IALDLVSRLVYWADAYLD-YIEVVDYEGRNRRTI-IQG------PS-VEHLFGLSVFEN--YLYATSIDNSNSPQNTTVIRVNRFNSTDYQVLTRVVKGGALHIYHRRRQPTGGSHPCAPDQYGKPGGCSDICLLASSHKTRTCRCRSGFSLGSDGKSCKMCITNLCLLKRLSRPGIIRGMDVTGRVQDEFMIPIENLVNPRAVDFHAETG---YVYFADTTNFLVARQKIDGTERETILKTNINN--VEGIAVDWMGYNLYWTDDGLKTINVARLEKASQARR-----------TLIEGNMTH---PRAIAVDPVHGFMYWTDWEEDPKGTKRGKIEHAWMDGTHRSIFVSSKTVLWPNGLSLDIPNGILYWCDAYFDQIERIKLDGTERKVVYDGQELSHPFGLTHHGHNIFWTEYRLGTVY--RYDTISRN-TTVLRNERPPIFEIRTYDREQQKSGTNACHVNNGGCSILCLAV---PEGRACACAD 804          

HSP 3 Score: 87.0409 bits (214), Expect = 4.573e-17
Identity = 115/466 (24.68%), Postives = 174/466 (37.34%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQF-WIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLV-----------KCD-------RYQIP-------CGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNT--CNISHLYSCSRSDVCLPITKRCDGVMDC-------DSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
             LA+D I   L W D     I   +LN       Y  V++N     + P  +A+      L W             S W +   I    +DG+ RSV++      P+ L++D  + RIYW D + + + +  +   N        I H                   ++ + + +++WTDW      + +VN   K + A              + T+ R M       F+   +     NHPC     ++ N  CS+LCL    IS               G+++C+CP +  +    R  +  C  S+ V           KCD       R   P       C  G  F  K G+    C +    CD   DC DGSDE  C+   C +   + C  +  C+P   RC+G  +C       D  E  C   +F+C S K   RC+P    C+   DC DGSDE
Sbjct: 3075 GLAVDWIGGNLYWCDKGRDTIEVSKLNG-----LYRTVLLN--NGLKEPRALAVDVRGGYLYW-------------SDWGEHPHIGRMGMDGSNRSVVIDTKITWPNGLSLDYVNNRIYWADAREDYIQFADMDGANRHTVVSEDIPHIF-----------------ALSLFEDHVYWTDW-----ETKTVNRAHKSTGADRTTL---------ISTLHRPMDLHVYHPFRQPDV----PNHPC-----KVNNGGCSNLCL----ISPG-------------GQYKCACPTNFYLASDGRTCLSNCTASRFVCKNDKCIPFWWKCDTEDDCGDRSDEPADCPDFKCRPGQ-FQCKNGI----CTNPAFICDGDNDCGDGSDEANCDVHVC-LPSQFKCRTTHRCIPGIFRCNGQDNCGDGEDEKDCPEVTCAPNQFQCSSTK---RCIPRVWVCDRDNDCGDGSDE 3454          

HSP 4 Score: 74.7146 bits (182), Expect = 2.493e-13
Identity = 88/355 (24.79%), Postives = 151/355 (42.54%), Query Frame = 3
Query:  921 CSSICLPIVDSAYRCSCSTGITEPINNAV-CPTFPTRS--LFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKT--RNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSC 1961
            CS  CL     +++C C+ G  + +N++  C         L   N   +  ++LDG     L+    NA +   F +         V    S I  + +N  G+  +      +S+  P  +AVD    N+YW +     + V++++      Y T+LL    +   KE R         LAVD    YL+ +   +    I R  +DG+ +  VI  T   WP GL+LD    ++Y+ D  + D I      G+ R  ++++      +LS F++ +YWT+ ET +++   K  G+ R+ +  T  R +D   + V    R   +    PC   +  C  LC    G Q+  +C
Sbjct: 2961 CSQTCLN-SHGSFKCLCTDGYRQRVNDSTSCKAISDEEAILIFANRYYLRKVNLDGSNYTLLKQGLNNA-VALDFEWSEQWVYWTDVTTQGSMIRRMHMN--GSDTQVLHRTSLSN--PDGLAVDWIGGNLYWCDKGRDTIEVSKLNGL----YRTVLL----NNGLKEPRA--------LAVDVRGGYLYWSDWGEHP-HIGRMGMDGSNRSVVI-DTKITWPNGLSLDYVNNRIYWAD-AREDYIQFADMDGANRHTVVSEDIPHIFALSLFEDHVYWTDWETKTVNRAHKSTGADRTTLISTLHRPMD---LHVYHPFRQPDV-PNHPCKVNNGGCSNLCLISPGGQYKCAC 3286          

HSP 5 Score: 65.4698 bits (158), Expect = 1.468e-10
Identity = 134/604 (22.19%), Postives = 224/604 (37.09%), Query Frame = 3
Query: 2985 CSQFCLPVES---RECGCGSVYSLSADGATC----VDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI--PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSL-LSNGVGFSTSSMVVLKKYLFWTDWFQQI---FASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSC------SRSDVCLPITKRCDGVMDCDSDE---------QCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            CS  CL   S   R C C S +SL +DG +C     +L  LL  ++  G I G+  ++     DE  F+  +E    P         AV + ++         G++   D T  +++ ++    + +E  +KT+ +  E               +A+D +   L W+D     I   RL         L        +   P  IA+ P+   + W   +     T    + H +      +DG  RS+ V +  +  P+ L++D+ +G +YW D   +++  + +             G   KV  D   LS+  G +          +FWT++       + +IS N+ +               L+++   +  I       D +    GT         A H + N  CS LCL+     + E  +      QL      +C  +   T   +   G                      F+ K G     C+  + RCD   DCLD SDE       I H ++C       +++ C+P+   CDG  DC + E         + C   +F C SG     C+P+S +C+   DC D SDE
Sbjct:  467 CSDICLLASSHKTRTCRCRSGFSLGSDGKSCKMCITNLC-LLKRLSRPGIIRGM--DVTGRVQDE--FMIPIENLVNP--------RAVDFHAET--------GYVYFADTTN-FLVARQKIDGTERETILKTNINNVE--------------GIAVDWMGYNLYWTDDGLKTINVARLEKASQARRTL-----IEGNMTHPRAIAVDPVHGFMYWTDWEEDPKGTKRGKIEHAW------MDGTHRSIFVSSKTVLWPNGLSLDIPNGILYWCDAYFDQIERIKLD------------GTERKVVYDGQELSHPFGLTHHG-----HNIFWTEYRLGTVYRYDTISRNTTV---------------LRNERPPIFEIRTY----DREQQKSGT--------NACH-VNNGGCSILCLA-----VPEGRACACADDQLLDADNITCKPNPDYTPPPQCHPG---------------------EFACKNGR----CIQERWRCDGDNDCLDNSDEAP----EICHQHTCPSDRFKCQNNRCIPLRWLCDGDNDCGNSEDESNTTCAARTCPPNQFSCASG----HCIPMSWKCDLDDDCGDRSDE 940          

HSP 6 Score: 64.3142 bits (155), Expect = 4.019e-10
Identity = 76/290 (26.21%), Postives = 116/290 (40.00%), Query Frame = 3
Query:  279 LKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIH-----RVDYQGQTGCSMRVQGTWKQWS-PTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPF 1130
            LK P      VAVDWV+ NLYW D     IEV  L            R+ L+S  + + H++V+DP    ++W   G    +E++ +DG+ R    +  L   + LAID   + L+W   D ++      R+D   +       QG    +S   F  +  G + ++N+    +  F  GT ++I       ++    I   H L  P     +PC  R C  +CL +  +   CSC  G    + N  C   PT +              DG    P  L   N G  F
Sbjct: 3925 LKMP----RGVAVDWVADNLYWTDSGRDVIEVAQLR--------GHYRKTLVSGMIDEPHAIVLDPIRGQMYWSDWGNNAKIEQASMDGTRRHNFVEKDLQWPTGLAIDFMNQRLYW--ADAKLSVIGSIRLDGTDRVVAVDSKQGLLHPFSIEIFEDYIYG-VTYVNNRVFRIHKFGSGTVVNITA----GMSHATDIVVFHPLKQP--EVINPCEQRKCEWLCL-LNPNGATCSCPNGWA--LVNGTCLEVPTPT-----------SQPDGSTPGPCTLPCLNGGSCF 4179          

HSP 7 Score: 62.7734 bits (151), Expect = 1.037e-9
Identity = 48/128 (37.50%), Postives = 66/128 (51.56%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCN-TCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDE---QC----------CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDP 4763
            C+++  RCD+  DC D SDE+GCN +C+IS  + C+ S  C+P    CDG  DC   SDE    C          C   +F+C   K   +C+P+  RC+G  DC D SDE  C     +  + T DP
Sbjct:  962 CINMNWRCDADNDCADASDEIGCNHSCSISQ-FKCN-SGRCIPSHWTCDGDNDCGDFSDETNPNCTKLATRPPGGCHGDEFQC---KADGQCIPLRWRCDGDTDCIDTSDEKEC-----DGVVRTCDP 1079          

HSP 8 Score: 62.3882 bits (150), Expect = 1.380e-9
Identity = 45/136 (33.09%), Postives = 66/136 (48.53%), Query Frame = 3
Query: 4353 KCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGC----NTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQKFECLSGKDVT-----RCLPISARCNGIVDCRDGSDEHGCNR 4727
            +CD  Q  C  G             C+  + RCD+ +DC+DGSDE  C     TC   H + C+ + +C P++ +CDG  DC  +SDE      KF+C  G+         C     +C+G+ +C DGSDE  C +
Sbjct: 3581 RCDHDQFQCRNG------------HCIPQRWRCDADIDCIDGSDEDNCAAIVRTC-PHHEFQCNNT-LCKPLSWKCDGEDDCGDNSDETPEMCLKFQCPPGRQFRCRNNRVCFWAGRQCDGVDNCGDGSDEENCEK 3702          

HSP 9 Score: 59.3066 bits (142), Expect = 1.106e-8
Identity = 73/339 (21.53%), Postives = 132/339 (38.94%), Query Frame = 3
Query:   45 KMIRTIIIVFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKS-----PCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFI 1040
            K I     + ++A+ + L K  L      +        +A D   S +   +       S+++  + +  D + +    +  + + + +AVDW+ GNLYW D+    IEV  LN           R +LL+  + +  +L VD    YL+W   G    + R  +DGS+R V+  + +   + L++D     ++W   D     + +    G +     +        L+  E  + + + E   V+     TG             I+ + R   L V    R+      PC   N  CS++CL      Y+C+C T      +   C +  T S F+
Sbjct: 2991 KAISDEEAILIFANRYYLRKVNLDGSNYTLLKQGLNNAVALDFEWSEQWVYWTDVTTQGSMIRRMHMNGSDTQVLH---RTSLSNPDGLAVDWIGGNLYWCDKGRDTIEVSKLN--------GLYRTVLLNNGLKEPRALAVDVRGGYLYWSDWGEHPHIGRMGMDGSNRSVVIDTKITWPNGLSLDYVNNRIYW--ADAREDYIQFADMDGANRHTVVSEDIPHIFALSLFEDHVYWTDWETKTVNRAHKSTGAD-------RTTLISTLHRPMDLHVYHPFRQPDVPNHPCKVNNGGCSNLCLISPGGQYKCACPTNFYLASDGRTCLSNCTASRFV 3309          

HSP 10 Score: 56.6102 bits (135), Expect = 7.183e-8
Identity = 39/104 (37.50%), Postives = 55/104 (52.88%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCN----TCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQKFECLS---GKDVTRCLPISARCNGIVDCRDGSDE 4712
            C+ ++ RCD   DC+D SDE  C+    TC+ +  +SC  +  C+  T  CDG  DC+  SDE+ C +   +  S     D + CL     C+G  DC DGSDE
Sbjct: 1048 CIPLRWRCDGDTDCIDTSDEKECDGVVRTCDPTLQFSCRDTGRCISKTWFCDGDNDCEDNSDEEGCETMLCKPPSHSCANDSSICLSPKKLCDGHSDCPDGSDE 1151          

HSP 11 Score: 55.8398 bits (133), Expect = 1.198e-7
Identity = 39/104 (37.50%), Postives = 54/104 (51.92%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGS-------QKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            C++ + RCD   DC DGSDE  C+       + C R+  C+P   RCD  +DC   SDE  C +        +F+C    + T C P+S +C+G  DC D SDE
Sbjct: 3556 CIAGRWRCDGDHDCSDGSDEKDCSPRCDHDQFQC-RNGHCIPQRWRCDADIDCIDGSDEDNCAAIVRTCPHHEFQC----NNTLCKPLSWKCDGEDDCGDNSDE 3654          

HSP 12 Score: 55.4546 bits (132), Expect = 1.705e-7
Identity = 41/106 (38.68%), Postives = 56/106 (52.83%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQ----KFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C+  + +CD   DC D SDE GC    C+ S  +SC+    C+    RCDG  DC   SDE+ C  +    +F+C +G     C+P   RC+  +DC DGSDE  C
Sbjct: 3517 CVPGRWQCDYDNDCGDNSDEEGCTPRPCSESE-FSCANG-RCIAGRWRCDGDHDCSDGSDEKDCSPRCDHDQFQCRNG----HCIPQRWRCDADIDCIDGSDEDNC 3616          

HSP 13 Score: 54.6842 bits (130), Expect = 2.868e-7
Identity = 47/169 (27.81%), Postives = 77/169 (45.56%), Query Frame = 3
Query:  234 TANF----SKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWL------QIGAIMVLERSRLDGSDRRVI--HKSILFKSSQLAIDRHRKMLFWWG----------LDGEIHRVDYQGQ 674
            T NF     K+D  +   +LK  + + E +AVDW+  NLYW D   + I V  L   S      + RR L+  NM    ++ VDP   +++W       +      +E + +DG+ R +    K++L+ +  L++D    +L+W            LDG   +V Y GQ
Sbjct:  556 TTNFLVARQKIDGTERETILKTNINNVEGIAVDWMGYNLYWTDDGLKTINVARLEKAS------QARRTLIEGNMTHPRAIAVDPVHGFMYWTDWEEDPKGTKRGKIEHAWMDGTHRSIFVSSKTVLWPNG-LSLDIPNGILYWCDAYFDQIERIKLDGTERKVVYDGQ 717          

HSP 14 Score: 53.9138 bits (128), Expect = 5.336e-7
Identity = 69/305 (22.62%), Postives = 115/305 (37.70%), Query Frame = 3
Query:  918 VCSSICLPIVDSAYRCSCSTGITEPINNAVC-----PTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAY-----------DSVTSSLLYV-------DFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ--KFQEFISLSYFDNFIYWTELE 1757
             CS  CL   D +Y CSC  G     ++  C     P     +L I N   +    L+G + P L  ++        F+Y           DS T S L+         F+   + ++ LN +   Q               +A+D  + N Y+M+  +  ++V        +    L L            Y     P  +A+D     LF T        +ER  +DG     ++ S   F P G+ALD   + +Y+ D     +  V+Y G ++R + Q    +    LS F+N++Y T ++
Sbjct:  137 TCSQNCLN-TDGSYSCSCVEGYLLQPDSKSCKAKNDPVDRPAALLIANSQNVVATYLNGSIVPGLTPVATRQASAMDFSYSEEMACWVNVGDSPTESRLHCARLAGLKGFSGERVINISLNVHHVEQ---------------MAIDWLTGNFYFMDDVDDRIFVCNKQGDTCVTLLDLEL------------YN----PKAIALDPTMGKLFFTDYGQIP-KVERCDMDGGNCSKLVDSKIVF-PHGIALDLVSRLVYWADAYLDYIEVVDYEGRNRRTIIQGPSVEHLFGLSVFENYLYATSID 407          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Sea Lamprey
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 122.094 bits (305), Expect = 1.038e-27
Identity = 179/813 (22.02%), Postives = 328/813 (40.34%), Query Frame = 3
Query:  303 ESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWE--QYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMR--VQGTWKQWSPTFLTFTEGKLVFINDEQ----LWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICL--PIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGT---CSIERYWLDGTQKFTVISSTN----DFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGS----MRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHL--TPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAA----NCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWR-GVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKW 2657
            E++AVDW+  NLYW D   + IEV  L+           R +L+S N+ +   LV+DP +  + +FW   G    +ER+ +DG  RR I  S L+  + LAID    +L++   D  +  +D+    G + R  +        P  +T  E   V+  D      +  + +  G   ++         P+ +++  H +  P     +PC+ + CS +CL  PI    Y C+C +G     +   C       L +     I+ +SLD   Q   + +   +GI   +  D   +  +Y   N  SI  +  +  GT +  +    I    P  +A+D  SRN+Y+ N R+  + V ++      +   +  + Q +             P  +A+D     L+ T     +     +    +DG+   TV+ S N    DF    + LD   Q+LY+     G +   +  G ++  + Q       ++  ++ +Y+T+ +   +  V  DGS    MRS +   + L           R+ S  T + C S +  C QLC P    Q   +CGCS    +  +   C      ++    S +   H+  T +++      G G + + V       +   +YW +  +      I +   +    + +    +    ++ +AVD++  NLY +   S+ + + + RL     D S+  V+  T +      AV   +  +FLFW +   +      ++ +A LDG+   ++   G+     L +D   ++V W      +I R       W
Sbjct: 1476 ENLAVDWIGKNLYWLDFVLETIEVSRLD--------GSHRTVLISTNVTNPRGLVLDPRDGSRTMFWTDWGKNPRIERAGMDGRLRRTIVSSKLYWPNGLAIDYATNLLYF--ADAYLDFIDFCDFNGQNRRQVLASDLILQHPHAITIFE-DFVYWTDRSTNRVMRANKWHGGNQSTMIYNLQ---QPMGLVA-SHSVRQPTA--TNPCLGQSCSHLCLLSPITPFFYSCACPSGWNLGPDGRTCQKEDRPFLIVVRSSIIFGISLDPN-QTSNDAMVPISGISNGYDVDFDDTQFIYWVENPGSIHRVKTD--GTNRTQFAPSAILG-APSGLAIDWISRNLYYTNPRSQTIEVIKMDGVQNYRKTIIGNNGQTTGVGY---------PVGIALDPSRGRLYWTDHGSDSGVPAKVAAADMDGSNP-TVLFSGNMDHVDF----ITLDMREQKLYWAVAGTGVIERGDVTGLNRITVVQHLSHPWGVAVHESHLYYTDYDYEVVERVGKDGSTPVLMRSNIPGLKCLKVHF-------RDTSSGTTNACSSGNGGCQQLCLPRPNAQR--ACGCSTGFQLAPDQISCRLYESFVIVSQLSAIRGFHINSTDHSEAMVPVAGTGRNALHVDVHMPSGF---LYWCDHGSASTYRGIRRIKPDGSGFQTVVSSGIGPSGVAGIAVDWVAGNLYFTNVFSSETHLEVQRL-----DTSFRRVLFKTSVDRPRHLAVDPRA--RFLFWVDAGQR-----PKIERAFLDGTNRSVVLDVGLLSPRSLTIDRATDWVYWADDGLDRIGRLAPDGSTW 2229          

HSP 2 Score: 105.916 bits (263), Expect = 9.390e-23
Identity = 227/1118 (20.30%), Postives = 408/1118 (36.49%), Query Frame = 3
Query:  951 SAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPP-LELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSIN--RYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR-ILAQK--FQEFISLSYFDNFIYWTELETLSI-HSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSE-MIVYFNKSMLITHHLTPN-TDKQYIELGKGES---DVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILG---AVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVAD-IDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVES--RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDA-VYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRE-----SRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI--PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTS-SMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLA 4223
             ++RC C  G T   +   C       + +  P +    S +    P  L  +  N        +D+    + + D     I+S   N  GT  R  +   +   +  ++AVD   +N+YW++     + V+R+   +R    T+L+S   +             P  L +D  +  R +F T        IER  +DG  + T++SS   +WP GLA+D     LYF D     +   +++G ++R +LA     Q   +++ F++F+YWT+  T  +  + K+ G  +S  T   NL  + M ++A          +PC   S  C  LC         +SC C +  ++  +   C       ++    S++    L PN T    +    G S   DV     Q       IYW+    + I +  ++   + Q     +     S LA+D+I  NLY   T+     I +I++       ++   ++    +   +G    +++      L+W +  + D    A++  A +DGS P +++ G  D +D + +D +   + W  + +G I R ++                               +R   +      + V + +S    T      +  VG          + RS     K + +   D  + +   C + N      C Q CLP  +  R CGC + + L+ D  +C      ++V     ++  IRG  +N  D     V         ++         +YW          ++G  S       Y  I++          IK D S  + +            S  I P     +  DWV G +    + + +  +E   +  +FR      S  RP  +A+ P +  L W+ A              +  IE + LDG  RSV++ + G+  P  LT+D  +  +YW D   +++  L      +Q+                 +  G G+     + +    L W D   +     S      P     +   NL  L+D      R+    APE         L+  +PC      + N  C   C +   ++ A
Sbjct: 1372 GSFRCHCDLGYTMESDRRTCKANDRHEVLLLVPSRSQIYSDNITATPNVLSSVVRNGRSIVAVDFDARAGRIYWADVAEDKIWSALRN--GT-DRQLVHKQVGLTVTENLAVDWIGKNLYWLDFVLETIEVSRLDGSHR----TVLISTNVTN------------PRGLVLDPRDGSRTMFWTDWGKNP-RIERAGMDGRLRRTIVSSKL-YWPNGLAIDYATNLLYFADAYLDFIDFCDFNGQNRRQVLASDLILQHPHAITIFEDFVYWTDRSTNRVMRANKWHGGNQS--TMIYNL-QQPMGLVASHSVRQPTATNPCLGQS--CSHLCLLSPITPFFYSCACPSGWNLGPDGRTCQKEDRPFLIVVRSSIIFGISLDPNQTSNDAMVPISGISNGYDVDFDDTQF------IYWVENPGS-IHRVKTDGTNRTQFAPSAILG-APSGLAIDWISRNLY--YTNPRSQTIEVIKMDGVQ---NYRKTIIGNNGQTTGVGYPVGIALDPSRGRLYWTDHGS-DSGVPAKVAAADMDGSNPTVLFSGNMDHVDFITLDMREQKLYWAVAGTGVIERGDVTGL----------------------------NRITVVQHLSHPWGVAVHESHLYYTDYDYEVVERVGKDGST---PVLMRSNIPGLKCLKVHFRDTSSGTTNACSSGNG----GCQQLCLPRPNAQRACGCSTGFQLAPDQISCRLYESFVIV----SQLSAIRGFHINSTDHSEAMVPVAGTGRNALHVDVHMPSGFLYWC---------DHGSAST------YRGIRR----------IKPDGSGFQTV-----------VSSGIGPSGVAGIAVDWVAGNLYFTNVFSSETHLEVQRLDTSFRRVLFKTSVDRPRHLAVDPRARFLFWVDAG------------QRPKIERAFLDGTNRSVVL-DVGLLSPRSLTIDRATDWVYWADDGLDRIGRLAPDGSTWQV-----------------VREGRGYPAPYGLAIYGSNLIWVDRNLRKVLQASKEPQASPPPPEVIR-DNLGTLRDVTIFDPRVQP-TAPE---------LINFNPC-----RLNNGGCQQFCFALPSVTTA 2328          

