Dynein heavy chain

Overview
NameDynein heavy chain
Smed IDSMED30019747
Length (bp)906
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain (SMED30019747) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain (SMED30019747) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain (SMED30019747) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain (SMED30019747) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30019747

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30019747SMESG000056476.1 SMESG000034533.1 SMESG000018120.1 SMESG000013850.1 SMESG000007807.1 SMESG000073407.1 Contig36149newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30019747SMESG000056476.1 SMESG000034533.1 SMESG000018120.1 SMESG000013850.1 SMESG000007807.1 SMESG000073407.1 Contig36149uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 76.2554 bits (186), Expect = 1.037e-14
Identity = 50/191 (26.18%), Postives = 99/191 (51.83%), Query Frame = 2
Query:   95 IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTF-SPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNII 664
            +PEL+R V+LQE  +L+    ++ +L+ Y  +  +++    V+L++  + LL +   G   LNW+SL   +YIT C  A+ K E  +  + K    I + L+ ++ +NLF+     S   +   KEF ++ E+ R +D + +  +    +  +L ++E  +  T T +   +   Y   E ++Y+ L+ +I
Sbjct:  748 VPELARNVALQEDKFLRYTAGIQRMLDHYHMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHM-VRWYLAIGPLLTKVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTKLI 937          
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 76.2554 bits (186), Expect = 1.057e-14
Identity = 50/191 (26.18%), Postives = 99/191 (51.83%), Query Frame = 2
Query:   95 IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTF-SPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNII 664
            +PEL+R V+LQE  +L+    ++ +L+ Y  +  +++    V+L++  + LL +   G   LNW+SL   +YIT C  A+ K E  +  + K    I + L+ ++ +NLF+     S   +   KEF ++ E+ R +D + +  +    +  +L ++E  +  T T +   +   Y   E ++Y+ L+ +I
Sbjct:  805 VPELARNVALQEDKFLRYTAGIQRMLDHYHMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHM-VRWYLAIGPLLTKVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTKLI 994          
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 76.2554 bits (186), Expect = 1.095e-14
Identity = 50/191 (26.18%), Postives = 99/191 (51.83%), Query Frame = 2
Query:   95 IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTF-SPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNII 664
            +PEL+R V+LQE  +L+    ++ +L+ Y  +  +++    V+L++  + LL +   G   LNW+SL   +YIT C  A+ K E  +  + K    I + L+ ++ +NLF+     S   +   KEF ++ E+ R +D + +  +    +  +L ++E  +  T T +   +   Y   E ++Y+ L+ +I
Sbjct:  687 VPELARNVALQEDKFLRYTAGIQRMLDHYHMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHM-VRWYLAIGPLLTKVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTKLI 876          
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 75.8702 bits (185), Expect = 1.412e-14
Identity = 50/191 (26.18%), Postives = 99/191 (51.83%), Query Frame = 2
Query:   95 IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTF-SPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNII 664