HSP 3 Score: 99.3673 bits (246), Expect = 8.969e-21
Identity = 146/602 (24.25%), Postives = 239/602 (39.70%), Query Frame = 3
Query:  249 KLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDP--WEQYLF---WLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICL-----PIVDSAYRCSCSTGITEPINNAVCPTFP-TRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFA---YDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPV--SIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALD---EYRQQLYFVDTVKGDMISVNYHGGSKRILAQ--KFQEFISLSYFDNFIYWTELETLSIHSV-KFDGS----MRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGC 1967
             +D   +  VL   +   E++AVDW+S  LY  +     I+V DLN           R  L++ N+     + +DP   +  +F   W        LER+ +DG++R  + ++ L   + + +D   + +FW  +D     I  V Y G    ++ + G      P  +T  E  + F +  ++ V+      G  + +    NI P  +I   H L  P+ R      N  C  IC+       V   YRC C  G     +   C  FP T+ L       +  + L+   Q   +++    G P  F    +D+ +  ++  D +   IF  +L+  G   R  L    S D+    S+A D  S+N+YW + RN  V V R+   +R    + L                 Q P  + V  +  Y+F +        I R W DG+   T I +T+  WP GLA+D    +  +LY+VD     +   N++G +++ L +        S+S    F Y+++    SI  V K DG     +R  +    N+       I    NA     +P    +  C   CFP         CGC
Sbjct:  424 NMDTLAVETVLSVALDMPENLAVDWISNKLYIVESSVDRIDVTDLN--------GANRLTLIAENLGRPRGIALDPTVGKGSIFFSDWDDASGNPRLERAYMDGTNRLALVRTKLGWPAGITLDFVLQRVFW--VDNRFDYIESVTYDGLIRKTI-LSGGANVPHPFDITTFEHYVYFTDWTRMEVTRVNVFNGSDLQVVHRSNIQPYGVIV-HHSLRQPQVRNPCGPNNGGCEQICVLSHRTDNVGLGYRCKCRVGFDLQPDGLRC--FPVTKFLLFSAMTSVRGIPLNQSQQE--DVILPVMGSPVTFVGIDFDAASQRVIVSDTSQGKIFQQNLDGTG---RVNL---TSRDVSSVESLAYDWVSKNLYWTDTRNRAVTVMRLIDQSRRNILSNL-----------------QNPRSIVVHPLQGYIFYSDWNRPA-KIVRAWCDGSHA-TPIVNTSLGWPNGLAIDWQSPWNPKLYWVDAFFDRIEFSNFNGQNRQRLDRISHLAHPFSISIHGGFAYFSDWRLNSIVRVQKMDGGEAVIIRQGIQYLMNVKVYDTD-IQTGSNACNRPANP----NGDCSHFCFPAPSGAR--VCGC 977          

HSP 4 Score: 96.6709 bits (239), Expect = 5.273e-20
Identity = 132/563 (23.45%), Postives = 225/563 (39.96%), Query Frame = 3
Query:  306 SVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQW-SPTFLTFTEGKLVFI--NDEQLWVSSFECGTGISIALKTNPNIAP---IAIISRKHQLMVPRGRRKSPCM--NRVCSSIC--LPIVDSAYRCSCSTGITEPINNAVCPTFPTRS-LFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIF---SLDLNKYGTPQRFYLDFP----ISSDI--PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIH-SVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFP 1931
             +AVDWV+GNLY+ +  +    +    +D+ F      RR+L   ++     L VDP  ++LFW+  G    +ER+ LDG++R V+    L     L IDR    ++W   D  + R+      G + +V    + + +P  L      L+++  N  ++  +S E             N+     + I   + Q   P     +PC   N  C   C  LP V +A  C+C+ G  E  ++ V    P+   L       I  M LD           E+  +P   A  S  +  L  D     ++   S+ L +                I+SD+  P  IA D  +R IY+ ++ N  +    +   NR   A +     P P               + +D    Y++ T  +     IER  L G  +  +I+S+   WP GL LD     LY+ D  +  +      G  + ++        +L+  +  +YWT+  T S++ + K DG+ +  V   +NL  R M +  ++ +      +PC   +  C  +C P
Sbjct: 2110 GIAVDWVAGNLYFTNVFSSETHLEVQRLDTSF------RRVLFKTSVDRPRHLAVDPRARFLFWVDAGQRPKIERAFLDGTNRSVVLDVGLLSPRSLTIDRATDWVYW--ADDGLDRIGRLAPDGSTWQVVREGRGYPAPYGLAIYGSNLIWVDRNLRKVLQASKEPQASPPPPEVIRDNLGTLRDVTIFDPRVQPTAPELINFNPCRLNNGGCQQFCFALPSVTTA-TCACAHG--ELGSDRVSCVMPSDEYLMFVTEDSIRSMRLD----------PEDHSLPIPTAQVSRVAVALDFDIADGRVYFTQSMGLARSRISFFSLSSPSSVTVIASDLGSPDGIAFDWINRRIYYSDYANQTIGSMGLDGGNRTVVALV-----PRPRA-------------IMLDPCKGYMYWTDWSVNA-KIERATLGGNFRVPIINSSL-VWPNGLTLDYSENMLYWADAYRQKIERSTLTGDRREVIVSMAVYPFALTIHEQHVYWTDWNTKSVYRATKDDGADQ--VVMIQNLPYRPMDIHILTASKQQRCSNPCNQFNGGCSHICVP 2629          

HSP 5 Score: 81.6481 bits (200), Expect = 1.855e-15
Identity = 93/360 (25.83%), Postives = 143/360 (39.72%), Query Frame = 3
Query:  915 RVCSSICLPIVDSAYRCSCSTGITEPINNAVC--PTFPTRSLFIGNPPKIYHMSLDG-GLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR-ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKT--RNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSN 1973
            +VCS +C     S Y C C+ G     N   C   +     L   N   + +M++ G    P L+ L+    + F    D V   L +VD+   +I  + LN+ G       D P     P  +A+D   R +YW +     + VA +      +Y   LLS           Y    P G        R L+ T   + T  I R  +DG    +V+ ST   WP GL +D    ++++ D     +   N  G  +   LA       +L+ F++ I+WT+  T SI S  K+ G  R+++  T  R  D   + V    R    +  +PC S +  C  LC    G    F C C +
Sbjct: 3123 QVCSQLCENTAGS-YFCKCAPGYVRLPNGRTCRQNSGVEPYLIFSNRYYVRNMTVGGRSYTPILQNLTNAVALDF----DRVERRLYWVDYGQRTIERMFLNRTGLETVMKHDLPA----PEGLAIDWVGRKMYWADAVLDCLNVAELDG----RYRKKLLS---GCVDTNHTYCLENPRGVTLHPRFGRVLYWTDWGN-TPYIARVGMDGKNNKSVVISTKLEWPNGLTIDYTTDRIFWSDAHLNYIEYANLDGSHRHTTLAGSLPHVFALTVFEDTIFWTDWNTRSIESAHKYTGEGRTMLANTTHRPFD---IHVYHPYRQPP-EVPNPCGSNNGGCSHLCLVAAGGT-GFQCECPD 3460          

HSP 6 Score: 71.2478 bits (173), Expect = 3.094e-12
Identity = 50/138 (36.23%), Postives = 64/138 (46.38%), Query Frame = 3
Query: 4338 KSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNT-----CNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQKFECLSGK---DVTRCLPISARCNGIVDCRDGSDEHGC 4721
            +  +  C  YQ  C +G             C++   RCD   DC D SDEVGC T     C+ +  + C    +C+P    CDG  DCD  SDE   G     C +G    D   C+P S RC+G  DCRDG+DE  C
Sbjct: 1143 RGCVFNCTSYQFSCSSG-----------DQCIATYYRCDGAFDCRDRSDEVGCPTRAPGLCH-NDEFQCQSDGLCIPAGWECDGHPDCDDGSDEHP-GCPPRTCAAGYLRCDNGNCVPESWRCDGDNDCRDGTDERDC 1267          

HSP 7 Score: 68.5514 bits (166), Expect = 1.833e-11
Identity = 44/109 (40.37%), Postives = 56/109 (51.38%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQ--------KFECLSGKDVTRCLPISARCNGIVDCRDGSDEH-GC 4721
            C+     CD   DC+DG+DE GC     S+ +SCS  D C+    RCDG  DC   SDE  C ++        +F+C S      C+P    C+G  DC DGSDEH GC
Sbjct: 1123 CIDNAYVCDGDSDCVDGADERGCVFNCTSYQFSCSSGDQCIATYYRCDGAFDCRDRSDEVGCPTRAPGLCHNDEFQCQSDG---LCIPAGWECDGHPDCDDGSDEHPGC 1228          

HSP 8 Score: 61.2326 bits (147), Expect = 3.361e-9
Identity = 113/493 (22.92%), Postives = 180/493 (36.51%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSG---RIYWIDTKTNKLMYLHIHWDNYQI--RAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFY----NLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQL--DGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVK----CDRY--------QIPCGAGLVFSKKEGMSVMS--CMSVQQR---------------------------CDSTVDCLDGSDEVGCNTCNISHLYSCSRSD-VCLPITKRCDGVMDC--DSDEQ-C---CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            SLA D +S  L W+D     +   RL  D+ R   L  + N       P  I + P+   + +       S+ N  +   + W      DG+  + +V    G P+ L +D  S    ++YW+D   +++ + + +  N Q   R  H + H   +++        GF+           +++DW         +NS ++     G         +QYL         +  ++   D ++ S       + C+R ++   N  CSH C    P             ++L  DG+     P+       S  +   C   + V     CD Y        +  CG G V       +  +  C+ +  R                           CD+  DC DGSDE GC+     H       D  C+     CDG  DC   +DE+ C   C S +F C SG    +C+    RC+G  DCRD SDE GC
Sbjct:  762 SLAYDWVSKNLYWTDTRNRAVTVMRL-IDQSRRNILSNLQN-------PRSIVVHPLQGYIFY-------SDWNRPAKIVRAWC-----DGSHATPIVNTSLGWPNGLAIDWQSPWNPKLYWVDAFFDRIEFSNFNGQNRQRLDRISH-LAHPFSISIHG------GFA-----------YFSDW--------RLNSIVRVQKMDGGEAVIIRQGIQYL---------MNVKVYDTDIQTGS-------NACNRPANP--NGDCSHFCF---PAPSGARVCGCPYGKRLAEDGRMCADNPLEPPTPQCSSTEFFACANGRCVPRLFLCDGYDDCHDGSDERGCGTGNVTCSPYAFTCTNRRCIPIDWRPTRLATTCRADQFTCASGNRCIPRYWICDTDNDCGDGSDERGCDMSGTCHPMQFQCPDHRCIDNAYVCDGDSDCVDGADERGCVFNCTSYQFSCSSGD---QCIATYYRCDGAFDCRDRSDEVGC 1184          

HSP 9 Score: 60.8474 bits (146), Expect = 4.585e-9
Identity = 91/382 (23.82%), Postives = 144/382 (37.70%), Query Frame = 3
Query: 3687 LDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTV--DSLL-SNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKP--------SAAMGMHFYNLQYLKDKLKTVVR----------IMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDV------CLPITKRCDGVMDCD--SDEQCCG------SQKFECLSGKDVTRCLPISARCNGIVDCRDG--SDEHGC 4721
            LDG  R+V+   P  P  + +D   G +YW D   N  +           RA   +G N +V +   SL+  NG+    S     +  L+W D ++Q     ++  D +           A+ +H  ++ +     K+V R          +M +  P       + T  +   CS   ++  N  CSH+C+   P     E               C CP        +  K   C+     +C   Q  C  G             C+  + +CD+  +C DGSDE+      +   ++C  +D       C+    RCD   DC   SDE+ C       + +F C +G    RC+  S  CNG+ +CRD   SDE  C
Sbjct: 2456 LDGGNRTVVALVP-RPRAIMLDPCKGYMYWTDWSVNAKIE----------RA--TLGGNFRVPIINSSLVWPNGLTLDYS-----ENMLYWADAYRQKIERSTLTGDRREVIVSMAVYPFALTIHEQHVYWTDWNTKSVYRATKDDGADQVVMIQNLPYRPMDIHILTASKQQRCSNPCNQF-NGGCSHICV---PGPSGVE---------------CQCPAQGRWYLANGGKD--CINDSGQQCGTSQFTCLNG------------RCIPFRNKCDNRDNCRDGSDELE----RVCAFHTCEPTDFTCRNGRCVRYGYRCDHTNDCGDSSDEEGCAFRTCDPAAEFACTNG----RCIARSQVCNGVNNCRDNATSDEQRC 2778          

HSP 10 Score: 60.4622 bits (145), Expect = 5.514e-9
Identity = 43/137 (31.39%), Postives = 65/137 (47.45%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEV--GC--NTCNISHLYSCSRSDVCLPITKRCDGVMDC-----DSDEQC-------CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNN 4790
            C+    +CD   DC DGSDE    C    CN    + C  ++ C+   + C+ V DC     ++ ++C       C  ++F+C SG    RC+P++A CN   +CRD +DE GCN+         +      NLP N
Sbjct: 3819 CIPPSWKCDGDNDCGDGSDEELHHCLDTPCNPPGRFRCD-NNRCIYSHEICNAVDDCGDGSDETPDKCKEPTFAPCTEEEFKCASG----RCIPMAAVCNNYNECRDNTDETGCNQGQDRTCAERICEQNCTNLPGN 3950          

HSP 11 Score: 60.077 bits (144), Expect = 6.150e-9
Identity = 59/246 (23.98%), Postives = 105/246 (42.68%), Query Frame = 3
Query: 1266 PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTC--SIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQ-QLYFVDTVKGDMISVNYHGGSKR-ILAQKFQEFISLSYFDNFIYWTELETLSI-HSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVL 1988
            P  IAVD   R+IYW + + S + VA +    R +    +L               ++P    A  ++N  L +   TD      IE  W+DG Q+  ++      WP GLA+D     ++Y+ D  +  + SV   GG +R +++       +L  F++ +YWT  ET  +    KF   ++S +    +  ++    +      +++  +PC  T   C  LC  +R     ++C C   A  +
Sbjct: 4109 PDGIAVDWVGRHIYWTDAQTSRIEVALLDGRYRKQLINSVL---------------DKP----ATIALNPKLGMMYWTDWGVVPKIEMAWMDGQQRQHLVQGLLG-WPTGLAVDHTNNGRIYWCDAKENVIESVRPDGGDRRTVISGDLGNPFTLDVFESNVYWTTRETGQVWQQNKFGSGVKSHILTVNSWLSQAR--VFQKHRYNVNVKNPCKGT---CSHLCL-LR--PQGYTCACPQNAQFI 4326          

HSP 12 Score: 57.3806 bits (137), Expect = 4.345e-8
Identity = 48/127 (37.80%), Postives = 56/127 (44.09%), Query Frame = 3
Query: 4377 CGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC----DSDEQCCGSQKFECLSG---KDVTRCLPISARCNGIVDCRDGSDEHGCNRN 4730
            C AG  F+   G+ V S    + RCD   DC DGSDE GC   TC   + ++C     C+P    CDG  DC    D D   C      C  G        C+ I   CN   DC DGSDE GC  N
Sbjct: 2955 CTAG-EFACDNGLCVHS----RYRCDRRNDCGDGSDERGCTYPTCR-QNQFTCENG-RCIPRIFACDGDNDCGDGSDEDTHLCHQPSPTCAPGFFRCGAGECVAIHLVCNQANDCADGSDEKGCGIN 3074          

HSP 13 Score: 56.6102 bits (135), Expect = 8.290e-8
Identity = 44/131 (33.59%), Postives = 56/131 (42.75%), Query Frame = 3
Query: 4356 CDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHL-YSCSRSDVCLPITKRCDGVMDC----DSDEQC----CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            CD  Q  CG+G            +C+     CDS  DC D SDE GC+    + L + C   + C+     CDG  DC    D  + C    C S  F C SG     C+  + RC+   DC D SDE  C
Sbjct:    1 CDSGQFRCGSG------------ACIPRSWVCDSINDCSDDSDERGCSPATCTTLQFRCRSDNRCIARAFVCDGEADCADRSDEHQNCPGSTCSSSHFTCASG----HCVQSAFRCDHFQDCDDRSDEQSC 115          

HSP 14 Score: 55.4546 bits (132), Expect = 1.871e-7
Identity = 104/490 (21.22%), Postives = 171/490 (34.90%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVI-INFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDG-NRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDW-FQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSL------GTLLQNHPCS---RASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRC--------SCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAG----LVFSKKEGMSVMSCMS-----VQQRCDSTVDCLDGSDE----VGCNTCNISHLYSCSRS-----------------------DVCLPITKRCDGVMDCDSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
             LAID +   + W+D V   +    L+    +    G +  N       P  + + P    +++ + D+  +           +I    +DG N +SV++      P+ LT+D  + RI+W D   N + Y ++             G +   T+   L +       ++ V +  +FWTDW  + I ++     + +   A   H     ++    +    +       +   S L      GT  Q   C     A H     RC   C ST      ++   +    + DG+  C        +CP       + + + G C  S L+       P G+     L F+ +   +   CM+         CD   DC DGSDE        TC     + C+                         D C+  + RCD               +F C +     RC+P  A CNG+ DCRD SDE GC
Sbjct: 3236 GLAIDWVGRKMYWADAVLDCLNVAELDGRYRKKLLSGCVDTNHTYCLENPRGVTLHPRFGRVLYWT-DWGNTP----------YIARVGMDGKNNKSVVISTKLEWPNGLTIDYTTDRIFWSDAHLNYIEYANLD------------GSHRHTTLAGSLPH-----VFALTVFEDTIFWTDWNTRSIESAHKYTGEGRTMLANTTHRPFDIHVYHPYRQPPEVPNPCGSNNGGCSHLCLVAAGGTGFQCE-CPDDFAAIHVGTTVRCLARCTSTQ-FRCQDDERCIPIWWKCDGQRDCRDASDEPATCPHRYCPIGRFQCRDGNCTSSNLLCNGNNNCPDGSDEEDTLCFNHRCNSNQWQCMNKRCIPAAWLCDGGPDCQDGSDEDSATCAARTCAPGQ-FRCNNGRCIPRSWVCDVDDDCGDGSDEPHDTCMGPSHRCDS------------HTEFACRTNY---RCIPTWAVCNGMDDCRDNSDEQGC 3679          

HSP 15 Score: 53.5286 bits (127), Expect = 7.407e-7
Identity = 52/229 (22.71%), Postives = 102/229 (44.54%), Query Frame = 3
Query:  291 VQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDE--QLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSC 971
            +   + +AVDWV  ++YW D +   IEV  L+           R+ L++  +    ++ ++P    ++W   G +  +E + +DG  R+ + + +L   + LA+D       +W  D + + ++     G   R   +    +P  L   E  + +   E  Q+W  + + G+G+   + T  +    A + +KH+  V     K+PC    CS +CL +    Y C+C
Sbjct: 4106 ISQPDGIAVDWVGRHIYWTDAQTSRIEVALLD--------GRYRKQLINSVLDKPATIALNPKLGMMYWTDWGVVPKIEMAWMDGQQRQHLVQGLLGWPTGLAVDHTNNGRIYW-CDAKENVIESVRPDGGDRRTVISGDLGNPFTLDVFESNVYWTTRETGQVWQQN-KFGSGVKSHILTVNSWLSQARVFQKHRYNV---NVKNPCKG-TCSHLCL-LRPQGYTCAC 4319          

HSP 16 Score: 51.9878 bits (123), Expect = 2.150e-6
Identity = 42/118 (35.59%), Postives = 56/118 (47.46%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDE-VGC--NTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQKFECLSGK-----DVTRCLPISARCNGIVDCRDGSD------EHGCNRNN 4733
            C+     CD   DC DGSDE  GC   TC   +L  C   + C+P + RCDG  DC   +DE+ C +  + C S       +   C+ +   C+G  DC DG D      EH C+ NN
Sbjct: 1205 CIPAGWECDGHPDCDDGSDEHPGCPPRTCAAGYL-RCDNGN-CVPESWRCDGDNDCRDGTDERDCPTPPYRCQSPSQWLCPNHRACVDLRKVCDGNFDCPDGGDESPHCNEHDCSVNN 1320          

HSP 17 Score: 50.0618 bits (118), Expect = 6.618e-6
Identity = 49/147 (33.33%), Postives = 63/147 (42.86%), Query Frame = 3
Query: 4353 KCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRC------------DSTVDCLDGSDEVGC--NTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQ----------KFECLSGKDVTRCLPISARCNGIVDCRDGSDEH 4715
            +CDRY   CG G   S +   +   C   + RC            +   DC D SDE  C   TC +   + C  S  C+P   +CDG  DC   SDE  C ++           FEC    D   C+P S +C+G  DC DGSDE 
Sbjct: 3703 RCDRYD-DCGDG---SDERNCAPRPCSESEFRCTNQRCIPGRWVCNHENDCGDNSDERDCELQTC-LPGYFQCG-SGHCIPERLKCDGSADCQDFSDESLCPTRYPNGTWCPPSSFEC----DNHVCIPPSWKCDGDNDCGDGSDEE 3839          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009373.1 (pep scaffold:Pmarinus_7.0:GL477430:65055:99670:-1 gene:ENSPMAG00000008463.1 transcript:ENSPMAT00000009373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 2.060e-19
Identity = 117/471 (24.84%), Postives = 197/471 (41.83%), Query Frame = 3
Query:  297 SAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQ---LWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPC--MNRVCSSICLPIVDSA-YRCSCSTGITEPINNAVCPTF----PTRSLFIGNPPKIYHMSLD----GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISV 1658
            S + +A DW+   LYW D +   +E+ +L+           R++L+ +++    ++ + P + +++W   G +  +ER+ +DG+ R V+    ++  + L +D     L+W   D +   IHR +  G    S R           F     G  ++  D Q   +     E G      L    +   I I S + Q   P G   SPC   N  CS +CL   +   Y C+C TG+    NN  C       P   L +     +  +SLD      +  PLE +     + F      V     + D N+ +I    L+  G+     +   I    P  IAVD  +RN+YW +     + VAR+   +R     +L+S                 P  + +D +  Y++ +   +    IER +LDGT++ +V+ +T+  WP GLALD    ++Y+ D  K D I V
Sbjct:  129 SPDGLACDWLGRKLYWTDSETNRVELAELD--------GSHRKVLVWQDLDQPRAIALHPAQGFMYWTDWGEVPKIERAGMDGTSRSVLIVDNIYWPNGLTLDYDSGKLYW--ADAKLNYIHRCNLDG----SFRQDVIAGNLPHPFALTVFGDTLYWTDWQTRSIQACHKETGERRQEILSNIYSPMDIHIYSAQRQ---PAG--SSPCDRDNGGCSHLCLLSPNKPFYSCACPTGVRLLDNNKTCRNVRHVGPAELLLLARRTDLRTISLDTPDFTAVMLPLEGVRHAIALDFHPGGGHV----YWTDDNAQTIRRARLD--GSASEVLVSLEIEH--PDGIAVDWVARNLYWTDTGTDRIEVARLDGSSR----RVLVS------------DGLDEPRAIVLDPMAGYMYWSDWGE-LPKIERAYLDGTER-SVLVNTSLGWPNGLALDYSEGKIYWGD-AKTDKIEV 553          

HSP 2 Score: 89.3521 bits (220), Expect = 4.105e-18
Identity = 103/462 (22.29%), Postives = 191/462 (41.34%), Query Frame = 3
Query: 1266 PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR-ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSY-----SSEMIVYFNKSMLITHHL-TPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            P  +A D   R +YW +   + V +A +   +R      +L WQ            +QP   +A+     +++ T   +    IER  +DGT + +V+   N +WP GL LD    +LY+ D     +   N  G  ++ ++A       +L+ F + +YWT+ +T SI +   +   R     +       + + +  R  +    SPC   +  C  LC  +  N+  +SC C     +L N   C        +E+++   ++ L T  L TP+     + L   E      +L        +YW +  A  I +  +  D      +  L  +    +AVD++  NLY + T +   RI + RL     D S   V+VS  +      A+ +     +++W      D   + ++ +A+LDG++  +L+   +   + L +D     + W  + + KI
Sbjct:  130 PDGLACDWLGRKLYWTDSETNRVELAELDGSHRK-----VLVWQ----------DLDQPRA-IALHPAQGFMYWTDWGE-VPKIERAGMDGTSR-SVLIVDNIYWPNGLTLDYDSGKLYWADAKLNYIHRCNLDGSFRQDVIAGNLPHPFALTVFGDTLYWTDWQTRSIQACHKETGERRQEILSNIYSPMDIHIYSAQRQPA--GSSPCDRDNGGCSHLCL-LSPNKPFYSCACPTGVRLLDNNKTCRNVRHVGPAELLLLARRTDLRTISLDTPDFTAVMLPL---EGVRHAIALDFHPGGGHVYWTDDNAQTIRR--ARLDGSASEVLVSLEIEHPDGIAVDWVARNLYWTDTGT--DRIEVARL-----DGSSRRVLVSDGLDEP--RAIVLDPMAGYMYW-----SDWGELPKIERAYLDGTERSVLVNTSLGWPNGLALDYSEGKIYWGDAKTDKI 551          

HSP 3 Score: 66.2402 bits (160), Expect = 6.208e-11
Identity = 41/146 (28.08%), Postives = 78/146 (53.42%), Query Frame = 3
Query:  192 YVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFW 629
            +V+   +N +++ +    ++LD      ++   ++  + +AVDWV+ NLYW D     IEV  L+  S        RR+L+S  + +  ++V+DP   Y++W   G +  +ER+ LDG++R V+  + L   + LA+D     ++W
Sbjct:  410 HVYWTDDNAQTIRR----ARLDGSASEVLVSLEIEHPDGIAVDWVARNLYWTDTGTDRIEVARLDGSS--------RRVLVSDGLDEPRAIVLDPMAGYMYWSDWGELPKIERAYLDGTERSVLVNTSLGWPNGLALDYSEGKIYW 543          

HSP 4 Score: 50.0618 bits (118), Expect = 5.568e-6
Identity = 38/128 (29.69%), Postives = 57/128 (44.53%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQF-WIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKL 3800
             +A+D ++  L W+D  T  I   RL+    R+          +    P  I + P++  + W             S W +   IE + LDG  RSVLV    G P+ L +D   G+IYW D KT+K+
Sbjct:  444 GIAVDWVARNLYWTDTGTDRIEVARLDGSSRRVL-------VSDGLDEPRAIVLDPMAGYMYW-------------SDWGELPKIERAYLDGTERSVLVNTSLGWPNGLALDYSEGKIYWGDAKTDKI 551          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001145.1 (pep scaffold:Pmarinus_7.0:GL476464:197894:249856:-1 gene:ENSPMAG00000001025.1 transcript:ENSPMAT00000001145.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 2.287e-15
Identity = 117/523 (22.37%), Postives = 206/523 (39.39%), Query Frame = 3
Query:  222 SLLKTANFSKLDRRKMRDVL--KFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSD-RRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE-IHRVDYQGQT------------GCSM---RVQGTWKQWSPT-FLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYR-CSCSTGITEPINNAVCPTFPTRSLFI----GNPPKIYHMSLDGGLQP----PLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKY-GTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVT-----VITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRI 1685
             +L  A  S L     + V+   F +   + + +DW++GNLY  D+    I V D +              LL      I SL +DP    +F+   G    +ER  +DGS+  ++++  I +  + + +D    +++W  +  + +  VDY+G+             G ++    + G   ++S +  ++         ++ Q+   +   G          P +   A    +H      GRR        CS ICL       R C C  G     +   C T P   LF+      P  +  + + G +Q     P+E+L     + F  A         +V F  SS F +   K  GT +   L   + +     I+VD    NIYW + R   V VAR+ + ++        SW+   T       +   P  + VD    +++ T     + +  +  IER W+DGT +   +SS    W  GL+LD     LY+ D     + S++ +G ++++
Sbjct:  189 GVLHCATMSSLGAFSSKTVIGINFVIYGVKEIRIDWLTGNLYLLDESYNHIVVCDAS--------GAFCVKLLDLGSEAIRSLALDPISGNIFFTIFGRNSRIERCDMDGSNCTKLVYSKITYPQA-ITLDVIAHLVYWADISFDYVEAVDYEGRKRHIVCRHVDRLFGLTIFENYIYGISIKYSASEHMSLVRVDRFNSSEVQVLAHTARVGAVFVHHSSKQPTVHGHACEPDEH------GRRGG------CSDICLFSAGYKVRKCRCHRGFNLDSDGRSC-TKPKHELFLLYGKAFPGVVRGIDMTGSVQDDFMIPVEMLVNPRAVDFHAATG-------FVYFADSSQFLIGRQKIDGTAREVLLANNVKN--VEGISVDWMGGNIYWTDDRLKAVKVARLENASQ--------SWKTLVT------GEMVHPRSIVVDPSRGHMYWTDWEEDLKSSRSGKIERAWMDGTHREVFVSSKTMLWVNGLSLDSSAGVLYWCDAFFNHISSIDINGSNRKV 666          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Sea Lamprey
Match: sorl1 (sortilin-related receptor, L(DLR class) A repeats containing [Source:ZFIN;Acc:ZDB-GENE-050208-22])

HSP 1 Score: 73.559 bits (179), Expect = 4.459e-13
Identity = 117/461 (25.38%), Postives = 171/461 (37.09%), Query Frame = 3
Query: 3576 IAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI--PSCLTVDVHSGRIYWID---------------TKTNKLMYLHIHWDNYQIRAGHVI----------------GHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSC---PVS------MSVTHKSRHKI--GFCVKSQLVKCDRYQIPCG--------------AGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC----DSDEQC-----------------CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            + + P S+ L W+ A+                IE+S LDG  R V++ +  +  P  L +  + G ++W D                 +NK++  ++ W N     G  I                G N  V ++S L +       ++ V K  ++W DW                 + MG+   N +Y    ++T+V     I   D K    G   QN     A    +N  CSHLCL        +    + + QQ  G F C+    PVS        V  +S+ K   G C+ + L KCD  +  CG                  FS   G     C+    RCD   DC D SDEV C++   S    C  S  C+P    CDG  DC    D  +QC                 C S +F+C SG     C+ +  +C+G+ DC D SDE  C
Sbjct:  731 VVVDPNSNLLYWVDAEARH-------------IEVSRLDGTYRKVILNSTVLEKPRGLVLVPNKGIMFWTDWGEVNAGIGSSDMDGQHSNKIVNSNVRWPNGIAIDGETIYWTDAFYDRIERASLDGSNRVVLINSNLPH-----PYAIAVYKSDVYWDDW-----------------SRMGIMRAN-KYDGSGVQTLVNRAPGIM--DMKIFYSGK--QN----SAYRTDKNGGCSHLCLPKPNGRTCQCPDGMSSVQQSSGDFICNSRDPPVSDVRCGPELVCAESQFKCANGRCI-NILWKCDHDEDDCGDNSDEPADCPHQKCQATEFSCSNG----RCVRSAWRCDGDNDCHDWSDEVNCSS---SQGMECCPSGPCIPRRWLCDGDKDCLDGADEQQQCGTRPPAMWCSMLHQPINCTSSEFQCRSGV----CISLHWKCDGVDDCGDYSDEANC 1135          

HSP 2 Score: 60.077 bits (144), Expect = 5.663e-9
Identity = 45/118 (38.14%), Postives = 56/118 (47.46%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCS--------RSDVCLPITKRCDGVMDC--DSDEQCCGSQ----------KFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C+S+  +CD   DC D SDE  C       +  C+            C+     CDG  DC   SDE  C +Q          +F+CL  KD T C+P SARC+G  DC DGSDE GC
Sbjct: 1113 CISLHWKCDGVDDCGDYSDEANCREMPSPEVVCCTVMIGEFRCGDGTCIFDHFVCDGSPDCADGSDEYGCPTQHGRPSPCSFTQFQCL--KDKT-CVPASARCDGRKDCVDGSDELGC 1227          

HSP 3 Score: 60.077 bits (144), Expect = 6.592e-9
Identity = 41/120 (34.17%), Postives = 55/120 (45.83%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCLDGSDEVGCNT-------CNISHLYSCSRSDVCLPITKRCDGVMDC----------DSDEQ-------CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            +C+     CD + DC DGSDE GC T       C+ +  + C +   C+P + RCDG  DC          DS  Q        CG  +F C+ G   + CL     C+G  DC+D SDE
Sbjct: 1159 TCIFDHFVCDGSPDCADGSDEYGCPTQHGRPSPCSFTQ-FQCLKDKTCVPASARCDGRKDCVDGSDELGCYDSGSQLCYSMPGVCGENQFACVDG---SGCLEHFMLCDGYHDCQDRSDE 1274          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Nematostella
Match: EDO49133 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGY8])

HSP 1 Score: 214.157 bits (544), Expect = 1.168e-55
Identity = 346/1523 (22.72%), Postives = 581/1523 (38.15%), Query Frame = 3
Query:  273 DVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRV---DYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNI-APIAI--ISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFA--YDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLS---WQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDG-SMRSLVTKTRNLDARTMPVIAVSRNASIDTGS-PCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNT---DKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCL--PVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRT-RPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKN-PGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQK---FECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTL 4757
            DV+   ++  E +AVDW S  LYW D + +   +   N+D  F      R++L   N+    ++ VDP   Y+FW   G    +ER+ +DG+ R VI    +F  + L ID + K ++W   D + H +   D+ G+   ++ ++GT     P  ++    KL + +     + S    TG    LK   N+ +P+ I    +  Q  +P+G       N  CS +CL +      C+C TG+   ++N  C   P   L +     +  +SLD       +++    GI    A  +D +   + + D     I    ++  G      ++       P  IAVD  +RN+YW +     + V+R++  +R     +L+S   W+P                 + VD    +++ T   +    IER  LDG  +  +++S+   WP GL +D    ++Y+ D  K D I V    GS R  +L    +    L+   N++YWT+ E  +I SV KF G   RS+V +  +L      + A+  N SI  GS PC + +  C  LC           CGC N   ++ +   C      +++     +  H ++ +T    K    +G  E++    S++      +IYW +     I +   N     +L I  L  +    LAVD+I  NLY   T S   +I + RL   H        V     ++  L  V+ H     L+W           + + +A++DGS    +   V    ++ +D +   + W  S+   I   ++  R                   +      P + + YL   D IY       S          I     + G+      SR   +    +  +    G     +C  +N      CS  CL  P + + C C   + L +D  TC +    ++  T    + GI   I +  D       + E+S  P+          Y +S   V       +I AV+ T R  +       + V   D++                    Y LAIDP    + W+D V   I    L     ++  LGV+ + ++    P  I + P    + W   D  K+            I  + +DG+    +V N P  P  L VD    ++YW DT   K+ +  +             G    V VD+ L   +G     + +   +++W D   ++   +           +G     +Q   D    V    ++I+         GT+   HPC +         CSH+CL                    D   +CSC  S+ +    ++    C   +   C    I C +         M  + C+    RCD  +DC D SDE  C  C   + + C     C+    RCD   +C   SDE  C + +   F C +GK    C+    +C+ + DC D SDE GC+     R ++++
Sbjct:   90 DVISVGLKRPEGLAVDWCSKKLYWTDSEVETNRIEVSNMDGRF------RKVLFWENLGQPRAIAVDPASGYMFWTDWGEEPKIERAGMDGTQRTVIVSKDIFWPNGLTIDHNDKRIYW--TDAKQHHIATTDFNGKEKRTI-IRGTLPH--PFAVSLYGNKLYWTDWTTKSIHSCNKKTGFG-RLKLQSNVYSPMGIHVFEKARQDPLPKG---CGLNNGGCSHLCL-LSPQGISCACPTGVRLLLDNKTCENGPKHFLLLARRTDLRRISLDTPDH--TDVVLPFVGIKHGIAVDFDPIEEYIYWSDDTLQVIKRAHIDGKGVETVASVEV----QNPEGIAVDWIARNLYWTDTGMDRIEVSRLNGTSR----KILISEDLWEPRA---------------IVVDPGKGHMYWTDWGEHP-KIERADLDGGNRIILVNSSVT-WPNGLTIDYSDNKIYWAD-AKLDKIEVMDVDGSNRRVVLDSNIRHVFGLTLLGNYLYWTDWERRNIDSVNKFTGREKRSVVEQLPDLQG----LKAI--NMSITYGSNPCQTNNGGCSHLCL---YRPAGVVCGCPNGMELIKDQLTCIVPRAFLLFSGSHDI--HRISLDTYSGGKDIPLVGIKEANALDFSIE----EKRIYWTDITLKSINRAYLNGSNPEKLIIVDL--EYPDGLAVDWIAKNLYW--TDSRKHKIEVSRLDGQHRRTLLYKDVWEP--RSLTLDPVNGH-----LYWANGGQD-----SSIDRANMDGSNRTKVISNVKRPTDITIDYKEGLLFWADSERKVIECADLHGRN----------------RRTVAQATKPFALTQYL---DYIYWTDWETES----------IERANKTTGLNRTRIRSRVDYVMDITVFHSSRQEGWN---VCSMNNGG----CSHLCLARPNKQKTCACPMHFKLMSDNRTCQEPLSFMLYST----VKGIHRFIFDSTD-------YAEIS-LPLRKLHDVKAVSYDISTGFVY------WIDAVEGTIRRALENGSLSGVIVAGPDVEP-------------------YDLAIDPYGQQMFWTDAVRNEINVFSLK----KMAPLGVVASAKD--EMPRSIVLFPEKGLMFW--TDVGKNGPK---------ILRASMDGSFPQPIVSNIPRSPVGLAVDTDRDKLYWTDTAHKKIEFSDLQ------------GAKRTVLVDTNLLTPIG-----LAIHGDFVYWIDSRARVLKRV--------RREVGSDEQTIQAEIDVTDLVALDRSQIS---------GTV--PHPCKQND-------CSHICLI-----------------GRDNAAKCSCTGSLVLQDDEKN----C--GEPSTCKPNYISCAS---------MKAI-CIPKMWRCDGMLDCTDKSDEEDCPPCK-ENQFRCDNGQ-CIDGDPRCDKYKNCTDGSDELGCATCEPNFFRCNTGK----CISARWQCDQLDDCGDNSDEIGCDTPPGKRIVASI 1365          

HSP 2 Score: 147.517 bits (371), Expect = 2.603e-35
Identity = 187/811 (23.06%), Postives = 338/811 (41.68%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISI--ALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELG-KGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTIS-NLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDE----LVVDEQANYVCWKSSDSGKI 2627
            L+    + +D + +  V    VQ+ E +AVDW++ NLYW D     IEV  LN  S        R+IL+S ++ +  ++VVDP + +++W   G    +ER+ LDG +R ++  S +   + L ID     ++W   D ++ +++     G + RV           LT     L + + E+  + S    TG      ++  P++  +  I+    + +  G       N  CS +CL    +   C C  G+ E I + +    P   L       I+ +SLD   GG   PL  + E   + F          + + D    SI    LN    P++  +   +  + P  +AVD  ++N+YW + R  ++ V+R+   +R    TLL             Y+    P  L +D +N +L+       + SI+R  +DG+ +  VIS+     P  + +D     L++ D+ +  +   + HG ++R +AQ  + F    Y D +IYWT+ ET SI        +     ++R      + V   SR    +    C   +  C  LC   R N+   +C C     ++ +   C      ++Y +    I   +  +TD   I L  +   DV+  S  +      +YWI+     I +   N  +     +     D    +LA+D     ++   T +  + I +    F+   ++   VV S   K+++  ++ +  +   +FW +      +N  ++ +A +DGS P  I   V++I      L VD   + + W  +   KI
Sbjct:  383 LQVIKRAHIDGKGVETVASVEVQNPEGIAVDWIARNLYWTDTGMDRIEVSRLNGTS--------RKILISEDLWEPRAIVVDPGKGHMYWTDWGEHPKIERADLDGGNRIILVNSSVTWPNGLTIDYSDNKIYW--ADAKLDKIEVMDVDGSNRRVVLDSNIRHVFGLTLLGNYLYWTDWERRNIDSVNKFTGREKRSVVEQLPDLQGLKAIN----MSITYGSNPCQTNNGGCSHLCL-YRPAGVVCGCPNGM-ELIKDQLTCIVPRAFLLFSGSHDIHRISLDTYSGGKDIPLVGIKEANALDFSIE----EKRIYWTDITLKSINRAYLNG-SNPEKLII---VDLEYPDGLAVDWIAKNLYWTDSRKHKIEVSRLDGQHR---RTLL-------------YKDVWEPRSLTLDPVNGHLYWANGGQDS-SIDRANMDGSNRTKVISNVKR--PTDITIDYKEGLLFWADSERKVIECADLHGRNRRTVAQATKPFALTQYLD-YIYWTDWETESIERANKTTGLNRTRIRSRVDYVMDITVFHSSRQEGWNV---CSMNNGGCSHLCL-ARPNKQK-TCACPMHFKLMSDNRTCQEPLSFMLY-STVKGIHRFIFDSTDYAEISLPLRKLHDVKAVSYDIS--TGFVYWIDAVEGTIRRALENGSLS---GVIVAGPDVEPYDLAIDPYGQQMFW--TDAVRNEINV----FSLKKMAPLGVVASA--KDEMPRSIVLFPEKGLMFWTDVG----KNGPKILRASMDGSFPQPI---VSNIPRSPVGLAVDTDRDKLYWTDTAHKKI 1123          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Nematostella
Match: EDO48357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJD6])

HSP 1 Score: 129.413 bits (324), Expect = 3.529e-30
Identity = 180/826 (21.79%), Postives = 344/826 (41.65%), Query Frame = 3
Query:  231 KTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWW-GLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSF----ECGTGISIALKTNPNIAP--IAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNP--PKIYHMSLDGGLQPPLELLSENAGI-----PFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKR-ILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTG-----SPCYSTSNK---CDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQY---IELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            K    +++D   + D++   +   + +A++W +  +YW D+  +FI+V  L+          RR +L+S  +     + V P    +FW   G    +ER+RLDG  R+ I  S +   + +A+D     LFW   +   +   D  G+   ++  Q   + +  + L    GK V+ +D   W S        GTG       N    P  +A+  +  Q   P G       N  CS +CLP   +  +C+C        +N  C       + + +P  P IY + LD        + + N G+          YD     + ++D    +I    +N     Q     F + +  P S+A+D   R++YW +           +   R++ A L    Q +P         ++P G L +D  N ++F T        IE+  +DGT ++T++   +  WP  L +D   ++L++ D     +   +++G +++ +  ++      +++F + +YWT+ +T S+  +    S+ S V+K         P +   R  S   G        Y T N+   C  LCF   G    ++C C +   +  N   C  + E +++ + ++ ++ ++ P  D      + +  G++ VQ A L  D   + I+W +     I   + N   ++ + +   + +    + VD+I  NLY   T S   RI + RL     D +   V++   ++     A+ +  +   ++W +  T       ++  AH+DGS + +L+  G+     L +D +   + W    +GKI
Sbjct:   52 KAIKRAQIDGTFIEDIITTNIGVCDGLAIEWRTRRIYWTDRTYRFIQVATLD--------GSRRHVLISSGLDKPRGIAVHPQAGLMFWTDWGENPKIERARLDGQKRQEIVTSNIGWPNSIAVDYAANRLFWVDAIRDSLESSDLDGRARRTLFRQPGLQPFGVSIL----GKHVYWSD---WASEGIHMNRMGTGKLEKSVYNVGNMPMGVAVFDKSRQ---PPGNNTCSKQNGGCSYLCLPSA-TGTQCACPWESLLSSDNKSCAKGRI-FMLVSDPEIPAIYKIYLD--------VPNHNRGVLSVNETTDITYDHFEDRIYWIDGAQRNIHRAYMNMTEHEQ-----FGMYTVRPESLALDWLGRHLYWTD-----------AGTKRIEAAQLDTGIQ-APVIMAG---LDKPRG-LVLDPPNGHMFWTDWGS-KPKIEKSNMDGTSRWTLLDK-DLIWPNALTIDYQSKRLFWADAKLNRIEVCDWYGENRKPVFEKRGMHPFGMAFFGDKLYWTDYKTKSVQEL----SLSSGVSK---------PFV---RRLSFPRGLYVYDPSTYKTGNEYAGCSHLCFIRHG---GYTCACPSGYRLGRNRKTCIRAKEFLLFID-AIAVSLNILPLDDTNIWTPVSVLPGKA-VQPADLDYDPVEDAIFWTDTFTGTI--NSYNMQTRKSMTLHRCNVERPDGIGVDWIGRNLYW--TDSGKGRIEVSRL-----DGTARKVLIQDDLERPT--ALVLFPEEGRMYWADYGTN-----PKIMTAHMDGSNRKILMGVGINITTGLAIDFRFRRLYWCDMGTGKI 789          