            +PEL+R V+LQE  +L+    ++ +L+ Y  +  +++    V+L++  + LL +   G   LNW+SL   +YIT C  A+ K E  +  + K    I + L+ ++ +NLF+     S   +   KEF ++ E+ R +D + +  +    +  +L ++E  +  T T +   +   Y   E ++Y+ L+ +I
Sbjct:  562 VPELARNVALQEDKFLRYTAGIQRMLDHYHMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHM-VRWYLAIGPLLTKVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTKLI 751          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: DNAH10 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 56.9954 bits (136), Expect = 1.724e-8
Identity = 49/225 (21.78%), Postives = 104/225 (46.22%), Query Frame = 2
Query:   68 IISQIYDLD-----IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFR-----RTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFHRYHNGRTS 712
            IIS+   LD     +P+  + V+LQE  +L+ +  L+ ++ RY  +  +++    +++ + ++ L  +L  G   +NW++L   ++I   N A  K E     ++K    I++ L  ++  NLF+     +T + P      +EF ++ E  R     +L   +   +  +L ++E  +  T T +   M + Y   E +++  L+ ++      F+    G T 
Sbjct:  522 IISEAKCLDRIGIVLPDELQNVALQEEVFLRYINGLKKLVRRYHLLMDNLNDAEFLLMADQVQELRQVLSVGCKRINWNNLGIPQFIQRGNQAASKFESLENQIQKNERDIDDKLKSIESANLFKFPLADQTGYLP----GIREFCEFIESERAKTVNLLVN-MYAAISPLLTKMESLIMGTSTGKAKGMAQFYAYWERKIFDSLTKMVFQNIQAFNTALMGNTP 741          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: si:dkeyp-86b9.1 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 56.6102 bits (135), Expect = 1.762e-8
Identity = 49/225 (21.78%), Postives = 104/225 (46.22%), Query Frame = 2
Query:   68 IISQIYDLD-----IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFR-----RTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFHRYHNGRTS 712
            IIS+   LD     +P+  + V+LQE  +L+ +  L+ ++ RY  +  +++    +++ + ++ L  +L  G   +NW++L   ++I   N A  K E     ++K    I++ L  ++  NLF+     +T + P      +EF ++ E  R     +L   +   +  +L ++E  +  T T +   M + Y   E +++  L+ ++      F+    G T 
Sbjct:  828 IISEAKCLDRIGIVLPDELQNVALQEEVFLRYINGLKKLVRRYHLLMDNLNDAEFLLMADQVQELRQVLSVGCKRINWNNLGIPQFIQRGNQAASKFESLENQIQKNERDIDDKLKSIESANLFKFPLADQTGYLP----GIREFCEFIESERAKTVNLLVN-MYAAISPLLTKMESLIMGTSTGKAKGMAQFYAYWERKIFDSLTKMVFQNIQAFNTALMGNTP 1047          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: DNAH10 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 56.6102 bits (135), Expect = 1.762e-8
Identity = 49/225 (21.78%), Postives = 104/225 (46.22%), Query Frame = 2
Query:   68 IISQIYDLD-----IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFR-----RTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFHRYHNGRTS 712
            IIS+   LD     +P+  + V+LQE  +L+ +  L+ ++ RY  +  +++    +++ + ++ L  +L  G   +NW++L   ++I   N A  K E     ++K    I++ L  ++  NLF+     +T + P      +EF ++ E  R     +L   +   +  +L ++E  +  T T +   M + Y   E +++  L+ ++      F+    G T 
Sbjct:  828 IISEAKCLDRIGIVLPDELQNVALQEEVFLRYINGLKKLVRRYHLLMDNLNDAEFLLMADQVQELRQVLSVGCKRINWNNLGIPQFIQRGNQAASKFESLENQIQKNERDIDDKLKSIESANLFKFPLADQTGYLP----GIREFCEFIESERAKTVNLLVN-MYAAISPLLTKMESLIMGTSTGKAKGMAQFYAYWERKIFDSLTKMVFQNIQAFNTALMGNTP 1047          
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:100492440])