HSP 2 Score: 89.3521 bits (220), Expect = 1.096e-17
Identity = 108/449 (24.05%), Postives = 170/449 (37.86%), Query Frame = 3
Query:  303 ESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRG-------RRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSL------DGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDF-PISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNR-------LKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTV---ITDGTCSIER----YWLD-GTQKFTVIS 1562
            ES+A+DW+  +LYW D   + IE   L+     P+            +     LV+DP   ++FW   G+   +E+S +DG+ R  +    L   + L ID   K LFW   D +++R++     G + +     +   P  + F   KL + + +   V      +G+S          P        +L  PRG         K+      CS +C  I    Y C+C +G     N   C       LFI        +SL      D  +  P+ +L   A  P    YD V  ++ + D      F+  +N Y    R  +     + + P  I VD   RN+YW +     + V+R+    R       L+  T L+ +        + Y  N       +D  NR + + V   IT G     R    YW D GT K   +S
Sbjct:  379 ESLALDWLGRHLYWTDAGTKRIEAAQLDTGIQAPVIMA--------GLDKPRGLVLDPPNGHMFWTDWGSKPKIEKSNMDGTSRWTLLDKDLIWPNALTIDYQSKRLFW--ADAKLNRIEVCDWYGENRKPVFEKRGMHPFGMAFFGDKLYWTDYKTKSVQELSLSSGVS---------KPFV-----RRLSFPRGLYVYDPSTYKTGNEYAGCSHLCF-IRHGGYTCACPSGYRLGRNRKTCIRAKEFLLFI----DAIAVSLNILPLDDTNIWTPVSVLPGKAVQPADLDYDPVEDAIFWTD-----TFTGTINSYNMQTRKSMTLHRCNVERPDGIGVDWIGRNLYWTDSGKGRIEVSRLDGTARKVLIQDDLERPTALVLFPEEGRMYWADYGTNPKIMTAHMDGSNRKILMGVGINITTGLAIDFRFRRLYWCDMGTGKIESMS 793          

HSP 3 Score: 56.225 bits (134), Expect = 1.233e-7
Identity = 49/192 (25.52%), Postives = 79/192 (41.15%), Query Frame = 3
Query: 3426 LAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLK-KYLFWTDWFQQIFASISVNS 3995
            L  DP+ D + W+D  TG I +  +   K    +       R +  RP  I +  I  +L W  +   +             IE+S LDG  R VL+++    P+ L +    GR+YW D  TN            +I   H+ G N K+    L+  G+  +T   +  + + L+W D       S+S+N 
Sbjct:  640 LDYDPVEDAIFWTDTFTGTINSYNMQTRKSMTLH-------RCNVERPDGIGVDWIGRNLYWTDSGKGR-------------IEVSRLDGTARKVLIQDDLERPTALVLFPEEGRMYWADYGTNP-----------KIMTAHMDGSNRKI----LMGVGINITTGLAIDFRFRRLYWCDMGTGKIESMSLNG 796          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Nematostella
Match: EDO49498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB0])

HSP 1 Score: 82.4185 bits (202), Expect = 1.160e-15
Identity = 79/341 (23.17%), Postives = 144/341 (42.23%), Query Frame = 3
Query:  912 NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCP--------------TFPTRSLFIGNPPKIYHMSLD-------GGLQPPLELLSENA----GIP----FRFAYDSVTSSL-LYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI-------PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRIL---AQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVT 1811
            N  C+ +C+ + +   +CSC  G T   +N  C                F TR  F     + Y +  D         ++P L   +       G+P    + FA   + +++ +  D+    ++  D+ K     R Y +     D+          +AVD   RN+YW + R+  + V+ +      K+  +LLS            +  + P  L +DS   YLF T        +ER WLDG+ +F +       WP GL LD   +++Y++D     ++S  Y G SKRI+   +++     +++ F++++YWT+ +   +  V K  G   +L++
Sbjct:  288 NGGCAQLCMDVPE-GVQCSCRPGFTLASDNKTCEDINECLNSSSCSQRCFNTRGSFSCKCVQGYRLEPDKRRCKAADSIRPFLYFSTRREIRKLGLPPSQSYTFAVRRLRNTIGIDFDWREKRLYWSDVYKK-VISRSYFNGTGREDLITDALITAEGVAVDWIGRNLYWSDMRSDRIEVSTLEG----KWRRVLLS------------EDVESPRGLVLDSNAGYLFWTDWGTSP-RVERSWLDGSNRFVISFGIKIVWPNGLTLDLATKRVYWIDAKLDHIVSCEYDGSSKRIVLSGSRQINHPFAMTLFEDYLYWTDWQNKHVLRVSKLHGENVTLLS 609          

HSP 2 Score: 62.7734 bits (151), Expect = 1.065e-9
Identity = 76/353 (21.53%), Postives = 144/353 (40.79%), Query Frame = 3
Query: 2967 HDNFLTCSQFCLPV-ESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAV----YWLSKNIVLRLD---NYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFS--KSETNDSSVWHQFW--------IEMSDLDGNRRSVLVKNPGI--PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQI--RAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDW 3959
            H N   C+Q C+ V E  +C C   ++L++D  TC D+++ L   + +      RG+           V+   L  +P     K  D++    Y+ ++  + +L    +  +  AV R R  + I         + D +    Y  ++YK   S+ +   +   D I+D L+ ++ V               ++++G  + + + R   ++++        + LS D    +    DS+  + FW        +E S LDG+ R V+     I  P+ LT+D+ + R+YWID K + ++       + +I       I H                   +M + + YL+WTDW
Sbjct:  285 HSNNGGCAQLCMDVPEGVQCSCRPGFTLASDNKTCEDINECLNSSSCSQRCFNTRGSF------SCKCVQGYRL--EPDKRRCKAADSIRPFLYFSTRREIRKLGLPPSQSYTFAVRRLRNTIGI---------DFDWREKRLYWSDVYKKVISRSYFNGTGREDLITDALITAEGVA--------------VDWIGRNLYWSDMRSDRIEVSTLEGKWRRVLLSEDVESPRGLVLDSNAGYLFWTDWGTSPRVERSWLDGSNRFVISFGIKIVWPNGLTLDLATKRVYWIDAKLDHIVSCEYDGSSKRIVLSGSRQINHPF-----------------AMTLFEDYLYWTDW 589          

HSP 3 Score: 62.3882 bits (150), Expect = 1.424e-9
Identity = 67/212 (31.60%), Postives = 101/212 (47.64%), Query Frame = 3
Query:  273 DVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSI-LFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRV--QGTWKQWSPTFLTFTEGKLVFI---NDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRG 890
            D++   + +AE VAVDW+  NLYW+D ++  IEV  L          + RR+LLS ++     LV+D    YLFW   G    +ERS LDGS+R VI   I +   + L +D   K ++W  +D ++  +      G S R+   G+ +   P  +T  E  L +    N   L VS      G ++ L +     P+ I +  H L  PRG
Sbjct:  432 DLITDALITAEGVAVDWIGRNLYWSDMRSDRIEVSTLE--------GKWRRVLLSEDVESPRGLVLDSNAGYLFWTDWGTSPRVERSWLDGSNRFVISFGIKIVWPNGLTLDLATKRVYW--IDAKLDHIVSCEYDGSSKRIVLSGSRQINHPFAMTLFEDYLYWTDWQNKHVLRVSKLH---GENVTLLSAGVSKPMDIHA-VHPLRQPRG 629          

HSP 4 Score: 62.3882 bits (150), Expect = 1.538e-9
Identity = 48/130 (36.92%), Postives = 64/130 (49.23%), Query Frame = 3
Query: 4377 CGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDE---VGCN--TCNISHLYSCSRSDVCLPITKRCDGVMDC-----DSDEQC-----CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C AG  F+ K G     C+S++ +CD   DC+D SDE    GC   +C  S  + C  S  C+P++ RCDG  DC       +  C     C +  F C +G+    C P    C+G  DC DGSDE GC
Sbjct:    1 CSAG-KFTCKNGH----CISLRWKCDGENDCVDNSDEDEYAGCAEWSCRASE-FRCQASRKCIPLSWRCDGDYDCLAPDLSDEANCSVATNCSASMFRCANGQ----CKPRDWVCDGFDDCGDGSDEKGC 120          

HSP 5 Score: 59.6918 bits (143), Expect = 9.385e-9
Identity = 45/114 (39.47%), Postives = 59/114 (51.75%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCL--DGSDEVGCN---TCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQ-----KFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNN 4733
            C+ +  RCD   DCL  D SDE  C+    C+ S ++ C+    C P    CDG  DC   SDE+ C +      +F C SG    RC+P+  RC+G  DC DG+DE GC   N
Sbjct:   56 CIPLSWRCDGDYDCLAPDLSDEANCSVATNCSAS-MFRCANGQ-CKPRDWVCDGFDDCGDGSDEKGCANHSCTPAQFSCPSG----RCIPLRWRCDGDGDCSDGADERGCPPKN 163          

HSP 6 Score: 53.5286 bits (127), Expect = 7.629e-7
Identity = 60/193 (31.09%), Postives = 83/193 (43.01%), Query Frame = 3
Query: 4206 LPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQ------------QRCDSTVDCLDGSDEVGCNTCNISH-LYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQ-----KFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCN 4724
            +P+S   +  +   A  L  +  CS   + S +   R   G C     V CD +   CG G   S ++G +  SC   Q             RCD   DC DG+DE GC   N +   +SCS    C+ +  RCDG  DC   SDE+ C  +     +F C +G+    C+     C+G  DC D SDE  C 
Sbjct:   57 IPLSWRCDGDYDCLAPDLSDEANCSVATNCSASM-FRCANGQCKPRDWV-CDGFD-DCGDG---SDEKGCANHSCTPAQFSCPSGRCIPLRWRCDGDGDCSDGADERGCPPKNCTDSQFSCSNGQ-CISLAWRCDGDHDCADKSDERNCTGKTCKPFEFACANGR---HCIQRKWICDGENDCGDRSDEVDCG 239          

HSP 7 Score: 52.373 bits (124), Expect = 1.788e-6
Identity = 41/109 (37.61%), Postives = 55/109 (50.46%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGC--NTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDE-----QCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEH-GCN 4724
            C+S+  RCD   DC D SDE  C   TC     ++C+    C+     CDG  DC   SDE     + CG+ ++ C    + +RC+  S  C+G VDC D SDE  GC 
Sbjct:  176 CISLAWRCDGDHDCADKSDERNCTGKTCK-PFEFACANGRHCIQRKWICDGENDCGDRSDEVDCGLESCGNDRWRC---SNTSRCIAKSQVCDGRVDCPDASDEGPGCG 280          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Nematostella
Match: EDO49497 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGA9])

HSP 1 Score: 69.3218 bits (168), Expect = 6.794e-12
Identity = 101/440 (22.95%), Postives = 162/440 (36.82%), Query Frame = 3
Query: 2985 CSQFCLPV--ESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINA--GQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI--PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCP 4286
            CSQ CL     +R C C   Y L  DG TC  ++  L+  T   EI       L+    +   V        PI    G  F+D             D+ G        R  V+ + +   +  +  I T     + +              A+D +   L W D +T +I   RLN    +     V+I+   S   P  +A+ P    L W  +D+               IE + +DG+RRS L+  P +  P+ LT+D   G +YW+D+K N +         ++I +  + G + K+ V +      G +  S+ V  ++L+WTD            S+IK  +     F     ++ K  T      R+   + +  ++      +PC      + N  C+H C                    LDGK  CSCP
Sbjct:  106 CSQLCLVTGKNTRRCTCIIGYRLIGDGRTCEGINSFLL-YTTAKEI-----RALSTTPGDTTAVH------PPITGLNGASFLD------------FDSAGRWIYYSDERARVIRRVHVDGTGVQDIIATGLRRPQGI--------------AVDWVGRNLFWCDAITDLIEVSRLNGSHRK-----VLISTGVSD--PKSLAVYPSMGLLFW--SDWGTPAR----------IERASMDGSRRSTLISGPTVRKPTGLTLDYLHGSLYWVDSKKNSI---------WRINSSLLDGTDRKIIVSA-----PGITLRSIAVFGEFLYWTD---------PSTSNIKRVS----KFNGGDTVQWKFATTGSSSMRVFAREAQDCTV------NPC------VLNGGCTHTC------------------TVLDGKPVCSCP 431          

HSP 2 Score: 67.781 bits (164), Expect = 2.153e-11
Identity = 102/382 (26.70%), Postives = 157/382 (41.10%), Query Frame = 3
Query:  912 NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGG----LQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI-------PVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGT-CSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYH--GGSKR--ILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRC 2006
            N  CS +CL    +  RC+C  G     +   C    +  L+     +I  +S   G    + PP+  L+   G  F   +DS    + Y D  +  I           +R ++D     DI       P  IAVD   RN++W +     + V+R++  +R     +L+S   S             P  LAV      LF +    GT   IER  +DG+++ T+IS      P GL LD     LY+VD+ K  +  +N     G+ R  I++       S++ F  F+YWT+  T +I  V KF+G   ++  K     + +M V A  R A   T +PC   +  C   C  + G      C C  + + L N  RC
Sbjct:  103 NGGCSQLCLVTGKNTRRCTCIIGYRLIGDGRTCEGINSFLLYT-TAKEIRALSTTPGDTTAVHPPITGLN---GASF-LDFDSAGRWIYYSDERARVI-----------RRVHVDGTGVQDIIATGLRRPQGIAVDWVGRNLFWCDAITDLIEVSRLNGSHR----KVLISTGVSD------------PKSLAVYPSMGLLFWSDW--GTPARIERASMDGSRRSTLISGPTVRKPTGLTLDYLHGSLYWVDSKKNSIWRINSSLLDGTDRKIIVSAPGITLRSIAVFGEFLYWTDPSTSNIKRVSKFNGG-DTVQWKFATTGSSSMRVFA--REAQDCTVNPCV-LNGGCTHTCTVLDGKP---VCSCP-QGYRLENPYRC 442          

HSP 3 Score: 59.3066 bits (142), Expect = 1.139e-8
Identity = 40/127 (31.50%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  252 LDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRR-VIHKSILFKSSQLAIDRHRKMLFW 629
            +D   ++D++   ++  + +AVDWV  NL+W D     IEV  LN           R++L+S  ++D  SL V P    LFW   G    +ER+ +DGS R  +I    + K + L +D     L+W
Sbjct:  200 VDGTGVQDIIATGLRRPQGIAVDWVGRNLFWCDAITDLIEVSRLN--------GSHRKVLISTGVSDPKSLAVYPSMGLLFWSDWGTPARIERASMDGSRRSTLISGPTVRKPTGLTLDYLHGSLYW 318          

HSP 4 Score: 52.373 bits (124), Expect = 1.357e-6
Identity = 69/351 (19.66%), Postives = 140/351 (39.89%), Query Frame = 3
Query: 1608 RQQLYFVDTVKGDMISVNYHGGSKRIL---AQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTK--TRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKT-ASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRG--VADIDELVVDEQANYVCWKSSDSGKIYR 2633
            R+++Y++D     ++S  Y G SKRI+   +++     +++ F++++YWT+ +   +  V K  G   +L++   ++ +D        +  N        C   +  C QLC      +++  C C     ++ +   C   +  ++Y     +     TP           G +      L  D     IY+ ++ A  I +     T +Q    I          +AVD++  NL+       W   +   +  +  + S   V++ST + +    +++V+  +  LFW +  T      A + +A +DGS+   +  G  V     L +D     + W  S    I+R
Sbjct:    6 RRRVYWIDAKLDHIVSCEYDGSSKRIVLSGSRQINHPFAMTLFEDYLYWTDWQNKHVLRVSKLHGENVTLLSAGVSKPMDIHACYFHLLGNNL-------CGWKNGGCSQLCLVT--GKNTRRCTCIIGYRLIGDGRTCEGINSFLLYTTAKEIRALSTTPGDTTAVHPPITGLNGASF--LDFDSAGRWIYYSDERARVIRRVHVDGTGVQ---DIIATGLRRPQGIAVDWVGRNLF-------WCDAITDLIEVSRLNGSHRKVLISTGVSDP--KSLAVYPSMGLLFWSDWGTP-----ARIERASMDGSRRSTLISGPTVRKPTGLTLDYLHGSLYWVDSKKNSIWR 328          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Nematostella
Match: EDO48069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ9])

HSP 1 Score: 67.0106 bits (162), Expect = 5.835e-11
Identity = 85/372 (22.85%), Postives = 145/372 (38.98%), Query Frame = 3
Query:  921 CSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRS-LFIGNPPKIYHMSLDGG----LQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTV-ISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRIL-AQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCF--PIRGNQHSFSCGCSNRAHVLLNISRC 2006
            CS +C     S Y+C+C  G     +   C     +  L   N   I  + +D      + P L              YD  T  + + D   +SI S  LN  G+     ++  + +  P  IAVD  +R +YW +     + VA +    R++  T  L                Q P  + V     Y+F T   +    IER  ++G  K  + I +TN  WP  L +D    ++++ D  +  +   N  G ++R++ +       +++ F ++IYWT+    SI+   KF+G  RSLV          M +    +       +PC   +  C   C   P+     S +C C    ++L + + C
Sbjct:  298 CSQMCFNSKGS-YKCTCMEGYRLEPDKKTCKALGDKPFLLFTNRQDIRRLVMDSSDFTQVVPKLRAA-------IALDYDFATGVIYWSDVIEASIKSAPLNN-GSAVETIVNMSLLT--PDGIAVDWVNRKLYWTDTGTDVIEVANLDGRERMRLITTGL----------------QEPRAIVVYPAIGYMFWTDWGEEP-KIERCGMNGDPKTRLQIVNTNILWPNALTIDYTIDKIWWADAKEHTIECANLDGTARRVITSDSVHHPFAITVFQDYIYWTDWVKESIYKANKFNGKDRSLVCSGL---YSPMDIHVYQQQKQPKFSNPCGENNGGCSHTCLLAPL---PKSHTCHCPPNINLLEDSATC 635          

HSP 2 Score: 55.0694 bits (131), Expect = 2.577e-7
Identity = 43/109 (39.45%), Postives = 53/109 (48.62%), Query Frame = 3
Query: 4428 CMSVQQRCDSTVDCLDGSDEVGC----NTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQ-----KFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            C+  + RCD   DC D SDE+ C      C  S  Y CS  + C+  +  CDG  DC   SDE  C S      +F C +     RC+P+  RCNG  DC D SDE  C
Sbjct:   93 CILSRWRCDGDRDCADNSDEINCPNSSQYCKSSE-YQCSTGE-CIHKSWVCDGEFDCLNKSDENNCHSSACHISQFTCAN----KRCIPMRDRCNGNNDCLDNSDEADC 195          

HSP 3 Score: 51.6026 bits (122), Expect = 3.672e-6
Identity = 43/136 (31.62%), Postives = 64/136 (47.06%), Query Frame = 3
Query: 4359 DRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNT--CNISHLYSCSRSDVCLPITKRCDGVMDC--DSDE--------------QCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            D    P  +    S +   S   C+     CD   DCL+ SDE  C++  C+IS  ++C+    C+P+  RC+G  DC  +SDE                C   +F+C S K   +C+P S  C+G VDC + +DE
Sbjct:  111 DEINCPNSSQYCKSSEYQCSTGECIHKSWVCDGEFDCLNKSDENNCHSSACHISQ-FTCANK-RCIPMRDRCNGNNDCLDNSDEADCRMFSLLATKPPSICKDGEFQCGSSK---QCIPESKVCDGSVDCTNSADE 241          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Medaka
Match: lrp5 (LDL receptor related protein 5 [Source:NCBI gene;Acc:101167185])

HSP 1 Score: 256.914 bits (655), Expect = 2.067e-68
Identity = 348/1539 (22.61%), Postives = 605/1539 (39.31%), Query Frame = 3
Query:  291 VQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAI--ISRKHQLMVPRGRRKSPCM--NRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFA--YDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHG-GSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKI----LGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDE----IDFVEWVELSEQPINAGQKFIDAVYWLS--KNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSV 4820
            + S + +A DW+S  LYW D +   IEV +LN  S        R++L   ++    ++ ++P ++Y++W   G    +ER+ +DGS R VI    +F  + L +D   + L+W   D +   IHR +  G    ++ V+GT     P  LT +   L + + +   + +     G           +P+ I  +    Q  +     ++PC   N  CS +C L  V   Y C+C TG+    +   C     + L +     +  +SLD  L    +++ +  GI    A  YD V   + + D    +I    L+  G+     +   I+   P  IAVD  SRN+YW +     + V R++  +R     +L+S            +    P  + +D +N Y+F +   +    IER  LDGT +  V+ +T+  WP GLALD    +LY+ D     +  +N  G G K +L  K       +   ++IYWT+ +  SI  V    ++R ++      D   +    V+     +    C   +  C  LCF  R    + SC C     +L ++  C      +++ N+  + +  L  N++   I L   +   + ++L  D    +IYW +     I +   N      +  F L  D    +AVD++ +N+Y + T +  +RI + RL     D  +  V+V   + N        ++++     F++W E        +  + +A++DGS    +   V   + L +D   + + W   D+     Y I +      Q  + +               P+   L  +  D IY    +          L  I       G+     +   + +       ++ D   E    C  +N D    C+  CL   +  +C C S Y+L+ DG  C   S  L+          I   +L E+  +    I  V+   +   P++        +YWL   +NI    D+   + A    +P         +  Q HD                        L++DP S  + W+   T  I  +R++        +GV++  +++  +P  I +      + + +     ++           IE + LDG  R  L     I P  L +D   G+++WID             D  +I +  + G N  V  DS +   +G     + VL ++L+W D  QQ+   +   +  + +   G     + +L     T +  +  + P +F         + HPCSR      N  CSH+C++                 + DG  RCSCP+ +             + S L++C   + P  +   F+   G   + C+ +  RCD   +C DGSDE  C  C++SH + C     C+   KRCDG  DC   SDE      C   +F C   +    C+    RC+G  DC DG DE  C+      + +  DP  +I +     +  + G V
Sbjct:   98 LDSPDGLACDWLSKKLYWTDSETNRIEVANLNGTS--------RKVLFWMDLDQPRAIALNPAQRYMYWTDWGEEPRIERAGMDGSRREVIVNEDIFWPNGLTVDLEEQKLYW--ADAKLSFIHRANLDGSAREAV-VEGTLTH--PFALTLSNETLFWTDWQTHSIHACNKHRGDKTREILGGIYSPMGIQVLESYRQPYI-----RTPCSDNNGGCSHLCLLSPVPPFYSCTCPTGVQLRADGKTCKPGAEQVLLLARRTDLRRISLD--LPDFTDIVLQVDGIRHAIAIDYDPVEGYVYWTDDEVRAIRRSRLD--GSNAVMLVTTEINH--PDGIAVDWVSRNLYWTDTGTDRIEVTRLNGTSR----KILIS------------ENLDEPRAIVLDPVNGYMFWSDWGERP-KIERANLDGTDRL-VLLNTSLGWPNGLALDYATGKLYWGDAKTDKIEVINVDGTGRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKVTAVREIIIDQLP-DLMGLKATKVTETHGTNG---CAVENGGCSHLCFWRR---RAVSCACPMGMELLPDLQTCVVPEAFLLFTNRDSIRSISLGTNSNDVAIPLTGIK---EASALDFDVSEKRIYWTD--IQTISRAYMNGSSVEHVIEFGL--DYPEGMAVDWMGHNIYWADTGT--NRIEVARL-----DGQYRQVLVCKDLDNPRSLDNPRSLALDPANGFMYWTEWG-----GLPRIARAYMDGSIITTLVEKVGRANGLTIDYVDHRLYWTDLDT-----YMIESSNMLGLQREIVVDD------------LPHPFGLTQY-KDFIYWTDFN----------LRTIERADKRGGLNRTVILKLELMMDILVFHSSRQDGTNE----CSLNNGD----CAHLCLATPTGAQCRCTSHYTLNPDGRNCSSPSSFLLFTQKN----SISRMVLGEQSPDIILPIHVVKARAVHYDPVDR------LIYWLDGRQNIRRARDDGSSVMATSTAQP---------VENQLHD------------------------LSLDPYSRHVYWTCENTNTINVQRMDG-----HTVGVVV--KDNTDKPRAIVVNAERGYMYFTTVQERSAK-----------IEGASLDGTERESLFTTGLIRPVALALDNKLGKLFWIDA------------DLKRIESSDLTGANRVVLQDSNILQPMG-----LTVLGEHLYWIDRQQQMIERVDKLTGDRRTRVQG----RISFL-----TSIHAVEEMDPREF---------ELHPCSR-----NNGGCSHICIA-----------------KGDGTPRCSCPIHL------------VLASDLLRCG--EPPTCSPEQFTCSTGD--IDCIPLAWRCDGFPECEDGSDEDNCPVCSVSH-FQCDEGS-CIDAHKRCDGEPDCADKSDEHDCEVICSPGEFRCGDNQ----CITKKQRCDGYSDCPDGLDELACDHAPPPSSFNH-DPKPIIPVIAIMLLVFVIGGV 1391          