HSP 1 Score: 85.5001 bits (210), Expect = 8.174e-18
Identity = 57/204 (27.94%), Postives = 104/204 (50.98%), Query Frame = 2
Query:   86 DLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFR---RTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFH 688
               + EL R V+LQE  +L+    ++ ++  Y+ +  S+    I +L+E I  +  +   G   LNW+SL   +YIT CN A+ K E  +  ++K    I+  LS ++  NLF+   +TT +   +   KEF +Y +  R  D +IL  K +  +  +L ++E  + +T T +   M++ Y   E R+Y  L+ ++     +F+
Sbjct:  705 GFSVGELPRNVALQEDKFLRYTDDMKHMIAAYEKLMGSLSEAEIQLLDEHIRDVWKVFRSGYRRLNWNSLGIGDYITRCNQAISKFESLVNKIQKNAKDIDLKLSAIESANLFKFMAKTTGT--DLSGVKEFFEYIDIERAKDVDILERKYST-IGQLLTKIEGLVVNTNTGKHPKMSQYYAHWEKRIYNSLTKMVLRNFQVFN 905          
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:100492440])

HSP 1 Score: 85.5001 bits (210), Expect = 8.569e-18
Identity = 57/204 (27.94%), Postives = 104/204 (50.98%), Query Frame = 2
Query:   86 DLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFR---RTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFH 688
               + EL R V+LQE  +L+    ++ ++  Y+ +  S+    I +L+E I  +  +   G   LNW+SL   +YIT CN A+ K E  +  ++K    I+  LS ++  NLF+   +TT +   +   KEF +Y +  R  D +IL  K +  +  +L ++E  + +T T +   M++ Y   E R+Y  L+ ++     +F+
Sbjct:  762 GFSVGELPRNVALQEDKFLRYTDDMKHMIAAYEKLMGSLSEAEIQLLDEHIRDVWKVFRSGYRRLNWNSLGIGDYITRCNQAISKFESLVNKIQKNAKDIDLKLSAIESANLFKFMAKTTGT--DLSGVKEFFEYIDIERAKDVDILERKYST-IGQLLTKIEGLVVNTNTGKHPKMSQYYAHWEKRIYNSLTKMVLRNFQVFN 962          
BLAST of Dynein heavy chain vs. Ensembl Mouse
Match: Dnah10 (dynein, axonemal, heavy chain 10 [Source:MGI Symbol;Acc:MGI:1860299])

HSP 1 Score: 73.1738 bits (178), Expect = 8.404e-14
Identity = 51/191 (26.70%), Postives = 94/191 (49.21%), Query Frame = 2
Query:   95 IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFR-RTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNII 664
            IPEL+R V+LQE  +L+    ++ +L+ Y  +  +++     +L++  + LL +   G   LNW+SL   +YIT C  A+ K E  +  + K    I + L+ ++ V+LFR     +   +   KEF +Y E+ R  D + +  +    +  +L ++E  +  T T     +   Y   E ++Y  L  +I
Sbjct:  750 IPELARNVALQEDKFLRYTEGIQRMLDHYHLLINTLNEAETALLDDHSQELLRVFRSGYKRLNWNSLGISDYITRCKQAIGKFETLVHQIHKNADDINSRLTLIESVSLFRFPVAKTADGVPGVKEFFEYIERERARDVDHM-VRWYMAIGPLLTKVEGLVVHTNTGRAPKLASYYEYWEGKIYDVLVKLI 939          
BLAST of Dynein heavy chain vs. Ensembl Mouse
Match: Dnah10 (dynein, axonemal, heavy chain 10 [Source:MGI Symbol;Acc:MGI:1860299])

HSP 1 Score: 73.1738 bits (178), Expect = 9.051e-14
Identity = 51/191 (26.70%), Postives = 94/191 (49.21%), Query Frame = 2
Query:   95 IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFR-RTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNII 664
            IPEL+R V+LQE  +L+    ++ +L+ Y  +  +++     +L++  + LL +   G   LNW+SL   +YIT C  A+ K E  +  + K    I + L+ ++ V+LFR     +   +   KEF +Y E+ R  D + +  +    +  +L ++E  +  T T     +   Y   E ++Y  L  +I
Sbjct:  807 IPELARNVALQEDKFLRYTEGIQRMLDHYHLLINTLNEAETALLDDHSQELLRVFRSGYKRLNWNSLGISDYITRCKQAIGKFETLVHQIHKNADDINSRLTLIESVSLFRFPVAKTADGVPGVKEFFEYIERERARDVDHM-VRWYMAIGPLLTKVEGLVVHTNTGRAPKLASYYEYWEGKIYDVLVKLI 996          
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Match: sp|Q8IVF4|DYH10_HUMAN (Dynein heavy chain 10, axonemal OS=Homo sapiens OX=9606 GN=DNAH10 PE=1 SV=4)