HSP 2 Score: 124.79 bits (312), Expect = 6.397e-28
Identity = 183/833 (21.97%), Postives = 330/833 (39.62%), Query Frame = 3
Query:  192 YVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSL---DGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESD-------VQVASLQLDHYRNQIYWINQAAN---------CIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            YV+   +  +++ +    S+LD      ++   +   + +AVDWVS NLYW D     IEV  LN  S        R+IL+S N+ +  ++V+DP   Y+FW   G    +ER+ LDG+DR V+  + L   + LA+D     L+W   D +  +++     G   +     +   P    FT  G  ++  D Q    S E    ++   +   +  P  +  +  ++    G       N  CS +C      A  C+C  G+    +   C   P   L   N   I  +SL      +  PL  + E + + F    D     + + D  + S   ++    G+     ++F +  D P  +AVD    NIYW +   + + VAR+      +Y  +L+           R   N  P  LA+D  N +++ T    G   I R ++DG+   T++         GL +D    +LY+ D     + S N  G  + I+         L+ + +FIYWT+    +I      G +   V     L    M  I V  ++  D  + C   +  C  LC           C C++   +  +   CS  S  +++  K+ +             + LG+   D       V+  ++  D     IYW++   N          +M T++   ++ QL           +L++D    ++Y +  ++  + I + R+     D     VVV          A+ V+++  ++++    T  ++  A++  A LDG++   L   G+     L +D +   + W  +D  +I
Sbjct:  377 YVYWTDDEVRAIRR----SRLDGSNAVMLVTTEINHPDGIAVDWVSRNLYWTDTGTDRIEVTRLNGTS--------RKILISENLDEPRAIVLDPVNGYMFWSDWGERPKIERANLDGTDRLVLLNTSLGWPNGLALDYATGKLYWG--DAKTDKIEVINVDGTGRKT--LLEDKLPHIFGFTLLGDYIYWTDWQR--RSIERVHKVTAVREIIIDQLPDLMGLKATKVTETHGTNGCAVENGGCSHLCF-WRRRAVSCACPMGMELLPDLQTC-VVPEAFLLFTNRDSIRSISLGTNSNDVAIPLTGIKEASALDF----DVSEKRIYWTDIQTISRAYMN----GSSVEHVIEFGL--DYPEGMAVDWMGHNIYWADTGTNRIEVARLDG----QYRQVLVC----KDLDNPRSLDN--PRSLALDPANGFMYWTEWG-GLPRIARAYMDGSIITTLVEKVGRA--NGLTIDYVDHRLYWTDLDTYMIESSNMLGLQREIVVDDLPHPFGLTQYKDFIYWTDFNLRTIERADKRGGLNRTVI----LKLELMMDILVFHSSRQDGTNECSLNNGDCAHLCL---ATPTGAQCRCTSHYTLNPDGRNCSSPSSFLLFTQKNSI-----------SRMVLGEQSPDIILPIHVVKARAVHYDPVDRLIYWLDGRQNIRRARDDGSSVMATSTAQPVENQLH----------DLSLDPYSRHVYWTCENT--NTINVQRM-----DGHTVGVVVKDNTDKP--RAIVVNAERGYMYF----TTVQERSAKIEGASLDGTERESLFTTGLIRPVALALDNKLGKLFWIDADLKRI 1125          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Medaka
Match: lrp6 (LDL receptor related protein 6 [Source:NCBI gene;Acc:101172212])

HSP 1 Score: 229.565 bits (584), Expect = 7.129e-60
Identity = 340/1525 (22.30%), Postives = 584/1525 (38.30%), Query Frame = 3
Query:  291 VQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRR-VIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFI--NDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCM--NRVCSSICLPIVDSAY-RCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQ-KFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLC-FPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHS-DVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKS-SDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLT----------------------CSQFCL--PVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVD-----RTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLV-KNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDE-QC-----CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            + S + +A DW+   LYW D +   IEV +L+           R++L  + +    ++ +DP   +++W   G +  +ER+ +DG++R  +IHK I + +  L +D  ++ L+W   D + + +      G    V    +   P  LT  E  L +   N   +   + E G G         +   I + S + Q +       SPC   N  CS +CL    S + RC+C TG+    +   C    T+ L +     +  +SLD      + L  E+        YD V   L + D +  +I    L+  G+  +F +   +S   P  IAVD  +RN+YW +     + V R++   R     +L+S            +    P  + +D +  Y++ T   +    IER  LDG ++  V+ +T+  WP GLALD +  ++Y+ D     +  +N +G  +R+L + K       +   + IYWT+ +  SI  V    + R ++          M + A   + +  + +PC  ++  C  LC +  RG Q    CGC     ++ ++  C      +++   + +    L  N +   I L   +   + ++L  D   N+IYW              TDI  +         TIS            A +  SA   ++   L +     V W             LG        K L+W +T T +R  VA+L   H    + +L+W+ +     L +D    Y+ W       KI R        +    +  I    +   +  L I    R LY    D+    TL +SS+ +   +     ++ H  G+  +         S + I  A    G    ++     H +++                       CS  CL  PV S  CGC + +SL+ D  TC   +  L+    +     I   +++E+                              S +I+L + N   + A+D     +   ++  K+      QE+  +  T  S +L      +    Y L+ID  S  + W++  T +I   R++  +     +GV++N  + R  P  I + P    + + +      +           IE + LDG  R VL     G P  L +D   G+++W+D+            D  +I +  + G N  V  DS +   VG     + V   +L+W D  QQ+   I   +    +         + YL D     +  +  +   D+           HPC+      +N  CSH+C+                  + DG  RCSCPV + +          C   +   C   Q  C +G V           C+    RCD   +C D SDE  C  C+       SR   C+ ++ RC+G ++C   SDE +C     C + +F C +G+    C+    +C+  +DC D SDE GC
Sbjct:   98 LASPDGLACDWLGSKLYWTDSETNRIEVAELD--------GSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEVPKIERAGMDGTNRSMIIHKDIYWPNG-LTLDYSQQKLYW--ADAKFNFIHRSNLDGSHREVVVKDELPHPFALTLYESTLFWTDWNTHSIHSCTKETGRGQRTVHSNIFSPMDIHVFSPRRQPV----SVNSPCSRDNGGCSHLCLLAPSSPFFRCACPTGVQLLEDGRTCRDGATQMLLLARRTDLRQISLDTPDFTDVVLQVEDIRHAIAIDYDPVEGYLYWTDDDVKAIRRSRLD--GSDAQFIVTSQVSH--PDGIAVDWIARNLYWTDTGTDRIEVTRLNGTMR----KILIS------------EDLDEPRAIVLDPVAGYMYWTDWGE-VPKIERADLDGMER-VVMVNTSLGWPNGLALDYHEGRMYWGDAKTDKIEVMNVNGTGRRVLVENKLPHIFGFTLLGDHIYWTDWQRRSIERVHKRTAEREVIIDQL---PDLMGLKATFVHEAFGS-NPCAESNGGCSHLCLYKPRGVQ----CGCPIGLELIADMRTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPLTGVK---EASALDFDVTDNRIYW--------------TDITLK---------TISR-----------AFMNGSALEHVVEFGLDYPEGMAVDW-------------LG--------KNLYWADTGT-NRIEVAKLDGQH----RQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDR--------AAMDGTGRITLVGNVGRANGLTIDYAERRLYWTDLDT----TLIESSNMLGLDREVIADDLPHPFGLTQYQDYIYWTDWSQRSIERANKTSGQNRTLI---QGHLDYVMDILVFHSSRQGGWNACAATNGHCSHLCLAVPVSSFVCGCPAHFSLNEDNKTCSAPTSFLLFSQKSA----INRMVIDEQQ-----------------------------SPDIILPIHNLKNVRAIDYDPLDKHLYWIDSKQNLIRRAQENGNQCTTVVSSSLIGP--GQVLQLYDLSIDIFSRFIYWTNEATNVINVTRMDGSR-----VGVVLNGEQDR--PRAIVVNPERGYMYFTNLQDRSPK-----------IERAALDGTEREVLFFGGLGKPVALAIDNDVGKLFWVDS------------DLRRIESSDLSGANRIVIADSNILQPVG-----LTVFGNHLYWIDKQQQMIERIDKMTRDGRTKVQA----RVSYLSD-----IHAVHELDMRDYG---------KHPCT-----WDNGGCSHICIV-----------------KGDGTTRCSCPVHLVLLQDELS----C--GEPPTCSPDQFACTSGEV----------DCIPQTWRCDGYSECDDSSDEEDCPVCSEDEFQCDSRQ--CIDLSLRCNGEVNCQDRSDENKCEVPIRCPADQFSCSNGQ----CIGKHKKCDHNMDCSDNSDEIGC 1367          

HSP 2 Score: 151.754 bits (382), Expect = 3.801e-36
Identity = 198/824 (24.03%), Postives = 338/824 (41.02%), Query Frame = 3
Query:  228 LKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLM------VPRGRRKSPCM--NRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLD-ARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISR--CSYSSEMIVYFNKS----MLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASN----TDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            +K    S+LD    + ++   V   + +AVDW++ NLYW D     IEV  LN           R+IL+S ++ +  ++V+DP   Y++W   G +  +ER+ LDG +R V+  + L   + LA+D H   ++W   D +  +++     G   RV    K   P    FT      + D   W          SI            II +   LM      V      +PC   N  CS +CL       +C C  G+    +   C   P   L       I  +SL+     +  PL  + E + + F    D   + + + D    +I    +N  G+     ++F +  D P  +AVD   +N+YW +   + + VA++   +R      +L W+   +           P  LA+D    Y++ T    G   I+R  +DGT + T++ +       GL +D   ++LY+ D     + S N  G  + ++A        L+ + ++IYWT+    SI    K  G  R+L+    +LD    + V   SR    +    C +T+  C  LC  +  +  SF CGC   AH  LN     CS  +  +++  KS    M+I    +P+       L        V ++  D     +YWI+   N I +   N    T +     I       + +L++D     +Y   T+ A + I + R+     D S   VV++ +       A+ V+ +  ++++  T  +DR    E  +A LDG++  +L + G+     L +D     + W  SD  +I
Sbjct:  386 VKAIRRSRLDGSDAQFIVTSQVSHPDGIAVDWIARNLYWTDTGTDRIEVTRLN--------GTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDGMERVVMVNTSLGWPNGLALDYHEGRMYWG--DAKTDKIEVMNVNGTGRRVLVENKL--PHIFGFT-----LLGDHIYWTDWQR----RSIERVHKRTAEREVIIDQLPDLMGLKATFVHEAFGSNPCAESNGGCSHLCL-YKPRGVQCGCPIGLELIADMRTC-IVPEAFLLFSRHTDIRRISLETNNNNVAIPLTGVKEASALDF----DVTDNRIYWTDITLKTISRAFMN--GSALEHVVEFGL--DYPEGMAVDWLGKNLYWADTGTNRIEVAKLDGQHRQ-----VLVWKDLDS-----------PRALALDPAEGYMYWTEWG-GKPKIDRAAMDGTGRITLVGNVGR--ANGLTIDYAERRLYWTDLDTTLIESSNMLGLDREVIADDLPHPFGLTQYQDYIYWTDWSQRSIERANKTSGQNRTLIQG--HLDYVMDILVFHSSRQGGWNA---CAATNGHCSHLCLAVPVS--SFVCGCP--AHFSLNEDNKTCSAPTSFLLFSQKSAINRMVIDEQQSPDIILPIHNLKN------VRAIDYDPLDKHLYWIDSKQNLIRRAQENGNQCTTVVSSSLIGPGQVLQLYDLSIDIFSRFIYW--TNEATNVINVTRM-----DGSRVGVVLNGEQDRP--RAIVVNPERGYMYF--TNLQDRSPKIE--RAALDGTEREVLFFGGLGKPVALAIDNDVGKLFWVDSDLRRI 1131          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Medaka
Match: lrp5 (LDL receptor related protein 5 [Source:NCBI gene;Acc:101167185])

HSP 1 Score: 171.014 bits (432), Expect = 5.400e-42
Identity = 188/791 (23.77%), Postives = 337/791 (42.60%), Query Frame = 3
Query:  291 VQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAI--ISRKHQLMVPRGRRKSPCM--NRVCSSIC-LPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFA--YDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHG-GSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKI----LGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDS 2618
            + S + +A DW+S  LYW D +   IEV +LN  S        R++L   ++    ++ ++P ++Y++W   G    +ER+ +DGS R VI    +F  + L +D   + L+W   D +   IHR +  G    ++ V+GT     P  LT +   L + + +   + +     G           +P+ I  +    Q  +     ++PC   N  CS +C L  V   Y C+C TG+    +   C     + L +     +  +SLD  L    +++ +  GI    A  YD V   + + D    +I    L+  G+     +   I+   P  IAVD  SRN+YW +     + V R++  +R     +L+S            +    P  + +D +N Y+F +   +    IER  LDGT +  V+ +T+  WP GLALD    +LY+ D     +  +N  G G K +L  K       +   ++IYWT+ +  SI  V    ++R ++   +  D   +    V+     +    C   +  C  LCF  R    + SC C     +L ++  C      +++ N+  + +  L  N++   I L   +   + ++L  D    +IYW +  A  I +   N      +  F L  D    +AVD++ +N+Y + T +  +RI + RL     D  +  V+V   + N        ++++     F++W E        +  + +A++DGS    +   V   + L +D   + + W   D+
Sbjct:  104 LDSPDGLACDWLSKKLYWTDSETNRIEVANLNGTS--------RKVLFWMDLDQPRAIALNPAQRYMYWTDWGEEPRIERAGMDGSRREVIVNEDIFWPNGLTVDLEEQKLYW--ADAKLSFIHRANLDGSAREAV-VEGTLTH--PFALTLSNETLFWTDWQTHSIHACNKHRGDKTREILGGIYSPMGIQVLESYRQPYI-----RTPCSDNNGGCSHLCLLSPVPPFYSCTCPTGVQLRADGKTCKPGAEQVLLLARRTDLRRISLD--LPDFTDIVLQVDGIRHAIAIDYDPVEGYVYWTDDEVRAIRRSRLD--GSNAVMLVTTEINH--PDGIAVDWVSRNLYWTDTGTDRIEVTRLNGTSR----KILIS------------ENLDEPRAIVLDPVNGYMFWSDWGERP-KIERANLDGTDRL-VLLNTSLGWPNGLALDYATGKLYWGDAKTDKIEVINVDGTGRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKVTAVREIIID-QLPDLMGLKATKVTETHGTNG---CAVENGGCSHLCFWRR---RAVSCACPMGMELLPDLQTCVVPEAFLLFTNRDSIRSISLGTNSNDVAIPLTGIK---EASALDFDVSEKRIYWTDIQAKTISRAYMNGSSVEHVIEFGL--DYPEGMAVDWMGHNIYWADTGT--NRIEVARL-----DGQYRQVLVCKDLDNPRSLDNPRSLALDPANGFMYWTEWG-----GLPRIARAYMDGSIITTLVEKVGRANGLTIDYVDHRLYWTDLDT 828          

HSP 2 Score: 127.872 bits (320), Expect = 7.995e-29
Identity = 184/835 (22.04%), Postives = 333/835 (39.88%), Query Frame = 3
Query:  192 YVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESD-------VQVASLQLDHYRNQIYWI-----------NQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            YV+   +  +++ +    S+LD      ++   +   + +AVDWVS NLYW D     IEV  LN  S        R+IL+S N+ +  ++V+DP   Y+FW   G    +ER+ LDG+DR V+  + L   + LA+D     L+W   D +  +++     G   +     +   P    FT  G  ++  D Q    S E    ++   +   +  P  +  +  ++    G       N  CS +C      A  C+C  G+    +   C   P   L   N   I  +SL      +  PL  + E + + F    D     + + D  + +I    +N  G+     ++F +  D P  +AVD    NIYW +   + + VAR+      +Y  +L+           R   N  P  LA+D  N +++ T    G   I R ++DG+   T++         GL +D    +LY+ D     + S N  G  + I+         L+ + +FIYWT+    +I      G +   V     L+   M  I V  ++  D  + C   +  C  LC           C C++   +  +   CS  S  +++  K+ +             + LG+   D       V+  ++  D     IYW+           + A + +M T++   ++ QL           +L++D    ++Y +  ++  + I + R+     D     VVV          A+ V+++  ++++    T  ++  A++  A LDG++   L   G+     L +D +   + W  +D  +I
Sbjct:  383 YVYWTDDEVRAIRR----SRLDGSNAVMLVTTEINHPDGIAVDWVSRNLYWTDTGTDRIEVTRLNGTS--------RKILISENLDEPRAIVLDPVNGYMFWSDWGERPKIERANLDGTDRLVLLNTSLGWPNGLALDYATGKLYWG--DAKTDKIEVINVDGTGRKT--LLEDKLPHIFGFTLLGDYIYWTDWQR--RSIERVHKVTAVREIIIDQLPDLMGLKATKVTETHGTNGCAVENGGCSHLCF-WRRRAVSCACPMGMELLPDLQTC-VVPEAFLLFTNRDSIRSISLGTNSNDVAIPLTGIKEASALDF----DVSEKRIYWTDIQAKTISRAYMN--GSSVEHVIEFGL--DYPEGMAVDWMGHNIYWADTGTNRIEVARLDG----QYRQVLVC----KDLDNPRSLDN--PRSLALDPANGFMYWTEWG-GLPRIARAYMDGSIITTLVEKVGRA--NGLTIDYVDHRLYWTDLDTYMIESSNMLGLQREIVVDDLPHPFGLTQYKDFIYWTDFNLRTIERADKRGGLNRTVILKGQLE--LMMDILVFHSSRQDGTNECSLNNGDCAHLCL---ATPTGAQCRCTSHYTLNPDGRNCSSPSSFLLFTQKNSI-----------SRMVLGEQSPDIILPIHVVKARAVHYDPVDRLIYWLDGRQNIRRARDDGAMSSVMATSTAQPVENQLH----------DLSLDPYSRHVYWTCENT--NTINVQRM-----DGHTVGVVVKDNTDKP--RAIVVNAERGYMYF----TTVQERSAKIEGASLDGTERESLFTTGLIRPVALALDNKLGKLFWIDADLKRI 1137          

HSP 3 Score: 121.324 bits (303), Expect = 8.290e-27
Identity = 147/636 (23.11%), Postives = 247/636 (38.84%), Query Frame = 3
Query: 2952 CPTHNHDNFLTCSQFCLPVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEI----DFVEWVELSEQPINAGQKFIDAVYWL-SKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSV 4820
            C  +N D    C+  CL   +  +C C S Y+L+ DG  C   S  L+          I   +L E+  +I      V+   +   P++        +YWL  +  + R  + G +S+V      +     + +  Q HD                        L++DP S  + W+   T  I  +R++        +GV++  +++  +P  I +      + + +     ++           IE + LDG  R  L     I P  L +D   G+++WID             D  +I +  + G N  V  DS +   +G     + VL ++L+W D  QQ+   +   +  + +   G     + +L     T +  +  + P +F         + HPCSR      N  CSH+C++                 + DG  RCSCP+ +             + S L++C   + P  +   F+   G   + C+ +  RCD   +C DGSDE  C  C++SH + C     C+   KRCDG  DC   SDE      C   +F C   +    C+    RC+G  DC DG DE  C+      + +  DP  +I +     +  + G V
Sbjct:  910 CSLNNGD----CAHLCLATPTGAQCRCTSHYTLNPDGRNCSSPSSFLLFTQKNS----ISRMVLGEQSPDIILPIHVVKARAVHYDPVDR------LIYWLDGRQNIRRARDDGAMSSV------MATSTAQPVENQLHD------------------------LSLDPYSRHVYWTCENTNTINVQRMDG-----HTVGVVV--KDNTDKPRAIVVNAERGYMYFTTVQERSAK-----------IEGASLDGTERESLFTTGLIRPVALALDNKLGKLFWIDA------------DLKRIESSDLTGANRVVLQDSNILQPMG-----LTVLGEHLYWIDRQQQMIERVDKLTGDRRTRVQG----RISFL-----TSIHAVEEMDPREF---------ELHPCSR-----NNGGCSHICIA-----------------KGDGTPRCSCPIHL------------VLASDLLRCG--EPPTCSPEQFTCSTGD--IDCIPLAWRCDGFPECEDGSDEDNCPVCSVSH-FQCDEGS-CIDAHKRCDGEPDCADKSDEHDCEVICSPGEFRCGDNQ----CITKKQRCDGYSDCPDGLDELACDHAPPPSSFNH-DPKPIIPVIAIMLLVFVIGGV 1403          