HSP 1 Score: 76.2554 bits (186), Expect = 5.259e-14
Identity = 50/191 (26.18%), Postives = 99/191 (51.83%), Query Frame = 2
Query:   95 IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTF-SPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNII 664
            +PEL+R V+LQE  +L+    ++ +L+ Y  +  +++    V+L++  + LL +   G   LNW+SL   +YIT C  A+ K E  +  + K    I + L+ ++ +NLF+     S   +   KEF ++ E+ R +D + +  +    +  +L ++E  +  T T +   +   Y   E ++Y+ L+ +I
Sbjct:  687 VPELARNVALQEDKFLRYTAGIQRMLDHYHMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHM-VRWYLAIGPLLTKVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTKLI 876          
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Match: sp|Q9SMH3|DYH1A_CHLRE (Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 2.851e-7
Identity = 49/193 (25.39%), Postives = 93/193 (48.19%), Query Frame = 2
Query:   95 IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIV---MLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNII 664
            IPE++  V+LQE  +L+ +  L ++L +Y     S+D LT V   ++E  +E L + L  G  +LNW+SL   E+I  C+ A+   +  +K ++K +  IE  +  +    L          +   +EF +  E+ R    E L  K    +  +L ++EE +  T + +   ++  Y   E  ++  L+ ++
Sbjct:  802 IPEIALNVALQEDKFLQWLEGLNSMLFKYYE---SIDQLTPVERELMERKLEELESCLQPGFTILNWNSLGITEFIGTCDKAIATFQQLVKQVQKNSGIIEQVVYAIAGAQLVTEPEEGA-EVMDLQEFYEDIERQRLAALESLVKKYRT-ISPLLGKIEEVVAGTNSGKSPALSSYYSFWERAIFNALNTMV 989          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A183AHT2 (DHC_N1 domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS6517 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.287e-32
Identity = 69/186 (37.10%), Postives = 115/186 (61.83%), Query Frame = 2
Query:   77 QIYDLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEV 634
            ++++L +PE++R + L+  +Y   VL L+ +++RY+ IR  +D L + ++E  +  L+  +DRG F LNWDSL  DEY+ +C+  L + E  +K++++C   +E   + + R  +F+        + SAKE++DYAE CREND E LA +I+    S L +LEE+L+DT T   + M  +Y R EV
Sbjct:  335 ELFNLPLPEIARFLGLRHSYYQNMVLQLQRMVDRYEEIRAQLDPLKVTLMENSLRNLVNTIDRGVFYLNWDSLVVDEYLEHCDRRLKRAENHIKEVDRCFDILERIGTLISRAQMFKEKENG--QLVSAKEYMDYAESCRENDMEELANQISTMATSCLGKLEEALFDTNTGRRAEMYPIYQRFEV 518          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A504YY86 (Dynein heavy chain 10 axonemal OS=Fasciola gigantica OX=46835 GN=FGIG_02111 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.034e-32
Identity = 73/210 (34.76%), Postives = 122/210 (58.10%), Query Frame = 2
Query:   77 QIYDLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFHRYHNGR 706
            ++++L +PE++R + L+  +Y   VL L+ +++RY+ IR  +D L + ++E  +  L+  +DRG F LNWDSL  DEY+ +C+  L + E  +K++++C   +E   + + R  +F+        + SAKE++DYAE CREND E LA +I+    S L +LEE+L+DT T   + M  +Y R EV +   L  ++      F     GR
Sbjct:   76 ELFNLPLPEIARFIGLRNSYYQNMVLQLQRMVDRYEEIRSQLDPLKVSLMEAGLRTLVNTIDRGVFYLNWDSLVVDEYLEHCDRRLKRAENHIKEIDRCFDILERIGALISRAQMFKEREDG--QLVSAKEYMDYAESCRENDMEELANQISTMATSCLGKLEEALFDTNTGRRTEMYPIYQRFEVMILFRLLEMVLRNMWSFVNALGGR 283          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A4E0RHS9 (Dynein heavy chain OS=Fasciola hepatica OX=6192 GN=D915_001887 PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 3.741e-32
Identity = 73/210 (34.76%), Postives = 122/210 (58.10%), Query Frame = 2
Query:   77 QIYDLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFHRYHNGR 706
            ++++L +PE++R + L+  +Y   VL L+ +++RY+ IR  +D L + ++E  +  L+  +DRG F LNWDSL  DEY+ +C+  L + E  +K++++C   +E   + + R  +F+        + SAKE++DYAE CREND E LA +I+    S L +LEE+L+DT T   + M  +Y R EV +   L  ++      F     GR
Sbjct:  824 ELFNLPLPEIARFIGLRNSYYQNMVLQLQRMVDRYEEIRSQLDPLKVSLMEAGLRTLVNTIDRGVFYLNWDSLVVDEYLEHCDRRLKRAENHIKEIDRCFDILERIGALISRAQMFKEREDG--QLVSAKEYMDYAESCRENDMEELANQISTMATSCLGKLEEALFDTNTGRRTEMYPIYQRFEVMILFRLLEMVLRNMWSFVNALGGR 1031          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A0R3X336 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS7721 PE=4 SV=2)