HSP 4 Score: 68.9366 bits (167), Expect = 6.299e-11
Identity = 90/415 (21.69%), Postives = 157/415 (37.83%), Query Frame = 3
Query: 2970 DNFLTCSQFCL--PVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQE-HDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCL 4199
            DN   CS  CL  PV     C C +   L ADG TC   ++ ++++         R ++     D  DF +                         IVL++D      A+D    Y  ++ Y   +  E   I+       N      ++      +A+D +S  L W+D  T  I   RLN    +I          E+   P  I + P++  + W  +D+ +             IE ++LDG  R VL+    G P+ L +D  +G++YW D KT+K+  +++             G   K  ++  L +  GF+     +L  Y++WTDW ++    +   + ++            + + D+L  ++ + A    E   ++                 +EN  CSHLC 
Sbjct:  298 DNNGGCSHLCLLSPVPPFYSCTCPTGVQLRADGKTCKPGAEQVLLLAR-------RTDLRRISLDLPDFTD-------------------------IVLQVDGIRHAIAID----YDPVEGYVYWTDDEVRAIRRSRLDGSNAVMLVTTEINHPDGIAVDWVSRNLYWTDTGTDRIEVTRLNGTSRKIL-------ISENLDEPRAIVLDPVNGYMFW--SDWGERPK----------IERANLDGTDRLVLLNTSLGWPNGLALDYATGKLYWGDAKTDKIEVINVD------------GTGRKTLLEDKLPHIFGFT-----LLGDYIYWTDWQRRSIERVHKVTAVR------------EIIIDQLPDLMGLKATKVTETHGTNGCA--------------VENGGCSHLCF 614          

HSP 5 Score: 53.5286 bits (127), Expect = 3.097e-6
Identity = 66/263 (25.10%), Postives = 103/263 (39.16%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI--PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHF--YNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCL 4199
             LA D +S  L W+D  T  I    LN    ++        F     +P  IA+ P    + W   D+ +             IE + +DG+RR V+V N  I  P+ LTVD+   ++YW D    KL ++H        RA ++ G   +  V+  L++    + S+     + LFWTDW      + + +   K    +G  +    +Q L+   +  +R                      PCS       N  CSHLCL
Sbjct:  109 GLACDWLSKKLYWTDSETNRIEVANLNGTSRKVL-------FWMDLDQPRAIALNPAQRYMYW--TDWGEEPR----------IERAGMDGSRREVIV-NEDIFWPNGLTVDLEEQKLYWADA---KLSFIH--------RA-NLDGSAREAVVEGTLTHPFALTLSN-----ETLFWTDWQTHSIHACNKHRGDKTREILGGIYSPMGIQVLESYRQPYIRT---------------------PCSD-----NNGGCSHLCL 308          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Medaka
Match: lrp5 (LDL receptor related protein 5 [Source:NCBI gene;Acc:101167185])

HSP 1 Score: 146.362 bits (368), Expect = 1.517e-34
Identity = 184/786 (23.41%), Postives = 325/786 (41.35%), Query Frame = 3
Query:  291 VQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE---IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFA--YDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHG-GSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKI----LGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDS 2618
            + S + +A DW+S  LYW D +   IEV +LN  S        R++L   ++    ++ ++P ++Y++W   G    +ER+ +DGS R VI    +F  + L +D   + L+W   D +   IHR +  G    ++ V+GT     P  LT +   L F  D Q   S   C                      KH     RG +    +  + S + + +++S YR                P    + L +     +  +SLD  L    +++ +  GI    A  YD V   + + D    +I    L+  G+     +   I+   P  IAVD  SRN+YW +     + V R++  +R     +L+S            +    P  + +D +N Y+F +   +    IER  LDGT +  V+ +T+  WP GLALD    +LY+ D     +  +N  G G K +L  K       +   ++IYWT+ +  SI  V    ++R ++      D   +    V+     +    C   +  C  LCF  R    + SC C     +L ++  C      +++ N+  + +  L  N++   I L   +   + ++L  D    +IYW +  A  I +   N      +  F L  D    +AVD++ +N+Y + T +  +RI + RL     D  +  V+V   + N        ++++     F++W E        +  + +A++DGS    +   V   + L +D   + + W   D+
Sbjct:  104 LDSPDGLACDWLSKKLYWTDSETNRIEVANLNGTS--------RKVLFWMDLDQPRAIALNPAQRYMYWTDWGEEPRIERAGMDGSRREVIVNEDIFWPNGLTVDLEEQKLYW--ADAKLSFIHRANLDGSAREAV-VEGTLTH--PFALTLSNETL-FWTDWQT-HSIHAC---------------------NKH-----RGDKTREILGGIYSPMGIQVLES-YR---------------QPYRAEQVLLLARRTDLRRISLD--LPDFTDIVLQVDGIRHAIAIDYDPVEGYVYWTDDEVRAIRRSRLD--GSNAVMLVTTEINH--PDGIAVDWVSRNLYWTDTGTDRIEVTRLNGTSR----KILIS------------ENLDEPRAIVLDPVNGYMFWSDWGERP-KIERANLDGTDRL-VLLNTSLGWPNGLALDYATGKLYWGDAKTDKIEVINVDGTGRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKVTAVREIIIDQLP-DLMGLKATKVTETHGTNG---CAVENGGCSHLCFWRR---RAVSCACPMGMELLPDLQTCVVPEAFLLFTNRDSIRSISLGTNSNDVAIPLTGIK---EASALDFDVSEKRIYWTDIQAKTISRAYMNGSSVEHVIEFGL--DYPEGMAVDWMGHNIYWADTGT--NRIEVARL-----DGQYRQVLVCKDLDNPRSLDNPRSLALDPANGFMYWTEWG-----GLPRIARAYMDGSIITTLVEKVGRANGLTIDYVDHRLYWTDLDT 784          

HSP 2 Score: 127.872 bits (320), Expect = 6.997e-29
Identity = 182/828 (21.98%), Postives = 332/828 (40.10%), Query Frame = 3
Query:  192 YVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTE-GKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLD---GGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWI-----------NQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQ-PMLIWRGVADIDELVVDEQANYVCWKSSDSGKI 2627
            YV+   +  +++ +    S+LD      ++   +   + +AVDWVS NLYW D     IEV  LN  S        R+IL+S N+ +  ++V+DP   Y+FW   G    +ER+ LDG+DR V+  + L   + LA+D     L+W   D +  +++     G   +     +   P    FT  G  ++  D Q    S E    ++   +   +  P  +  +  ++    G       N  CS +C      A  C+C  G+    +   C   P   L   N   I  +SL      +  PL  + E + + F    D     + + D  + +I    +N  G+     ++F +  D P  +AVD    NIYW +   + + VAR+      +Y  +L+           R   N  P  LA+D  N +++ T    G   I R ++DG+   T++         GL +D    +LY+ D     + S N  G  + I+         L+ + +FIYWT+    +I      G +   V     L+   M  I V  ++  D  + C   +  C  LC           C C++   +  +   CS  S  +++  K+ +    L   +    + +      V+  ++  D     IYW+           + A + +M T++   ++ QL           +L++D    ++Y +  ++  + I + R+     D     VVV          A+ V+++  ++++    T  ++  A++  A LDG++   L   G+     L +D +   + W  +D  +I
Sbjct:  339 YVYWTDDEVRAIRR----SRLDGSNAVMLVTTEINHPDGIAVDWVSRNLYWTDTGTDRIEVTRLNGTS--------RKILISENLDEPRAIVLDPVNGYMFWSDWGERPKIERANLDGTDRLVLLNTSLGWPNGLALDYATGKLYWG--DAKTDKIEVINVDGTGRKT--LLEDKLPHIFGFTLLGDYIYWTDWQR--RSIERVHKVTAVREIIIDQLPDLMGLKATKVTETHGTNGCAVENGGCSHLCF-WRRRAVSCACPMGMELLPDLQTC-VVPEAFLLFTNRDSIRSISLGTNSNDVAIPLTGIKEASALDF----DVSEKRIYWTDIQAKTISRAYMN--GSSVEHVIEFGL--DYPEGMAVDWMGHNIYWADTGTNRIEVARLDG----QYRQVLVC----KDLDNPRSLDN--PRSLALDPANGFMYWTEWG-GLPRIARAYMDGSIITTLVEKVGRA--NGLTIDYVDHRLYWTDLDTYMIESSNMLGLQREIVVDDLPHPFGLTQYKDFIYWTDFNLRTIERADKRGGLNRTVILKGQLE--LMMDILVFHSSRQDGTNECSLNNGDCAHLCL---ATPTGAQCRCTSHYTLNPDGRNCSSPSSFLLFTQKNSISRMVLGEQSPDIILPIHV----VKARAVHYDPVDRLIYWLDGRQNIRRARDDGAMSSVMATSTAQPVENQLH----------DLSLDPYSRHVYWTCENT--NTINVQRM-----DGHTVGVVVKDNTDKP--RAIVVNAERGYMYF----TTVQERSAKIEGASLDGTERESLFTTGLIRPVALALDNKLGKLFWIDADLKRI 1093          

HSP 3 Score: 122.094 bits (305), Expect = 4.491e-27
Identity = 147/636 (23.11%), Postives = 247/636 (38.84%), Query Frame = 3
Query: 2952 CPTHNHDNFLTCSQFCLPVES-RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEI----DFVEWVELSEQPINAGQKFIDAVYWL-SKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSV 4820
            C  +N D    C+  CL   +  +C C S Y+L+ DG  C   S  L+          I   +L E+  +I      V+   +   P++        +YWL  +  + R  + G +S+V      +     + +  Q HD                        L++DP S  + W+   T  I  +R++        +GV++  +++  +P  I +      + + +     ++           IE + LDG  R  L     I P  L +D   G+++WID             D  +I +  + G N  V  DS +   +G     + VL ++L+W D  QQ+   +   +  + +   G     + +L     T +  +  + P +F         + HPCSR      N  CSH+C++                 + DG  RCSCP+ +             + S L++C   + P  +   F+   G   + C+ +  RCD   +C DGSDE  C  C++SH + C     C+   KRCDG  DC   SDE      C   +F C   +    C+    RC+G  DC DG DE  C+      + +  DP  +I +     +  + G V
Sbjct:  866 CSLNNGD----CAHLCLATPTGAQCRCTSHYTLNPDGRNCSSPSSFLLFTQKNS----ISRMVLGEQSPDIILPIHVVKARAVHYDPVDR------LIYWLDGRQNIRRARDDGAMSSV------MATSTAQPVENQLHD------------------------LSLDPYSRHVYWTCENTNTINVQRMDG-----HTVGVVV--KDNTDKPRAIVVNAERGYMYFTTVQERSAK-----------IEGASLDGTERESLFTTGLIRPVALALDNKLGKLFWIDA------------DLKRIESSDLTGANRVVLQDSNILQPMG-----LTVLGEHLYWIDRQQQMIERVDKLTGDRRTRVQG----RISFL-----TSIHAVEEMDPREF---------ELHPCSR-----NNGGCSHICIA-----------------KGDGTPRCSCPIHL------------VLASDLLRCG--EPPTCSPEQFTCSTGD--IDCIPLAWRCDGFPECEDGSDEDNCPVCSVSH-FQCDEGS-CIDAHKRCDGEPDCADKSDEHDCEVICSPGEFRCGDNQ----CITKKQRCDGYSDCPDGLDELACDHAPPPSSFNH-DPKPIIPVIAIMLLVFVIGGV 1359          

HSP 4 Score: 66.2402 bits (160), Expect = 4.495e-10
Identity = 60/260 (23.08%), Postives = 109/260 (41.92%), Query Frame = 3
Query: 3423 SLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNP-GIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCL 4199
             +A+D +S  L W+D  T  I   RLN    +I          E+   P  I + P++  + W  +D+ +             IE ++LDG  R VL+    G P+ L +D  +G++YW D KT+K+  +++             G   K  ++  L +  GF+     +L  Y++WTDW ++    +   + ++            + + D+L  ++ + A    E   ++          C+     +EN  CSHLC 
Sbjct:  373 GIAVDWVSRNLYWTDTGTDRIEVTRLNGTSRKIL-------ISENLDEPRAIVLDPVNGYMFW--SDWGERPK----------IERANLDGTDRLVLLNTSLGWPNGLALDYATGKLYWGDAKTDKIEVINVD------------GTGRKTLLEDKLPHIFGFT-----LLGDYIYWTDWQRRSIERVHKVTAVR------------EIIIDQLPDLMGLKATKVTETHGTNG---------CA-----VENGGCSHLCF 570          
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Medaka
Match: lrp1bb (LDL receptor related protein 1B [Source:NCBI gene;Acc:101154991])

HSP 1 Score: 139.813 bits (351), Expect = 2.405e-32
Identity = 346/1604 (21.57%), Postives = 598/1604 (37.28%), Query Frame = 3
Query:   72 FLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKL--YVFVIQEN--GKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMV-LERSRLDGSDRRVIHKSILFKS--SQLAIDRHRKMLFWWGLDGE-IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFIND---EQLWVSSFECGTGISIALKTNPNIAPIAII--SRKHQLMVP--RGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDI-PVSIAVDSASRNIYWMNHRN--SEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILA---QKFQEFISLSYFDNFIYWTELETLSIHSV-KFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGS-QPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLF----MADSIYQVTLSDSSSSITRKQLTFISNV-----GHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVES--RECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYL--GVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDG-NRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQ--IFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIA-PEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRY-QIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVG--CNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQ-----CCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNN 4733
             +++  H + +  LH+    +        +A D   SR L  +  V+++      L ++   + ++      V++  + + E +AVDW++G LYW D     IEV  LN +         R  L++  M    ++ +DP E  LFW    A    +E + + G DR V+ K++   +  + L +D   K + W     + I    Y G+    + +    +  S  F     G  VF  D     L  ++   G  +++  KT+     + I   SR+ Q   P      + P     CS +CL   +    C+C   +    +   C +   +   I    +   +  D    PPL  L +   +     YD+    + + D  + +I    +N  GT     L+  ISSDI    +A+D  S+N+YW++  N  S++ VAR                    + + S       P  L V      +F    TDG+ +I    +DG+    +  +  D  P GL++D    +LY++ +    +   N  G    +L    +K  +  +L+     ++W + E+  + +V K DG  R+ +   RN     + +    R       + C   +  C QLCFP   ++ + SC C+   ++  + + C      ++Y     +    L PN + + +    G   +    +      + +YW +   N I +  S  D   +  I       +  +AVD+I  NLY   T   ++ I I RL     + ++ +VV+S  +      A++VH    +LFW E           + ++ LDGS Q  L+  G+   + + +D + N + W  + + KI R  +   +  E                    I  ++ ++ LF        IY    + S+ SI R      S++     G    ++  +  +R     T     A+S+ G                 C Q C  + S  R C C     L+ DG  C      L+    T     I  +I     DE D    V+  E P               +NI+    ++G  +A    R +     +  + V   D    +  +EN+         S   LA     DTL W+   +      R + D  R+       ++   E    P  +A+    S + W + +  +             I  S L G N + V+  +   P+ LT+D  + ++Y+ D   +K+        +Y   + HVI       V S   N  G     + +   +++W+DW ++  + ++     D K   A   H               + M  IA  +D  +  L       PC        N  C  LCL T                   G+  CSC     +   +R     CV S+   C+ Y +  CG G             C++ Q  CD    C D SDE    C+  +    +    +  C+  ++ CDG  DC  +SDE       CGS +  C  G     C+P S  CN ++DC D SDE  CN  +
Sbjct: 1214 IIFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFSRSLLYWTDVVEDKIYRGRLSESGGVTGIEV-----VVQHGLATPEGLAVDWITGKLYWIDSNLDQIEVAKLNGE--------MRTTLIAGGMEHPRAIALDPGEGILFWTDWDATFPRIEAASMCGGDRHVVFKNMEIGAWPNGLTLDHLEKRIVWTDARSDAIFSALYDGRG--VIEILRGHEYLSHPFAVSLFGGYVFWTDWRTNTLARANKWTGQNVTVIQKTSAQPFDLQIFHPSRQPQASNPCKENDGRGP-----CSHLCLINYNHTASCTCPHLMKLSADKQSC-SGEQKHFTIQATRRGLPLMQD----PPLNDLPDIDDVSV-VDYDAQEERIYWADVKTQTIKRAFIN--GT----QLETIISSDIVNCGLALDWISKNLYWLSSENDESQINVARFDG-----------------SLQTSIIHGIDKPRCLVVHPAKGKIF---WTDGS-TINMANMDGSNSKVLHQNQKD--PVGLSIDHPANKLYWISSANNTINRCNLDGSGLEVLETLKRKLSKGTALAVMGGKLWWADDESGQLGTVTKKDG--RNFL-PLRNKTGGVVHMKVYDREGQKGK-NMCQVNNGGCSQLCFPT--SETTRSCSCTLGYNLRSDRTTCEGVDSFLMYSIHEGIRGISLDPNDNTEALMPITGT--LFAVGVDFHAGNDTVYWTDMGLNRISR--SKRDQTWREDIITTGISRVEGIAVDWIAGNLY--WTDHGFNLIEISRL-----NGAYRSVVISEGLDQPR--AIAVHPQKGYLFWTEWGKN-----PCIGRSRLDGSDQVTLVNSGIMWPNGISIDYEENTLYWCDARTDKIERINLETGESRE--------------------IVLSASNVDLFSVAVFGPFIYWSDRAHSNGSIRRGLKRDTSDIVTIRSGLGVNLKDVTVFNRGREKGTN--PCARSNGG-----------------CQQLCFHLGSGRRTCSCAHG-RLADDGFACERYEGYLLYSERT-----ILKSI--HLSDESDLNAPVQPLENPA------------FFRNIIALTFDFGQNTA-GTNRIFFSDVHFGNIQVINDDWTGRSIIAENV--------GSVEGLAYHHAWDTLFWT--SSTTSTITRQSVDLKRVNAFPRQAVVTLSED-DHPHNLALDECQSLMFWTNWNEQRPS-----------IMRSTLAGKNMKIVIGSDILTPNGLTIDHKAEKLYFSDGSLSKIERC-----DYDGSSRHVI-------VKSGAGNFYG-----LAIYGDFVYWSDWTRRAVLRSNKYTGGDTKVLRADMPH---------------QPMGIIAVAKDTNNCELS------PCRHL-----NGGCGDLCLLT-----------------PHGRVNCSCRGERVLLEDNR-----CV-SENSSCNIYSEFECGNG------------ECINYQLTCDGVAHCKDKSDEKMQYCDNRSCRSGFRPCYNQRCVANSRFCDGFDDCGDNSDEAFCGNITCGSSESSCKDGS----CIPSSVWCNQVIDCPDASDEKNCNHTD 2574          

HSP 2 Score: 111.694 bits (278), Expect = 7.487e-24
Identity = 143/637 (22.45%), Postives = 256/637 (40.19%), Query Frame = 3
Query:  156 LLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDR--RKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWG--LDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFL--TFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRV-----CSSICLPIVDSAYR---CSCSTGITEPINNAVCPTFPTRSLFI----GNPPKIYHMSL-----DGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVT-----VITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEF---ISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSN 1973
            +LA D   S++   + +       L+ A    L R  R+     +  +Q+ E +A+DW++GN Y+ D+    I   D         +      ++  ++ +   L +DP +  +F+   G    +ER  +DG++R  +    + + + +A+D  +K+++W    LD  I  VDYQG+   ++   G+       FL    ++      + E L V  F     IS   +   N+     +   H+L  P+ +  +  M+R      CS ICL  ++  Y+   C C TG +   +   C   P    F+    G P  I  + +     D  ++P  +L++     P    Y   T  + + D  S  I    ++  G       +     D    I+VD    N+YW N         +  S  RL+ A+     Q   T  E        P  + VD +N +++ T      + D    IE+ W+DG+ +   ++S N  WP GL LD     +++ D    D I   +  GS R++  + +E      +S++ +FI+WTE    S+  +       +L+   R      +  + V    S    + C      C  LC  I G +    C C++
Sbjct:  216 ILALDFLHSQESVCWSLSTESSGQLRCAVTRNLRRFTREQEIRTQHSLQNVEQMAIDWLTGNYYFVDRVTNKIFACD--------RTGITCVTIVQLDLLNPKGLALDPVKGMMFFTDYGNAAKIERCNMDGTNRTRLVDHRIEQPTAVALDVIKKLVYWADAYLD-YIDVVDYQGKNRHTI-AHGSQVTVFEDFLYAVHSDPTRASSSVELLQVHRFN----ISADSRKLANLGNSRALRVYHKLTQPKAKSHACEMDRYGKPGGCSHICL--LNGNYKSRTCRCRTGYSLGYDGKSCKK-PKSDFFLFYGKGRPGVIRGLDMNIKSSDEHMEPIEDLVN-----PRAIDYHVETGYVYFADTTSFLIGRQKIDGSGRETILKDEL----DNVEGISVDWIGNNLYWTNDG-----YRKTISVARLENAS-----QTRKTLLEGNMSH---PRAIVVDPLNSWMYWTDWEEDEVNDSIGRIEKAWMDGSNRGIFVTS-NMLWPNGLTLDHSTSTMFWCDAYY-DHIEKIHLNGSGRMVVYRGKELNHPFGISHYGDFIFWTEYMNASVFQLDLSTGDVTLLRSER----PPLFGLRVYDAQSQQGDNACSVNYGGCATLCLAIPGGR---VCACAD 804          