HSP 1 Score: 127.872 bits (320), Expect = 4.365e-29
Identity = 70/207 (33.82%), Postives = 121/207 (58.45%), Query Frame = 2
Query:   59 IFAIISQIYDLD-----IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNII 664
            I+A I++   L+     +PE++R++ L+  ++   VL L+ I++RY+ +R ++  + + +L   ++  +   DRG   LNWDSL   +++      +  +E + K++ KC   ++    R+KR+NLF+  + +   + SAKEF+DYAE  REND E LAT   N L + L +LEE+L+DT T+ C  M  +Y   E RL + L N++
Sbjct:  991 IWATIAEAARLELLGVRVPEMARLLGLRRRYFQNIVLRLQDIVDRYEGVRRNLSPIKVALLRLTLQDFVAHFDRGVNYLNWDSLAIGDFLELAEKKIQLLETQFKEINKCFSSLDQVCRRIKRMNLFKEQSRA--VLVSAKEFLDYAETARENDMEELATSTQNTLANALGKLEEALFDTSTHRCEQMASVYQMFEQRLLEALVNMV 1195          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A068WR82 (Dynein heavy chain OS=Echinococcus granulosus OX=6210 GN=EgrG_000536600 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.231e-29
Identity = 69/207 (33.33%), Postives = 121/207 (58.45%), Query Frame = 2
Query:   59 IFAIISQIYDLD-----IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNII 664
            I+A I++   L+     IPE++R++ L+  ++   VL L+ I++RY+ +R ++  +   +L+  +   +   DRG   LNWDSL  D+++      +  +E + K++ +C   ++ +  ++KR+NLF+  + +   + SAKEF+DYAE  REND E LAT   N L + L +LEE+L+DT T+ C  M  +Y   E  L + L N++
Sbjct: 1003 IWAAIAEAARLEMLGMRIPEMARLLGLRRRYFQFLVLRLQDIVDRYEAVRRNLSPIKAALLQLTLRDFIAHFDRGVNYLNWDSLAIDDFLELAEKKIQSLETQFKEINRCFASLQQACCKIKRINLFKEQSRAV--LVSAKEFLDYAEAARENDMEELATATQNTLANALSKLEEALFDTSTHRCEQMASVYLMFEQGLLEALVNMV 1207          
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 70.4774 bits (171), Expect = 4.528e-13
Identity = 57/221 (25.79%), Postives = 104/221 (47.06%), Query Frame = 2
Query:   68 IISQIYDLD-----IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFR-RTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFHRYHNGRTS 712
            IIS+   LD     +PEL+R V+LQE  +L+ V  L+ +++R  ++  S++    ++L   ++ L  +L  G   LNW+SL   E+I     A+ K E  +  ++K    ++  L  ++  NLF+         +   KEF +  E+ R  D  IL + +   +  +L + E  +  T T     M + Y   E ++Y  L+ ++     +F+    G T 
Sbjct:  576 IISETIYLDRLGYAVPELARNVALQEHRFLRCVDELKNLVKRCHSLMDSLNDAEFLLLTPQVQELRRVLRAGWRRLNWNSLGIAEFIGRSEQAVTKFESLVSQIKKNARDVDAKLQDIETANLFKFPAPDKAGDLPGVKEFFELVEKQRVKDV-ILLSLMYTAIGPLLTKTESLIMQTSTGRAESMTQYYAYWERKVYDALTKMVLKNLQVFNTALMGSTP 795          
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004851.1 (pep scaffold:Pmarinus_7.0:GL478972:11642:23229:-1 gene:ENSPMAG00000004406.1 transcript:ENSPMAT00000004851.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 2.279e-15
Identity = 54/191 (28.27%), Postives = 92/191 (48.17%), Query Frame = 2
Query:   95 IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFR-RTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNII 664
            +PEL+R V+LQE  Y + V  L+ +L     +  S       +L+E +  L  +L  G   LNW+SL   +YI+ C  AL K+E  +  ++K    + + L+ ++  +LFR     S   +   KEF +  EQ R  D ++LA +    +  +L ++E  +  T T     +   Y   E R Y+ L  ++
Sbjct:  566 VPELARNVTLQEDKYHRYVEGLKRLLGSLQVVLSSASEAETQLLDEHLHALWKVLLPGYRRLNWNSLGIADYISRCEVALSKLESLVAQVQKNARDVTSKLALIESADLFRFPVAKSDDDVPGVKEFFERVEQARAQDLDVLARRW-LAVGPLLTKVEGVVAGTNTGRSPRLGAYYAYWEGRAYEALRKMV 755          
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 94.3597 bits (233), Expect = 1.710e-21
Identity = 61/199 (30.65%), Postives = 103/199 (51.76%), Query Frame = 2
Query:   95 IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQS-AKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFH 688
            +PEL+R V+LQE  YLK V  L+ +LERY  +  S+D     +L++ I+ L  +L  G+  LNW+SL   +Y+T C  A+ K E  +  ++K    I + L  ++   LF+        I   AKE+ D+ E+ R  + E+LA K    +  +L ++E  +  T T     +   Y   E  +Y+ L+ ++T    +F+
Sbjct:  542 VPELARNVALQEEKYLKYVDGLKLMLERYHTVTGSLDVAETQLLDDNIKELKRVLKPGSKRLNWNSLGISDYVTRCGQAIGKFESLVNQIQKNAKDIYSRLEMIEITELFKTPPPKTNGIMPDAKEYFDFLEKGRSQELEVLARKY-RAIGPLLTKMEGLVAHTNTGRAPKLQPYYAFWENAVYEALTKMVTRNLQVFN 739          
BLAST of Dynein heavy chain vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 50.0618 bits (118), Expect = 2.395e-6
Identity = 45/190 (23.68%), Postives = 86/190 (45.26%), Query Frame = 2
Query:   95 IPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNII 664
            +PEL++ V+LQE H+L  V  L  ++  Y++I   +     +M+   I+     +D G   +N       ++I+    A+   E  L  + K    IE+ L  ++  NL +       +    +EF D+ E+ R     +L+    +  ++I+   E  + DT + + SLM   Y   E R++  L  ++
Sbjct:  533 VPELAQSVALQEEHFL-YVSDLNHLVSSYNSIMEGLSQTHAIMVAPQIKAAQKEIDFGCKRIN-----IADFISRGQKAVSNFETVLNQILKNERDIESKLQSIQTANLLKCPVPDKSNELPIREFCDHLERERVKTVALLSRNYKDIGLTIIMT-EHMIMDTNSGKASLMETYYTYWEKRVFNSLEKMV 715          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000073407.1 (SMESG000073407.1)