HSP 3 Score: 83.9593 bits (206), Expect = 2.035e-15
Identity = 132/610 (21.64%), Postives = 222/610 (36.39%), Query Frame = 3
Query: 2985 CSQFCLPVE-SRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKF-IDAVYWLSKNIVLRLDNYG-------------------FISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGI-PSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDE-VGCNTCNIS----HLYSCSRSDVCLPITKRCDGVMDCDSDEQCCGSQKFECLSGK-DVTR---CLPISARCNGIVDCRDGSDEHGC 4721
            C+Q C  +    +C C   + L  DG TCVD+ +   ++  +   I   G+      D  + ++    + + ++A + F I A +   + + +   NY                    FI  VD TRP    +K  ++ +   D+K               +     +LA+D I   L W D       AE+   +  +   L   I      + P  + + P +  + W+                   I    +DG  +++++      P+ LT+D  + R+YW D             DN      H++  NM  T    +S+       ++ + + +++WTD       S S+    K   + G+   N       +K++    +   PE          +  H C     ++ N  CSHLCL +                   G+ +C+CP +  +   +        K+ L  C   Q  CG               C+    +CD+  DC DGSDE   C    +S      + C      LP    CDG  DC  +      + + CLSG+   TR   C+P++ RCNG  DC DG DE  C
Sbjct: 2826 CTQDCQDLTVGYKCKCWPGFHLKDDGKTCVDIDECSTILPCSQRCINTYGSFRCLCVDGYEALDRNPNTCKAVSAEEPFLIMADHHEIRKLSVDGSNYTILKQGLYNIIHLDFDYKKEFIYWVDSTRPSG--RKINRMRLNGSDLK------------IVHRTAVPSALAVDWIGKNLYWCD-------AEKKTLEVSKANGLYPTILISSGLKNPTDLTLDPQTGYVFWVDC------------CEPPHIGRVGMDGRGQTIIIDTEIYSPTALTIDYTNKRLYWAD-------------DN------HILFANMDGTQRHKVSSDHIQGVMALTLFEDFVYWTD-----GKSKSLRRAHKTMGSQGIELLNSW---QAIKSIKVYHSLRQPE----------VPKHQC-----QIANGGCSHLCLLSP-----------------GGEHKCACPTNFYLAADN--------KTCLSNCTSSQFRCGTD------------ECIPFWWKCDTVDDCGDGSDEPADCQNLKLSFPCPGRFQCGTGLCALPPFI-CDGENDCGDNTDEANCETYICLSGQFKCTRKQKCIPLNLRCNGQDDCGDGEDETDC 3322          

HSP 4 Score: 65.855 bits (159), Expect = 6.126e-10
Identity = 72/298 (24.16%), Postives = 122/298 (40.94%), Query Frame = 3
Query:  174 FLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFW--------WGLDG-EIHRVDYQGQTGCSMRVQGTWK-QWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLF 1037
            F  +K +++ +     S  K  N  +L+   ++ V +  V SA  +AVDW+  NLYW D + + +EV   N    +P             + +   L +DP   Y+FW+       + R  +DG  + +I  + ++  + L ID   K L+W          +DG + H+V        S  +QG         F+ +T+GK   +      + S     GI + L +   I  I +     Q  VP  + +    N  CS +CL      ++C+C T      +N  C +  T S F
Sbjct: 2938 FDYKKEFIYWVDSTRPSGRKI-NRMRLNGSDLKIVHRTAVPSA--LAVDWIGKNLYWCDAEKKTLEVSKAN--GLYPTILISS------GLKNPTDLTLDPQTGYVFWVDCCEPPHIGRVGMDGRGQTIIIDTEIYSPTALTIDYTNKRLYWADDNHILFANMDGTQRHKVS-------SDHIQGVMALTLFEDFVYWTDGKSKSLRRAHKTMGS----QGIEL-LNSWQAIKSIKVYHSLRQPEVP--KHQCQIANGGCSHLCLLSPGGEHKCACPTNFYLAADNKTCLSNCTSSQF 3210          

HSP 5 Score: 61.6178 bits (148), Expect = 1.215e-8
Identity = 56/191 (29.32%), Postives = 79/191 (41.36%), Query Frame = 3
Query: 4260 DGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAG---------LVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC---DSDEQC-------CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVI 4775
            DG    +C       H+ R +   C+     +CD  Q  CG G             K    +   C+S + RCD   DCLD SDE GC        + C  ++ C+ +   CDG  DC   + ++ C       C   ++ C SG     C+  S RC+G  +C DGSDE GC +  R      L+ A  I
Sbjct: 3355 DGSDEANCDEKTCGPHEFRCENNNCIPDHW-RCDS-QNDCGDGSDENNCKPVTCNHKDFACANGECISSRFRCDGDYDCLDNSDENGCEAHCADDQFQC-HNNYCISLKWVCDGQEDCKMGEDEKNCQATAVPSCSVNEYVCASGG----CVSASLRCDGHDNCLDGSDEIGCVKECREDEFLCLNRAHCI 3538          

HSP 6 Score: 59.6918 bits (143), Expect = 4.813e-8
Identity = 50/234 (21.37%), Postives = 99/234 (42.31%), Query Frame = 3
Query: 1263 IPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSK-RILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSC 1961
            +P ++AVD   +N+YW +     + V++ +      Y T+L+S               + P DL +D    Y+F     +    I R  +DG  + T+I  T  + P  L +D   ++LY+ D     ++  N  G  + ++ +   Q  ++L+ F++F+YWT+ ++ S+         + +         +++ V    R   +     C   +  C  LC    G +H  +C
Sbjct: 2976 VPSALAVDWIGKNLYWCDAEKKTLEVSKANGL----YPTILIS------------SGLKNPTDLTLDPQTGYVFWVDCCEPP-HIGRVGMDGRGQ-TIIIDTEIYSPTALTIDYTNKRLYWAD--DNHILFANMDGTQRHKVSSDHIQGVMALTLFEDFVYWTDGKSKSLRRAHKTMGSQGIELLNSWQAIKSIKVYHSLRQPEVPK-HQCQIANGGCSHLCLLSPGGEHKCAC 3188          

HSP 7 Score: 58.151 bits (139), Expect = 1.374e-7
Identity = 64/264 (24.24%), Postives = 107/264 (40.53%), Query Frame = 3
Query:  249 KLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWA-DQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQI------GAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFE--CGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCP 1013
            K+D      +LK  + + E ++VDW+  NLYW  D   + I V  L   S      + R+ LL  NM+   ++VVDP   +++W          +I  +E++ +DGS+R +   S +   + L +D     +FW   D     ++     G    V    K+ +  F     G  +F   E +  S F+    TG    L++     P     R +     +G          C+++CL I      C+C+       NN  CP
Sbjct:  566 KIDGSGRETILKDELDNVEGISVDWIGNNLYWTNDGYRKTISVARLENAS------QTRKTLLEGNMSHPRAIVVDPLNSWMYWTDWEEDEVNDSIGRIEKAWMDGSNRGIFVTSNMLWPNGLTLDHSTSTMFW--CDAYYDHIEKIHLNGSGRMVVYRGKELNHPFGISHYGDFIFWT-EYMNASVFQLDLSTGDVTLLRSE---RPPLFGLRVYDAQSQQGDNACSVNYGGCATLCLAIP-GGRVCACADNQVLEKNNVTCP 816          

HSP 8 Score: 52.373 bits (124), Expect = 7.583e-6
Identity = 38/101 (37.62%), Postives = 49/101 (48.51%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC--DSDEQCCGSQKFECLSGKDV---TRCLPISARCNGIVDCRDGSDE 4712
             C+S   RCD   +CLDGSDE+GC        + C     C+P   RCD V+DC   SDE+ C      C + + +   T C      C+G  DC D SDE
Sbjct: 3497 GCVSASLRCDGHDNCLDGSDEIGCVKECREDEFLCLNRAHCIPRRWRCDDVLDCMDHSDEEDCSHGATFCRADEFICNNTLCKLHIWVCDGKDDCGDNSDE 3597          

HSP 9 Score: 51.9878 bits (123), Expect = 8.969e-6
Identity = 42/128 (32.81%), Postives = 55/128 (42.97%), Query Frame = 3
Query: 4377 CGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLY----------SCSRSDVCLPITKRCDGVMDCD--SDE-QC---CGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDE 4712
            CG     S +      SC+     C+  +DC D SDE  CN  + SH Y          SC+ + +C+  +  CDG  DC   +DE  C   C    F C        C+P    C+G  DC DGSDE
Sbjct: 2531 CGNITCGSSESSCKDGSCIPSSVWCNQVIDCPDASDEKNCNHTDCSHFYKLGVKERDFISCNSTSLCIHPSWVCDGANDCGDYADETNCTVTCAPGLFSCPGS---YACVPKRWLCDGERDCPDGSDE 2655          
BLAST of Low-density lipoprotein receptor-related protein vs. Planmine SMEST
Match: SMESG000010458.1 (SMESG000010458.1)

HSP 1 Score: 3723.71 bits (9655), Expect = 0.000e+0
Identity = 1886/1894 (99.58%), Postives = 1887/1894 (99.63%), Query Frame = 3
Query:   48 MIRTIIIVFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPXXXXXXXXXXXXNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNISRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKWSEFQXXXXXXXXXXXXXXXXXHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAERLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCDSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSVALSACSFAIIYICLSRRIRHKTVHESCLFRANNVNIMFMSNTANRRPRPYRSSSTCDRHNLSPTINLHHAKSCDIIDNINGYDAHDPTTQSLTSLSECYRQIKNPQPCPYASILGRPLFSMQDDVLFQLSRFRPLITHCASNSSIKKIEKLPPSEVTINSDTGDKQDDPIDKNNEILSSPCESELEEIYVHRYQMSRQPTQFDNYPSCLLQNLLSACNQTPQLCNTPTTVYKDLVVENVXXXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXXXXXXXXEFYQNSSSNLDISPPPPSPITVELA 5729
            MIRTIIIVFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPISRERRRILLSRNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSN AHVL N+SRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRK SEFQLSLDILSKVSSSSSEWLHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHF SKEFSRYSLAIDPISDTLLWSDWVTGIIAAE LNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNL YLKDKLKT VRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCDSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSVALSACSFAIIYICLSRRIRHKTVHESCLFRANNVNIMFMSNTANRRPRPYRSSSTCDRHNLSPTINLHHAKSCDIIDNINGYDAHDPTTQSLTSLSECYRQIKNPQPCPYASILGRPLFSMQDDVLFQLSRFRPLITHCASNSSIKKIEKLPPSEVTINSDTGDKQDDPIDKNNEILSSPCESELEEIYVHRYQMSRQPTQFDNYPSCLLQNLLSACNQTPQLCNTPTTVYKDLVVENVYRRKRRKLLKYRKPRSFSKGKLSLSSSRRTRSDRSQYTSEFYQNSSSNLDISPPPPSPITVELA
Sbjct:    1 MIRTIIIVFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYVFVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWADQKNQFIEVVDLNVDSDFPISRERRRILLSRNMADIHSLVVDPWEQYLFWLQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGEIHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFECGTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIVDSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPLELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDFPISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQPSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQKFTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQKFQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPVIAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNPAHVLRNLSRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDHYRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNLYASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLKFLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYVCWKSSDSGKIYRYEIVNRKRSEFQLSLDILSKVSSSSSEWLHIYPNSRSLYLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAISTKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVESRECGCGSVYSLSADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQPINAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQEHDIKTDTSYSENLYKHFVSKEFSRYSLAIDPISDTLLWSDWVTGIIAAEHLNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETNDSSVWHQFWIEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNKLMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLFWTDWFQQIFASISVNSDIKPSAAMGMHFYNLLYLKDKLKTAVRIMARIAPEDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMTAQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCDSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSVALSACSFAIIYICLSRRIRHKTVHESCLFRANNVNIMFMSNTANRRPRPYRSSSTCDRHNLSPTINLHHAKSCDIIDNINGYDAHDPTTQSLTSLSECYRQIKNPQPCPYASILGRPLFSMQDDVLFQLSRFRPLITHCASNSSIKKIEKLPPSEVTINSDTGDKQDDPIDKNNEILSSPCESELEEIYVHRYQMSRQPTQFDNYPSCLLQNLLSACNQTPQLCNTPTTVYKDLVVENVYRRKRRKLLKYRKPRSFSKGKLSLSSSRRTRSDRSQYTSEFYQNSSSNLDISPPPPSPITVELA 1894          
BLAST of Low-density lipoprotein receptor-related protein vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.885e-10
Identity = 42/126 (33.33%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 4356 CDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC----DSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            CD  Q  C           +S  +C+ + ++CD T +C D SDE+ C    + H   C+ S  C+   K CDG  DC     SDE+ C   +       +   C+ ++ +C+G  DC DGSDEHGC
Sbjct: 1512 CDLQQFQC-----------ISNGACIPMTKKCDGTQNCEDNSDEISCGC--LPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGC 1624          

HSP 2 Score: 52.373 bits (124), Expect = 5.259e-6
Identity = 35/119 (29.41%), Postives = 55/119 (46.22%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCL--DGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQKFECLSGKDVT----------------RCLPISARCNGIVDCRDGSDEHGC 4721
            +C+  ++ CD   DC   D SDE  C  C ++  Y C+ S +C+ +  +CDG  DC   SDE  C     EC+  +                   +C+  + +C+G+ DC +G DE  C
Sbjct: 1561 TCIEEKKICDGNYDCGVNDKSDEENCKKCQMTE-YKCNNSQICILLNNKCDGQDDCGDGSDEHGC-----ECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNC 1673          
BLAST of Low-density lipoprotein receptor-related protein vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.932e-10
Identity = 42/126 (33.33%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 4356 CDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC----DSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            CD  Q  C           +S  +C+ + ++CD T +C D SDE+ C    + H   C+ S  C+   K CDG  DC     SDE+ C   +       +   C+ ++ +C+G  DC DGSDEHGC
Sbjct: 1353 CDLQQFQC-----------ISNGACIPMTKKCDGTQNCEDNSDEISCGC--LPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGC 1465          

HSP 2 Score: 52.373 bits (124), Expect = 5.622e-6
Identity = 35/119 (29.41%), Postives = 55/119 (46.22%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCL--DGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQKFECLSGKDVT----------------RCLPISARCNGIVDCRDGSDEHGC 4721
            +C+  ++ CD   DC   D SDE  C  C ++  Y C+ S +C+ +  +CDG  DC   SDE  C     EC+  +                   +C+  + +C+G+ DC +G DE  C
Sbjct: 1402 TCIEEKKICDGNYDCGVNDKSDEENCKKCQMTE-YKCNNSQICILLNNKCDGQDDCGDGSDEHGC-----ECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNC 1514          
BLAST of Low-density lipoprotein receptor-related protein vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.981e-10
Identity = 42/126 (33.33%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 4356 CDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC----DSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            CD  Q  C           +S  +C+ + ++CD T +C D SDE+ C    + H   C+ S  C+   K CDG  DC     SDE+ C   +       +   C+ ++ +C+G  DC DGSDEHGC
Sbjct: 1353 CDLQQFQC-----------ISNGACIPMTKKCDGTQNCEDNSDEISCGC--LPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGC 1465          

HSP 2 Score: 52.373 bits (124), Expect = 5.669e-6
Identity = 35/119 (29.41%), Postives = 55/119 (46.22%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCL--DGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQKFECLSGKDVT----------------RCLPISARCNGIVDCRDGSDEHGC 4721
            +C+  ++ CD   DC   D SDE  C  C ++  Y C+ S +C+ +  +CDG  DC   SDE  C     EC+  +                   +C+  + +C+G+ DC +G DE  C
Sbjct: 1402 TCIEEKKICDGNYDCGVNDKSDEENCKKCQMTE-YKCNNSQICILLNNKCDGQDDCGDGSDEHGC-----ECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNC 1514          
BLAST of Low-density lipoprotein receptor-related protein vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.982e-10
Identity = 42/126 (33.33%), Postives = 61/126 (48.41%), Query Frame = 3
Query: 4356 CDRYQIPCGAGLVFSKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDC----DSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCRDGSDEHGC 4721
            CD  Q  C           +S  +C+ + ++CD T +C D SDE+ C    + H   C+ S  C+   K CDG  DC     SDE+ C   +       +   C+ ++ +C+G  DC DGSDEHGC
Sbjct: 1353 CDLQQFQC-----------ISNGACIPMTKKCDGTQNCEDNSDEISCGC--LPHQIVCNISRTCIEEKKICDGNYDCGVNDKSDEENCKKCQMTEYKCNNSQICILLNNKCDGQDDCGDGSDEHGC 1465          