HSP 1 Score: 427.557 bits (1098), Expect = 1.009e-142
Identity = 210/216 (97.22%), Postives = 213/216 (98.61%), Query Frame = 2
Query:   65 AIISQIYDLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFHRYHNGRTS 712
            A + ++ DLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFHRYHNGRTS
Sbjct:  802 AKLMELLDLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFHRYHNGRTS 1017          

HSP 2 Score: 65.0846 bits (157), Expect = 1.691e-11
Identity = 28/29 (96.55%), Postives = 29/29 (100.00%), Query Frame = 3
Query:    3 PQDICRIRKSNCNMETVELFSQLFPKYMI 89
            PQDICRIRKSNCNMETVELFSQLFPKYM+
Sbjct:  761 PQDICRIRKSNCNMETVELFSQLFPKYMV 789          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000073407.1 (SMESG000073407.1)

HSP 1 Score: 393.275 bits (1009), Expect = 7.674e-125
Identity = 193/201 (96.02%), Postives = 198/201 (98.51%), Query Frame = 2
Query:   65 AIISQIYDLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIIT 667
            A + ++ DLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSN++T
Sbjct:  802 AKLMELLDLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNMVT 1002          

HSP 2 Score: 65.4698 bits (158), Expect = 1.671e-11
Identity = 28/29 (96.55%), Postives = 29/29 (100.00%), Query Frame = 3
Query:    3 PQDICRIRKSNCNMETVELFSQLFPKYMI 89
            PQDICRIRKSNCNMETVELFSQLFPKYM+
Sbjct:  761 PQDICRIRKSNCNMETVELFSQLFPKYMV 789          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000073407.1 (SMESG000073407.1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.166e-124
Identity = 193/201 (96.02%), Postives = 198/201 (98.51%), Query Frame = 2
Query:   65 AIISQIYDLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIIT 667
            A + ++ DLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSN++T
Sbjct:  802 AKLMELLDLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNMVT 1002          