HSP 2 Score: 52.373 bits (124), Expect = 5.670e-6
Identity = 35/119 (29.41%), Postives = 55/119 (46.22%), Query Frame = 3
Query: 4425 SCMSVQQRCDSTVDCL--DGSDEVGCNTCNISHLYSCSRSDVCLPITKRCDGVMDCD--SDEQCCGSQKFECLSGKDVT----------------RCLPISARCNGIVDCRDGSDEHGC 4721
            +C+  ++ CD   DC   D SDE  C  C ++  Y C+ S +C+ +  +CDG  DC   SDE  C     EC+  +                   +C+  + +C+G+ DC +G DE  C
Sbjct: 1402 TCIEEKKICDGNYDCGVNDKSDEENCKKCQMTE-YKCNNSQICILLNNKCDGQDDCGDGSDEHGC-----ECICKEPEMILCETERTSTTEERNCQCINGTKQCDGVYDCWNGFDEKNC 1514          
The following BLAST results are available for this feature:
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRP54.460e-7123.46LDL receptor related protein 5 [Source:HGNC Symbol... [more]
LRP41.135e-5222.61LDL receptor related protein 4 [Source:HGNC Symbol... [more]
LRP67.006e-3922.35LDL receptor related protein 6 [Source:HGNC Symbol... [more]
LRP67.006e-3922.35LDL receptor related protein 6 [Source:HGNC Symbol... [more]
LRP61.290e-3822.35LDL receptor related protein 6 [Source:HGNC Symbol... [more]
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp-16.664e-2920.84Low-density lipoprotein receptor-related protein ... [more]
lrp-26.524e-1422.59Low-density lipoprotein RecePtor related [Source:... [more]
nid-11.791e-1324.37NIDogen (Basement membrane protein) [Source:UniPr... [more]
lrx-15.091e-1334.71LRP X(Cross)-hybridizing [Source:UniProtKB/TrEMBL... [more]
nid-15.798e-1324.14NIDogen (Basement membrane protein) [Source:UniPr... [more]
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arr2.491e-5321.23gene:FBgn0000119 transcript:FBtr0087702[more]
Lrp43.637e-3122.02gene:FBgn0030706 transcript:FBtr0074125[more]
Lrp43.698e-3122.02gene:FBgn0030706 transcript:FBtr0301666[more]
Lrp43.698e-3122.02gene:FBgn0030706 transcript:FBtr0340309[more]
mgl5.523e-3120.65gene:FBgn0261260 transcript:FBtr0343371[more]
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp52.911e-6722.62low density lipoprotein receptor-related protein 5... [more]
lrp52.911e-6722.62low density lipoprotein receptor-related protein 5... [more]
lrp59.312e-5722.34low density lipoprotein receptor-related protein 5... [more]
lrp1ba8.480e-3721.89low density lipoprotein receptor-related protein 1... [more]
lrp2b1.360e-3220.97low density lipoprotein receptor-related protein 2... [more]
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpa333.835e-4721.61glycoprotein A33 (transmembrane) [Source:Xenbase;A... [more]
polk2.097e-4123.62polymerase (DNA directed) kappa [Source:Xenbase;Ac... [more]
polk2.297e-4123.62polymerase (DNA directed) kappa [Source:Xenbase;Ac... [more]
polk2.354e-4123.62polymerase (DNA directed) kappa [Source:Xenbase;Ac... [more]
polk2.589e-4123.62polymerase (DNA directed) kappa [Source:Xenbase;Ac... [more]
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrp53.811e-7224.32low density lipoprotein receptor-related protein 5... [more]
Lrp43.841e-5022.57low density lipoprotein receptor-related protein 4... [more]
Lrp68.143e-4022.66low density lipoprotein receptor-related protein 6... [more]
Lrp13.331e-3921.11low density lipoprotein receptor-related protein 1... [more]
Lrp22.806e-3122.35low density lipoprotein receptor-related protein 2... [more]
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91VN0|LRP5_MOUSE2.666e-7124.32Low-density lipoprotein receptor-related protein 5... [more]
sp|O75197|LRP5_HUMAN2.142e-7023.46Low-density lipoprotein receptor-related protein 5... [more]
sp|O75096|LRP4_HUMAN6.137e-5222.61Low-density lipoprotein receptor-related protein 4... [more]
sp|Q9QYP1|LRP4_RAT6.348e-5222.72Low-density lipoprotein receptor-related protein 4... [more]
sp|Q8VI56|LRP4_MOUSE2.687e-4922.57Low-density lipoprotein receptor-related protein 4... [more]
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U3D8T71.541e-6923.86Low-density lipoprotein receptor-related protein O... [more]
F7B2X41.701e-6923.86Low-density lipoprotein receptor-related protein O... [more]
A0A2K6S5082.108e-6923.96Low-density lipoprotein receptor-related protein O... [more]
U3D8R22.490e-6923.86Low-density lipoprotein receptor-related protein O... [more]
G3VNB77.509e-6923.25Low-density lipoprotein receptor-related protein O... [more]
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp56.169e-4423.89low density lipoprotein receptor-related protein 5... [more]
lrp61.278e-4223.57LDL receptor related protein 6 [Source:NCBI gene;A... [more]
lrp1bb4.091e-3321.01LDL receptor related protein 1B [Source:NCBI gene;... [more]
lrp1ba4.549e-3022.02low density lipoprotein receptor-related protein 1... [more]
lrp1ab1.767e-2920.08low density lipoprotein receptor-related protein 1... [more]
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp1ab1.369e-2919.72low density lipoprotein receptor-related protein 1... [more]
lrp2a1.038e-2722.02low density lipoprotein receptor-related protein 2... [more]
ENSPMAT00000009373.12.060e-1924.84pep scaffold:Pmarinus_7.0:GL477430:65055:99670:-1 ... [more]
ENSPMAT00000001145.12.287e-1522.37pep scaffold:Pmarinus_7.0:GL476464:197894:249856:-... [more]
sorl14.459e-1325.38sortilin-related receptor, L(DLR class) A repeats ... [more]
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491331.168e-5522.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483573.529e-3021.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494981.160e-1523.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494976.794e-1222.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480695.835e-1122.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp52.067e-6822.61LDL receptor related protein 5 [Source:NCBI gene;A... [more]
lrp67.129e-6022.30LDL receptor related protein 6 [Source:NCBI gene;A... [more]
lrp55.400e-4223.77LDL receptor related protein 5 [Source:NCBI gene;A... [more]
lrp51.517e-3423.41LDL receptor related protein 5 [Source:NCBI gene;A... [more]
lrp1bb2.405e-3221.57LDL receptor related protein 1B [Source:NCBI gene;... [more]
back to top
BLAST of Low-density lipoprotein receptor-related protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010458.10.000e+099.58SMESG000010458.1[more]
SMESG000042718.11.885e-1033.33SMESG000042718.1[more]
SMESG000042718.11.932e-1033.33SMESG000042718.1[more]
SMESG000042718.11.981e-1033.33SMESG000042718.1[more]
SMESG000042718.11.982e-1033.33SMESG000042718.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019756 ID=SMED30019756|Name=Low-density lipoprotein receptor-related protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5993bp
CTATATAAATCTTATATGGATTCACTAAATCGCTTTGTTAATAAAAAATG
ATACGAACGATTATTATTGTTTTTCTTTACGCTTCGTATCATGTTTTGTC
TAAATCCATTTTGCATCGGCACGGTGTCGATATTTTTTTCAACACAGATT
TGAAATTATTGGCTGCAGATGTATTTTTGTCAAGGAAATTATACGTTTTT
GTAATTCAAGAAAATGGCAAGTCATTATTAAAAACTGCAAATTTCAGCAA
ATTAGATCGCAGAAAGATGCGAGACGTATTGAAATTCCCGGTCCAATCAG
CCGAATCGGTTGCTGTCGACTGGGTCAGTGGCAACCTGTATTGGGCGGAC
CAAAAGAATCAGTTCATAGAAGTAGTTGATTTGAATGTCGATTCCGATTT
CCCAATATCCAGAGAAAGACGACGAATTTTACTGTCGAGAAATATGGCGG
ATATCCATTCATTAGTTGTCGATCCCTGGGAGCAGTATTTATTCTGGTTG
CAAATCGGCGCTATAATGGTGCTCGAAAGGTCCCGCCTTGATGGCTCCGA
CAGGCGAGTCATTCACAAGTCGATTTTATTTAAGAGTTCTCAGTTGGCAA
TAGATAGACATCGTAAAATGCTGTTCTGGTGGGGTCTGGACGGTGAGATT
CACCGGGTGGATTATCAGGGCCAGACCGGGTGTAGCATGCGAGTGCAAGG
AACCTGGAAGCAATGGAGTCCAACATTCCTCACATTCACCGAAGGGAAAC
TTGTATTCATTAATGATGAGCAGCTATGGGTGTCATCATTTGAATGCGGT
ACCGGCATATCTATTGCGTTAAAAACAAATCCTAACATTGCCCCGATAGC
CATCATTTCTAGGAAGCATCAATTAATGGTTCCCAGAGGGAGGCGCAAGA
GTCCTTGCATGAATAGGGTGTGTTCCTCTATATGTTTACCGATAGTCGAC
AGTGCTTATCGATGCTCATGCTCCACCGGCATTACTGAACCAATTAACAA
CGCCGTCTGTCCAACATTTCCGACGCGTTCTCTTTTCATTGGAAATCCTC
CGAAAATCTATCACATGTCATTGGATGGTGGTTTGCAGCCGCCATTGGAA
CTGTTATCTGAGAATGCTGGAATCCCTTTTCGTTTCGCTTACGATTCAGT
GACATCTTCTCTTCTCTATGTCGATTTCAACTCCAGTTCGATCTTTTCTT
TGGATCTCAACAAATATGGAACTCCACAGAGATTTTACCTTGACTTTCCG
ATCTCATCCGATATTCCTGTTAGCATTGCCGTCGATTCTGCTTCTCGTAA
TATCTACTGGATGAATCATCGCAATTCAGAGGTTTGGGTCGCTCGGATTA
GCTCGTTTAATCGACTGAAATATGCAACTCTCCTCTTGTCCTGGCAGCCC
AGCCCGACATTCAAGGAATCCCGTTACCAGCAAAATCAGCCCCCTGGTGA
CCTGGCCGTGGATAGCATCAATCGGTATTTGTTTGTAACCGTTATTACAG
ATGGCACCTGCTCCATTGAGAGATACTGGCTTGATGGCACTCAAAAGTTC
ACAGTGATCTCCTCTACAAATGATTTCTGGCCACGGGGCCTCGCTCTTGA
TGAGTATAGGCAGCAATTATATTTTGTTGACACGGTTAAGGGTGACATGA
TCAGTGTCAATTATCACGGCGGAAGCAAGCGAATTCTAGCTCAGAAATTT
CAAGAGTTTATCAGTTTGTCATATTTTGATAATTTCATTTACTGGACCGA
ATTGGAAACTCTCTCCATCCATTCTGTGAAATTTGACGGTTCGATGCGTT
CACTAGTGACCAAGACGAGGAATCTCGACGCCAGAACGATGCCTGTTATT
GCCGTGTCAAGGAACGCATCAATCGACACCGGATCTCCGTGTTATTCGAC
ATCGAATAAATGCGATCAACTTTGTTTCCCAATCCGGGGAAATCAACATT
CCTTCTCTTGCGGTTGCTCCAATCGGGCACATGTGCTTCTGAATATTTCA
CGATGCAGCTATTCCTCGGAAATGATAGTCTATTTCAACAAGTCAATGCT
CATCACTCACCACTTAACTCCAAATACCGACAAGCAGTACATTGAATTGG
GCAAAGGAGAGTCTGATGTTCAGGTTGCCTCGCTGCAATTGGATCACTAC
CGAAATCAAATCTATTGGATTAATCAGGCGGCAAATTGCATCATGAAAAC
GGCCAGTAATACTGACATCCAACGGCAACTGAAGATCTTTTGTCTGTCCT
CTGATACCATCTCAAATCTCGCTGTTGATTTTATCCGCAACAATCTCTAC
GCCTCGGTAACTAGCTCGGCCTGGAGTCGGATAATGATTATACGATTACC
TTTTACGCATTCTGATGTTTCCTGGACAAATGTCGTTGTCTCAACGAAGA
TCAAAAACAAAATTCTCGGCGCAGTTTCCGTTCATTCGGATTTAAAATTT
CTGTTCTGGTTCGAAACGAAAACGAAAGATCGACAGAATGTTGCCGAGCT
ATTCCAAGCTCATCTCGATGGCAGTCAGCCAATGCTGATATGGAGAGGTG
TGGCAGATATTGATGAGCTGGTTGTAGATGAGCAAGCTAATTATGTGTGC
TGGAAAAGCAGTGACAGTGGGAAGATATACAGATATGAAATCGTCAACAG
GAAATGGAGCGAGTTTCAATTGTCTCTGGATATCCTTAGCAAGGTGAGCA
GCAGTTCCTCCGAATGGCTGCACATTTATCCAAATTCTCGCTCCCTATAC
TTGTTTATGGCTGATTCAATTTATCAAGTGACCCTTTCGGATTCCAGTTC
GTCGATAACGAGGAAACAGTTGACATTCATTTCCAATGTCGGACATTCAG
CAGGAATACGCGGCTTTTCCTTTGTTTCCAGATCCATTGCTATATCGACA
AAGAAAATCGCGCTCGCTAAGTCTGATATTGGGACAGAATCCGTAATTTT
ATGTCCAACACATAATCATGACAATTTTCTTACGTGCTCTCAATTCTGTT
TGCCAGTTGAGTCCAGAGAATGCGGCTGTGGGTCTGTTTATTCTCTGAGT
GCCGACGGGGCAACTTGCGTTGATTTGAGTGATTTGCTTATGGTTATGAC
AAATACCGGTGAAATAATTGGAATTCGGGGGAACATTTTAAATGAAAAAG
ACGATGAGATAGATTTTGTGGAATGGGTAGAATTGTCAGAGCAACCAATC
AACGCTGGGCAAAAGTTTATCGATGCTGTCTATTGGCTGAGTAAGAACAT
CGTGTTACGATTGGACAATTATGGATTTATCAGTGCAGTCGATCGCACTC
GGCCGTATGTTATGATCAAAAAATACAAGCAATTGTCTGTACAAGAGCAT
GACATCAAAACCGATACGAGCTATTCTGAAAATCTCTATAAACACTTCTT
TTCTAAAGAATTTTCTCGCTACAGTTTAGCTATAGATCCGATCAGTGATA
CGCTGTTATGGTCAGACTGGGTTACTGGGATAATTGCTGCAGAACGCCTC
AATGCCGATAAGGACAGAATTGAATATCTGGGAGTTATCATAAATTTTCG
TGAATCTCGTCGTAGGCCACTGCAAATTGCGATCGCTCCTATTTCTAGTT
CTCTAATCTGGTTGAGTGCTGACTTTTCAAAGTCTGAAACGAATGATAGT
TCAGTTTGGCATCAGTTCTGGATTGAGATGTCTGACTTGGATGGTAATCG
GCGTTCGGTTCTCGTTAAGAATCCTGGAATTCCTTCGTGTCTCACAGTCG
ATGTGCACTCTGGTAGAATCTATTGGATTGATACCAAGACAAACAAGCTA
ATGTATTTGCATATCCATTGGGATAACTATCAAATCCGAGCCGGTCATGT
CATTGGACATAATATGAAGGTTACAGTTGATTCCTTGCTCTCCAATGGTG
TAGGGTTCTCCACTTCATCAATGGTCGTCCTCAAGAAGTATTTATTCTGG
ACCGATTGGTTCCAGCAGATTTTTGCCAGTATTTCCGTAAATTCTGACAT
CAAACCATCAGCAGCGATGGGAATGCATTTTTATAATCTGCAATATCTGA
AAGACAAATTGAAAACAGTCGTAAGAATAATGGCTCGAATAGCACCGGAG
GATTTCAAGAGCTCGTCACTGGGCACCCTGCTGCAGAATCATCCATGTTC
TCGTGCCTCCCACGAGATGGAAAACAAGCGCTGTTCACATCTCTGCCTGT
CGACTCTACCAATAAGTCTAGCGGAGGAATATTCCTTTCTAATGACGGCG
CAACAATTGGATGGGAAATTCCGATGCTCTTGTCCTGTGTCAATGTCAGT
GACTCACAAGTCCCGGCATAAAATCGGGTTCTGTGTCAAATCGCAACTAG
TGAAATGTGACAGGTACCAGATTCCGTGTGGGGCCGGTCTTGTATTCTCC
AAGAAGGAAGGAATGTCGGTAATGAGTTGCATGTCAGTGCAACAGCGCTG
CGATTCGACAGTTGATTGCTTGGACGGCTCGGATGAGGTTGGCTGTAACA
CTTGTAATATCAGCCATTTGTACAGCTGTTCTCGGTCAGACGTGTGCTTG
CCGATCACAAAGCGATGTGACGGAGTGATGGATTGTGATTCCGATGAACA
ATGTTGTGGAAGCCAGAAATTTGAGTGCCTCAGTGGAAAAGACGTTACTC
GGTGCCTCCCTATATCAGCGAGGTGTAATGGGATTGTTGATTGCAGAGAT
GGGAGTGATGAGCACGGTTGTAATCGTAATAATAGGAACCGAGCCCTGTC
TACCCTTGATCCAGCTACTGTAATAAATCTTCCAAACAATTACACAGTGG
CAATTATTGCCGGTTCCGTTGCCCTGTCAGCTTGCAGTTTTGCCATAATT
TATATCTGTTTGTCTCGTCGCATTCGACACAAAACTGTCCACGAATCTTG
CCTATTTCGCGCCAATAACGTCAATATTATGTTCATGTCTAACACAGCCA
ACAGAAGACCTAGACCATATAGATCAAGTTCCACTTGTGATCGGCACAAT
CTTAGTCCTACTATTAATCTTCATCATGCCAAATCTTGTGACATTATCGA
CAATATTAATGGATACGATGCCCATGATCCTACTACCCAATCATTGACCT
CACTGTCGGAATGTTACCGACAAATCAAAAATCCTCAGCCTTGTCCCTAC
GCATCGATATTGGGTAGACCTTTGTTTTCCATGCAGGACGATGTTTTGTT
CCAATTGTCAAGGTTCAGGCCCCTGATCACTCACTGTGCCAGTAATAGCA
GCATCAAGAAAATAGAAAAACTTCCCCCTAGTGAAGTAACAATTAACAGT
GACACTGGAGACAAACAAGACGACCCAATTGATAAAAATAATGAAATTCT
ATCGAGTCCATGTGAATCTGAGCTTGAAGAGATATATGTTCACAGATATC
AAATGAGTCGGCAGCCGACACAATTCGATAATTATCCATCGTGTTTATTG
CAAAACCTGTTATCGGCCTGCAATCAAACTCCTCAGTTATGCAACACTCC
AACGACAGTTTACAAAGATTTGGTTGTGGAAAATGTTTATCGACGTAAAA
GAAGAAAACTACTGAAATATAGGAAACCACGTAGTTTTTCAAAAGGAAAA
TTATCTTTGTCGTCATCTAGAAGAACAAGATCAGATCGTTCACAATATAC
ATCAGAGTTCTATCAAAATTCTTCATCGAATCTCGATATCTCTCCTCCAC
CACCCAGTCCGATAACAGTTGAGTTGGCATGAGGGACCCCGCATTTCATT
CGCCTGCTCGTGGCATACTGTCATATCATGTGTATATGCGTCATGAACTC
GTGTAAAATAGTTTGGAATTTTATTTTCGTTGTTTAGATGGAAGACTTAT
TTTAATATTGCATTTTATTATTGTATTGTTTTAGATCCGTTCATTTTTAG
ATAATATTTTTGTGAAATTATTGGTAATGATGGCATTAAACATTTTATTG
GTTTTATGTGAAAATTGGTTTATATAATATATCTGACTCCTGA
back to top

protein sequence of SMED30019756-orf-1

>SMED30019756-orf-1 ID=SMED30019756-orf-1|Name=SMED30019756-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1895bp
MIRTIIIVFLYASYHVLSKSILHRHGVDIFFNTDLKLLAADVFLSRKLYV
FVIQENGKSLLKTANFSKLDRRKMRDVLKFPVQSAESVAVDWVSGNLYWA
DQKNQFIEVVDLNVDSDFPISRERRRILLSRNMADIHSLVVDPWEQYLFW
LQIGAIMVLERSRLDGSDRRVIHKSILFKSSQLAIDRHRKMLFWWGLDGE
IHRVDYQGQTGCSMRVQGTWKQWSPTFLTFTEGKLVFINDEQLWVSSFEC
GTGISIALKTNPNIAPIAIISRKHQLMVPRGRRKSPCMNRVCSSICLPIV
DSAYRCSCSTGITEPINNAVCPTFPTRSLFIGNPPKIYHMSLDGGLQPPL
ELLSENAGIPFRFAYDSVTSSLLYVDFNSSSIFSLDLNKYGTPQRFYLDF
PISSDIPVSIAVDSASRNIYWMNHRNSEVWVARISSFNRLKYATLLLSWQ
PSPTFKESRYQQNQPPGDLAVDSINRYLFVTVITDGTCSIERYWLDGTQK
FTVISSTNDFWPRGLALDEYRQQLYFVDTVKGDMISVNYHGGSKRILAQK
FQEFISLSYFDNFIYWTELETLSIHSVKFDGSMRSLVTKTRNLDARTMPV
IAVSRNASIDTGSPCYSTSNKCDQLCFPIRGNQHSFSCGCSNRAHVLLNI
SRCSYSSEMIVYFNKSMLITHHLTPNTDKQYIELGKGESDVQVASLQLDH
YRNQIYWINQAANCIMKTASNTDIQRQLKIFCLSSDTISNLAVDFIRNNL
YASVTSSAWSRIMIIRLPFTHSDVSWTNVVVSTKIKNKILGAVSVHSDLK
FLFWFETKTKDRQNVAELFQAHLDGSQPMLIWRGVADIDELVVDEQANYV
CWKSSDSGKIYRYEIVNRKWSEFQLSLDILSKVSSSSSEWLHIYPNSRSL
YLFMADSIYQVTLSDSSSSITRKQLTFISNVGHSAGIRGFSFVSRSIAIS
TKKIALAKSDIGTESVILCPTHNHDNFLTCSQFCLPVESRECGCGSVYSL
SADGATCVDLSDLLMVMTNTGEIIGIRGNILNEKDDEIDFVEWVELSEQP
INAGQKFIDAVYWLSKNIVLRLDNYGFISAVDRTRPYVMIKKYKQLSVQE
HDIKTDTSYSENLYKHFFSKEFSRYSLAIDPISDTLLWSDWVTGIIAAER
LNADKDRIEYLGVIINFRESRRRPLQIAIAPISSSLIWLSADFSKSETND
SSVWHQFWIEMSDLDGNRRSVLVKNPGIPSCLTVDVHSGRIYWIDTKTNK
LMYLHIHWDNYQIRAGHVIGHNMKVTVDSLLSNGVGFSTSSMVVLKKYLF
WTDWFQQIFASISVNSDIKPSAAMGMHFYNLQYLKDKLKTVVRIMARIAP
EDFKSSSLGTLLQNHPCSRASHEMENKRCSHLCLSTLPISLAEEYSFLMT
AQQLDGKFRCSCPVSMSVTHKSRHKIGFCVKSQLVKCDRYQIPCGAGLVF
SKKEGMSVMSCMSVQQRCDSTVDCLDGSDEVGCNTCNISHLYSCSRSDVC
LPITKRCDGVMDCDSDEQCCGSQKFECLSGKDVTRCLPISARCNGIVDCR
DGSDEHGCNRNNRNRALSTLDPATVINLPNNYTVAIIAGSVALSACSFAI
IYICLSRRIRHKTVHESCLFRANNVNIMFMSNTANRRPRPYRSSSTCDRH
NLSPTINLHHAKSCDIIDNINGYDAHDPTTQSLTSLSECYRQIKNPQPCP
YASILGRPLFSMQDDVLFQLSRFRPLITHCASNSSIKKIEKLPPSEVTIN
SDTGDKQDDPIDKNNEILSSPCESELEEIYVHRYQMSRQPTQFDNYPSCL
LQNLLSACNQTPQLCNTPTTVYKDLVVENVYRRKRRKLLKYRKPRSFSKG
KLSLSSSRRTRSDRSQYTSEFYQNSSSNLDISPPPPSPITVELA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR019774Aromatic-AA_hydroxylase_C
IPR002172LDrepeatLR_classA_rpt
IPR000742EGF-like_dom
IPR000033LDLR_classB_rpt
IPR0110426-blade_b-propeller_TolB-like
IPR023415LDLR_class-A_CS
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0001702gastrulation with mouth forming second
GO:0001944vasculature development
GO:0002053positive regulation of mesenchymal cell proliferation
GO:0002076osteoblast development
GO:0006007glucose catabolic process
GO:0006897endocytosis
GO:0007275multicellular organism development
GO:0008203cholesterol metabolic process
GO:0008217regulation of blood pressure
GO:0008284positive regulation of cell proliferation
GO:0009952anterior/posterior pattern specification
GO:0016055Wnt signaling pathway
GO:0033690positive regulation of osteoblast proliferation
GO:0035019somatic stem cell population maintenance
GO:0035108limb morphogenesis
GO:0035426extracellular matrix-cell signaling
GO:0042074cell migration involved in gastrulation
GO:0042632cholesterol homeostasis
GO:0042733embryonic digit morphogenesis
GO:0042981regulation of apoptotic process
GO:0043434response to peptide hormone
GO:0044332Wnt signaling pathway involved in dorsal/ventral axis specification
GO:0045600positive regulation of fat cell differentiation
GO:0045668negative regulation of osteoblast differentiation
GO:0045840positive regulation of mitotic nuclear division
GO:0045893positive regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0046849bone remodeling
GO:0046850regulation of bone remodeling
GO:0048539bone marrow development
GO:0051091positive regulation of sequence-specific DNA binding transcription factor activity
GO:0060033anatomical structure regression
GO:0060042retina morphogenesis in camera-type eye
GO:0060070canonical Wnt signaling pathway
GO:0060348bone development
GO:0060349bone morphogenesis
GO:0060444branching involved in mammary gland duct morphogenesis
GO:0060603mammary gland duct morphogenesis
GO:0060612adipose tissue development
GO:0060764cell-cell signaling involved in mammary gland development
GO:0060828regulation of canonical Wnt signaling pathway
GO:0061178regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0061299retina vasculature morphogenesis in camera-type eye
GO:0061304retinal blood vessel morphogenesis
GO:0071901negative regulation of protein serine/threonine kinase activity
GO:1902262apoptotic process involved in blood vessel morphogenesis
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0005515protein binding
GO:0017147Wnt-protein binding
GO:0042813Wnt-activated receptor activity
GO:0071936coreceptor activity involved in Wnt signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005783endoplasmic reticulum
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0043235receptor complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPRINTSPR00261LDLRECEPTORcoord: 1498..1519
score: 33.15
coord: 1534..1555
score: 49.33
coord: 1459..1480
score: 45.57
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 1485..1522
e-value: 0.032
score: 17.6
coord: 1526..1560
e-value: 1.8E-5
score: 34.2
coord: 1436..1484
e-value: 0.016
score: 20.2
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPFAMPF00057Ldl_recept_acoord: 1520..1558
e-value: 2.5E-8
score: 34.0
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 1436..1484
score: 10.312
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 1519..1559
score: 12.25
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 1520..1558
e-value: 2.56534E-10
score: 54.9054
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 1437..1483
e-value: 2.46653E-5
score: 41.0382
IPR000033LDLR class B repeatSMARTSM00135LY_2coord: 170..211
e-value: 4.9
score: 12.6
coord: 545..584
e-value: 0.42
score: 19.7
coord: 1278..1319
e-value: 140.0
score: 0.6
coord: 1115..1156
e-value: 5.9
score: 12.0
coord: 1220..1261
e-value: 3.9
score: 13.4
coord: 75..117
e-value: 5.6E-6
score: 35.9
coord: 453..500
e-value: 64.0
score: 3.3
coord: 126..169
e-value: 3.1E-5
score: 33.4
coord: 502..544
e-value: 0.0014
score: 27.9
coord: 828..870
e-value: 100.0
score: 1.6
coord: 1164..1219
e-value: 31.0
score: 6.0
coord: 399..439
e-value: 1.8
score: 16.3
IPR000742EGF-like domainSMARTSM00181egf_5coord: 968..1008
e-value: 64.0
score: 6.8
coord: 286..322
e-value: 40.0
score: 9.1
coord: 614..654
e-value: 76.0
score: 5.9
coord: 1366..1430
e-value: 37.0
score: 9.5
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 319..656
e-value: 1.5E-47
score: 164.3
coord: 22..318
e-value: 3.5E-42
score: 146.6
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 1066..1426
e-value: 7.2E-24
score: 86.6
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 657..897
e-value: 5.4E-15
score: 57.1
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 969..1018
e-value: 2.9E-5
score: 26.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1849..1894
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1849..1880
NoneNo IPR availablePANTHERPTHR46513FAMILY NOT NAMEDcoord: 972..1306
coord: 286..767
coord: 82..209
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.503
NoneNo IPR availableSUPERFAMILYSSF63825YWTD domaincoord: 1119..1307
NoneNo IPR availableSUPERFAMILYSSF63825YWTD domaincoord: 330..580
NoneNo IPR availableSUPERFAMILYSSF63825YWTD domaincoord: 72..251
NoneNo IPR availableSUPERFAMILYSSF63825YWTD domaincoord: 692..879
NoneNo IPR availableTMHMMTMhelixcoord: 1583..1605
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 1518..1563
e-value: 9.6E-9
score: 36.9
coord: 1432..1489
e-value: 1.8E-6
score: 29.6
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 1437..1483
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 1519..1560
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 1536..1558