HSP 2 Score: 65.4698 bits (158), Expect = 1.732e-11
Identity = 28/29 (96.55%), Postives = 29/29 (100.00%), Query Frame = 3
Query:    3 PQDICRIRKSNCNMETVELFSQLFPKYMI 89
            PQDICRIRKSNCNMETVELFSQLFPKYM+
Sbjct:  761 PQDICRIRKSNCNMETVELFSQLFPKYMV 789          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000073430.1 (SMESG000073430.1)

HSP 1 Score: 286.189 bits (731), Expect = 1.841e-87
Identity = 146/222 (65.77%), Postives = 179/222 (80.63%), Query Frame = 2
Query:   59 IFAIISQ-----IYDLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLF-RRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFHRYHNGR 706
            ++AIIS+     + DL IPELSRIV LQEPH+ KTVLALETILERYD IR+S++SL+I+MLE+ +E+LLT+LDRGTFMLNWDSLPF+EYIT CN AL  VE +L DLEKC+ Q+E +LSRLK+VNLF +RT ++  +I SAK+FIDYAEQ REN+CEILA KINNEL SI QRLEESLY+TKT EC+LMNELY+R E  L K LSN++T     F    +G+
Sbjct:  787 LWAIISESKLMELLDLQIPELSRIVGLQEPHFQKTVLALETILERYDKIRISLNSLSIIMLEDSLEILLTVLDRGTFMLNWDSLPFEEYITICNTALSTVETRLYDLEKCDKQVEKTLSRLKKVNLFKKRTAYTEGYIPSAKDFIDYAEQSRENECEILAPKINNELYSIFQRLEESLYNTKTGECALMNELYYRYETELCKALSNMVTRNLWTFINGLSGK 1008          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000073430.1 (SMESG000073430.1)

HSP 1 Score: 286.189 bits (731), Expect = 1.864e-87
Identity = 146/222 (65.77%), Postives = 179/222 (80.63%), Query Frame = 2
Query:   59 IFAIISQ-----IYDLDIPELSRIVSLQEPHYLKTVLALETILERYDNIRMSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKVEIKLKDLEKCNMQIENSLSRLKRVNLF-RRTTFSPFHIQSAKEFIDYAEQCRENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLYKELSNIITHKSIIFHRYHNGR 706
            ++AIIS+     + DL IPELSRIV LQEPH+ KTVLALETILERYD IR+S++SL+I+MLE+ +E+LLT+LDRGTFMLNWDSLPF+EYIT CN AL  VE +L DLEKC+ Q+E +LSRLK+VNLF +RT ++  +I SAK+FIDYAEQ REN+CEILA KINNEL SI QRLEESLY+TKT EC+LMNELY+R E  L K LSN++T     F    +G+
Sbjct:  800 LWAIISESKLMELLDLQIPELSRIVGLQEPHFQKTVLALETILERYDKIRISLNSLSIIMLEDSLEILLTVLDRGTFMLNWDSLPFEEYITICNTALSTVETRLYDLEKCDKQVEKTLSRLKKVNLFKKRTAYTEGYIPSAKDFIDYAEQSRENECEILAPKINNELYSIFQRLEESLYNTKTGECALMNELYYRYETELCKALSNMVTRNLWTFINGLSGK 1021          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DNAH101.037e-1426.18dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH101.057e-1426.18dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH101.095e-1426.18dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH101.412e-1426.18dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein heavy chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DNAH101.724e-821.78si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
si:dkeyp-86b9.11.762e-821.78si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
DNAH101.762e-821.78si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
DNAH108.174e-1827.94dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
DNAH108.569e-1827.94dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Dnah108.404e-1426.70dynein, axonemal, heavy chain 10 [Source:MGI Symbo... [more]
Dnah109.051e-1426.70dynein, axonemal, heavy chain 10 [Source:MGI Symbo... [more]
back to top
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8IVF4|DYH10_HUMAN5.259e-1426.18Dynein heavy chain 10, axonemal OS=Homo sapiens OX... [more]
sp|Q9SMH3|DYH1A_CHLRE2.851e-725.39Dynein-1-alpha heavy chain, flagellar inner arm I1... [more]
back to top
BLAST of Dynein heavy chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183AHT22.287e-3237.10DHC_N1 domain-containing protein OS=Echinostoma ca... [more]
A0A504YY863.034e-3234.76Dynein heavy chain 10 axonemal OS=Fasciola giganti... [more]
A0A4E0RHS93.741e-3234.76Dynein heavy chain OS=Fasciola hepatica OX=6192 GN... [more]
A0A0R3X3364.365e-2933.82Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A068WR826.231e-2933.33Dynein heavy chain OS=Echinococcus granulosus OX=6... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkeyp-86b9.14.528e-1325.79dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004851.12.279e-1528.27pep scaffold:Pmarinus_7.0:GL478972:11642:23229:-1 ... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO358521.710e-2130.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkeyp-86b9.12.395e-623.68dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
back to top
BLAST of Dynein heavy chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073407.11.009e-14297.22SMESG000073407.1[more]
SMESG000073407.17.674e-12596.02SMESG000073407.1[more]
SMESG000073407.11.166e-12496.02SMESG000073407.1[more]
SMESG000073430.11.841e-8765.77SMESG000073430.1[more]
SMESG000073430.11.864e-8765.77SMESG000073430.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30019747 ID=SMED30019747|Name=Dynein heavy chain|organism=Schmidtea mediterranea sexual|type=transcript|length=906bp
AACCTCAAGATATATGTCGAATTAGAAAATCCAATTGCAATATGGAAACT
GTAGAATTATTTTCGCAATTATTTCCCAAATATATGATTTAGACATTCCT
GAATTATCAAGGATTGTTTCTTTGCAAGAGCCACATTATCTGAAAACAGT
ATTAGCACTTGAAACCATTTTGGAACGATACGATAACATTAGAATGTCGG
TTGACAGTCTAACAATTGTCATGTTAGAAGAGTTCATTGAAGTTCTTCTT
ACTCTACTTGACCGTGGTACATTTATGCTAAATTGGGACAGTTTACCATT
CGATGAATACATTACAAACTGCAATGCGGCTTTACTTAAAGTAGAAATTA
AATTAAAAGATTTAGAAAAATGCAATATGCAAATTGAAAATTCCCTTTCT
AGATTAAAAAGAGTAAATTTATTCCGAAGAACAACTTTTAGCCCTTTTCA
CATACAATCGGCAAAAGAATTTATCGACTATGCTGAACAATGCCGAGAAA
ATGATTGTGAAATTCTAGCAACAAAAATAAACAATGAATTAATTAGTATT
CTTCAACGTTTGGAAGAAAGCTTATACGATACAAAAACCAATGAATGCTC
ATTAATGAATGAACTTTATTTTCGATGTGAAGTTCGTTTGTATAAAGAGT
TATCCAATATTATTACGCACAAGAGTATCATATTTCACCGATATCATAAC
GGAAGAACTTCTTGAGATGCACTCCGACAATGTTCAAAGATCTGGTGATA
GATGTGATCCATATTGTATTACTTGAAAAGACTCAATGAGAGTAACATCT
TTAAATGGGTCTCCATGTTGCCATGATTTCAAACATTACCAAACAATCCA
TATATTGTTAACTGAAATGCGTAAAGTATATTACCCAGACATTTTTGATT
TGAAAC
back to top

protein sequence of SMED30019747-orf-1

>SMED30019747-orf-1 ID=SMED30019747-orf-1|Name=SMED30019747-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=174bp
MSVDSLTIVMLEEFIEVLLTLLDRGTFMLNWDSLPFDEYITNCNAALLKV
EIKLKDLEKCNMQIENSLSRLKRVNLFRRTTFSPFHIQSAKEFIDYAEQC
RENDCEILATKINNELISILQRLEESLYDTKTNECSLMNELYFRCEVRLY
KELSNIITHKSIIFHRYHNGRTS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003777microtubule motor activity
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
GO:0005930axoneme
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement